F458140

General Info

Members Datasets Scaffolds Average Seq Length
517 225 1034 160

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10392309|Ga0207661_103923092
Length 173
Sequence MEIVIRSLVIFVFLWIVTRAVGRSSLGELSTFQLLLYVTMGDLVQQAITQQDYSVTAGILAVSTFALLTVFFGWINWRFPRTRPVIHGLPLVIVKGGEPQLDAMARERMTMTDLYAQARQQGIGNISDIDIAVLETDGKVSFFTKNGDSDGAIFHVHPLKTGLHTSGDTKRHK

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
96 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.78
Metatranscriptomes 5.03
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 0
Rhizoplane 10.44
Rhizosphere 85.11
Stem 0
Stem Tuber 0
Unclassified 6.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10392309 3300025944 Bacteria 1258
2 JGI24740J21852_10021231 3300001979 Bacteria 2253
3 JGI24735J21928_10163981 3300002067 Bacteria 642
4 rootL2_10220255 3300003322 Bacteria 1236
5 Ga0058861_11678786 3300004800 Bacteria 966
6 Ga0058861_11907541 3300004800 Unclassified 1078
7 Ga0058860_12223778 3300004801 Unclassified 694
8 Ga0070658_10016964 3300005327 Bacteria 5827
9 Ga0070658_10064525 3300005327 Bacteria 2987
10 Ga0070658_10491349 3300005327 Bacteria 1059
11 Ga0070676_10127786 3300005328 Bacteria 1604
12 Ga0070683_100059671 3300005329 Bacteria 3544
13 Ga0070683_100085373 3300005329 Bacteria 2959
14 Ga0070683_100092722 3300005329 Bacteria 2837
15 Ga0070683_100259985 3300005329 Bacteria 1651
16 Ga0070683_100280013 3300005329 Bacteria 1586
17 Ga0070683_100440178 3300005329 Bacteria 1244
18 Ga0070683_101074476 3300005329 Bacteria 773
19 Ga0070690_101137802 3300005330 Bacteria 620
20 Ga0070670_100083026 3300005331 Bacteria 2753
21 Ga0070670_100615217 3300005331 Bacteria 973
22 Ga0068869_100010662 3300005334 Bacteria 5998
23 Ga0070680_100002942 3300005336 Bacteria 12662
24 Ga0070680_100226343 3300005336 Bacteria 1579
25 Ga0070680_100377419 3300005336 Bacteria 1207
26 Ga0070680_100894207 3300005336 Bacteria 766
27 Ga0070682_100007040 3300005337 Bacteria 6327
28 Ga0070682_100016087 3300005337 Bacteria 4345
29 Ga0070682_100049210 3300005337 Bacteria 2627
30 Ga0070682_100236858 3300005337 Unclassified 1308
31 Ga0070682_100309406 3300005337 Bacteria 1162
32 Ga0070682_100468356 3300005337 Bacteria 969
33 Ga0070682_100531333 3300005337 Bacteria 917
34 Ga0068868_100068693 3300005338 Bacteria 2822
35 Ga0068868_100093060 3300005338 Bacteria 2430
36 Ga0068868_100562021 3300005338 Bacteria 1007
37 Ga0070660_100005955 3300005339 Bacteria 8431
38 Ga0070660_100010799 3300005339 Bacteria 6464
39 Ga0070660_100330827 3300005339 Bacteria 1253
40 Ga0070660_100369181 3300005339 Bacteria 1184
41 Ga0070687_100247036 3300005343 Bacteria 1106
42 Ga0070687_100261707 3300005343 Bacteria 1080
43 Ga0070661_100391638 3300005344 Bacteria 1097
44 Ga0070692_10034326 3300005345 Bacteria 2562
45 Ga0070692_10048409 3300005345 Bacteria 2202
46 Ga0070692_10651519 3300005345 Bacteria 703
47 Ga0070668_100039232 3300005347 Bacteria 3622
48 Ga0070668_101180109 3300005347 Bacteria 693
49 Ga0070669_100340881 3300005353 Bacteria 1215
50 Ga0070675_100265835 3300005354 Bacteria 1504
51 Ga0070675_100968458 3300005354 Bacteria 781
52 Ga0070671_100000553 3300005355 Bacteria 26489
53 Ga0070674_100430888 3300005356 Bacteria 1084
54 Ga0070688_100337362 3300005365 Bacteria 1100
55 Ga0070659_100026748 3300005366 Bacteria 4441
56 Ga0070667_100113261 3300005367 Bacteria 2354
57 Ga0070714_101221965 3300005435 Bacteria 733
58 Ga0070663_100067442 3300005455 Bacteria 2595
59 Ga0070663_100278314 3300005455 Bacteria 1332
60 Ga0070663_101400598 3300005455 Bacteria 619
61 Ga0070663_101569739 3300005455 Bacteria 586
62 Ga0070678_100592740 3300005456 Bacteria 989
63 Ga0070678_101766839 3300005456 Bacteria 583
64 Ga0070662_100610512 3300005457 Bacteria 918
65 Ga0070662_100759117 3300005457 Bacteria 823
66 Ga0070662_100821101 3300005457 Bacteria 791
67 Ga0070681_10000025 3300005458 Bacteria 110322
68 Ga0070681_10086299 3300005458 Bacteria 3092
69 Ga0070681_10673988 3300005458 Bacteria 949
70 Ga0070681_10886946 3300005458 Bacteria 810
71 Ga0070681_11081981 3300005458 Bacteria 722
72 Ga0070681_11451749 3300005458 Bacteria 610
73 Ga0070685_10022152 3300005466 Bacteria 3460
74 Ga0070685_10071207 3300005466 Bacteria 2061
75 Ga0070685_10673825 3300005466 Bacteria 752
76 Ga0070679_100002372 3300005530 Bacteria 17068
77 Ga0070679_100036127 3300005530 Bacteria 4903
78 Ga0070679_100040822 3300005530 Bacteria 4617
79 Ga0070679_100092235 3300005530 Bacteria 3017
80 Ga0070679_100210770 3300005530 Unclassified 1907
81 Ga0070679_100449926 3300005530 Bacteria 1233
82 Ga0070679_100719642 3300005530 Bacteria 941
83 Ga0070684_100006111 3300005535 Bacteria 9279
84 Ga0070684_100147873 3300005535 Bacteria 2127
85 Ga0070684_100330526 3300005535 Bacteria 1401
86 Ga0070684_100533455 3300005535 Unclassified 1088
87 Ga0070684_100605015 3300005535 Bacteria 1019
88 Ga0068853_101131752 3300005539 Bacteria 755
89 Ga0068853_101167663 3300005539 Bacteria 743
90 Ga0070672_100222921 3300005543 Bacteria 1582
91 Ga0070672_101144361 3300005543 Bacteria 692
92 Ga0070686_100153290 3300005544 Bacteria 1616
93 Ga0070686_100339860 3300005544 Bacteria 1125
94 Ga0070693_100700172 3300005547 Bacteria 742
95 Ga0070665_100039101 3300005548 Bacteria 4770
96 Ga0070665_100749638 3300005548 Bacteria 989
97 Ga0070665_100837751 3300005548 Bacteria 933
98 Ga0070665_101766998 3300005548 Bacteria 625
99 Ga0068855_100238509 3300005563 Bacteria 2033
100 Ga0070664_100111991 3300005564 Bacteria 2383
101 Ga0070664_100518207 3300005564 Bacteria 1100
102 Ga0070664_101207741 3300005564 Unclassified 713
103 Ga0068857_100027136 3300005577 Bacteria 5052
104 Ga0068857_100136884 3300005577 Bacteria 2212
105 Ga0068857_100703067 3300005577 Bacteria 960
106 Ga0068854_100032380 3300005578 Bacteria 3638
107 Ga0068854_100074939 3300005578 Bacteria 2483
108 Ga0068856_100053916 3300005614 Bacteria 3965
109 Ga0070702_100069139 3300005615 Bacteria 2080
110 Ga0070702_100371255 3300005615 Bacteria 1014
111 Ga0068852_100059649 3300005616 Bacteria 3309
112 Ga0068852_100065395 3300005616 Bacteria 3172
113 Ga0068852_100068010 3300005616 Bacteria 3116
114 Ga0068852_101111124 3300005616 Bacteria 811
115 Ga0068859_100250458 3300005617 Bacteria 1862
116 Ga0068864_100047420 3300005618 Bacteria 3690
117 Ga0068864_100086235 3300005618 Bacteria 2762
118 Ga0068866_10302673 3300005718 Bacteria 999
119 Ga0068851_10334202 3300005834 Bacteria 878
120 Ga0068870_10436357 3300005840 Bacteria 860
121 Ga0068863_100224161 3300005841 Bacteria 1812
122 Ga0068863_100779050 3300005841 Bacteria 953
123 Ga0068858_100076469 3300005842 Bacteria 3109
124 Ga0068858_101379751 3300005842 Bacteria 694
125 Ga0068860_100166569 3300005843 Bacteria 2128
126 Ga0068860_100231759 3300005843 Bacteria 1795
127 Ga0068860_100299548 3300005843 Bacteria 1575
128 Ga0068862_101173551 3300005844 Bacteria 765
129 Ga0081455_10020739 3300005937 Bacteria 6180
130 Ga0075365_10001922 3300006038 Bacteria 9800
131 Ga0075365_10017282 3300006038 Bacteria 4410
132 Ga0075365_10114956 3300006038 Bacteria 1852
133 Ga0075365_10135240 3300006038 Bacteria 1708
134 Ga0075363_100000556 3300006048 Bacteria 12158
135 Ga0075363_100191987 3300006048 Bacteria 1165
136 Ga0075370_10002681 3300006353 Bacteria 8328
137 Ga0068871_100082054 3300006358 Bacteria 2673
138 Ga0068865_100043280 3300006881 Bacteria 3075
139 Ga0068865_100141458 3300006881 Bacteria 1815
140 Ga0097620_100250471 3300006931 Bacteria 1862
141 Ga0111539_11091355 3300009094 Bacteria 927
142 Ga0105245_10011247 3300009098 Bacteria 7792
143 Ga0105245_10052901 3300009098 Bacteria 3643
144 Ga0105245_11606483 3300009098 Unclassified 702
145 Ga0105247_10334273 3300009101 Unclassified 1061
146 Ga0105247_10450208 3300009101 Bacteria 928
147 Ga0105243_10015441 3300009148 Bacteria 5771
148 Ga0105243_10468063 3300009148 Bacteria 1187
149 Ga0105243_10720122 3300009148 Bacteria 975
150 Ga0105243_12288347 3300009148 Unclassified 578
151 Ga0105241_11217977 3300009174 Bacteria 714
152 Ga0105242_10579311 3300009176 Bacteria 1080
153 Ga0105242_10949864 3300009176 Bacteria 864
154 Ga0105242_11434541 3300009176 Bacteria 719
155 Ga0105248_10119071 3300009177 Bacteria 2978
156 Ga0105248_10784277 3300009177 Bacteria 1075
157 Ga0105237_10305598 3300009545 Bacteria 1594
158 Ga0105238_10164937 3300009551 Unclassified 2191
159 Ga0105238_10211357 3300009551 Bacteria 1916
160 Ga0105238_10330911 3300009551 Bacteria 1510
161 Ga0105238_12580516 3300009551 Bacteria 544
162 Ga0105249_10052425 3300009553 Bacteria 3725
163 Ga0105249_10064403 3300009553 Bacteria 3370
164 Ga0105239_10014807 3300010375 Bacteria 8650
165 Ga0105239_10019948 3300010375 Bacteria 7398
166 Ga0105239_11499953 3300010375 Bacteria 779
167 Ga0105246_10002931 3300011119 Bacteria 10328
168 Ga0105246_10018069 3300011119 Bacteria 4491
169 Ga0157373_10093045 3300013100 Unclassified 2123
170 Ga0157371_10309073 3300013102 Bacteria 1145
171 Ga0157371_10418913 3300013102 Bacteria 982
172 Ga0157370_10455740 3300013104 Bacteria 1176
173 Ga0157369_10048433 3300013105 Bacteria 4612
174 Ga0157369_10163448 3300013105 Bacteria 2349
175 Ga0157369_10238134 3300013105 Bacteria 1901
176 Ga0157369_10647268 3300013105 Bacteria 1090
177 Ga0157374_10279844 3300013296 Bacteria 1647
178 Ga0157378_10233673 3300013297 Bacteria 1753
179 Ga0163162_10008757 3300013306 Bacteria 9843
180 Ga0163162_10326714 3300013306 Bacteria 1666
181 Ga0163162_10659330 3300013306 Bacteria 1170
182 Ga0157372_10006339 3300013307 Bacteria 12586
183 Ga0157372_10039920 3300013307 Bacteria 5183
184 Ga0157372_10077004 3300013307 Bacteria 3766
185 Ga0157372_10077881 3300013307 Bacteria 3746
186 Ga0157372_10186637 3300013307 Bacteria 2401
187 Ga0157372_10226692 3300013307 Bacteria 2166
188 Ga0157372_10469003 3300013307 Bacteria 1467
189 Ga0157372_10892934 3300013307 Bacteria 1031
190 Ga0157372_11601346 3300013307 Unclassified 750
191 Ga0157375_10008213 3300013308 Bacteria 9137
192 Ga0157375_10322573 3300013308 Bacteria 1709
193 Ga0157375_10409833 3300013308 Bacteria 1522
194 Ga0157375_10605800 3300013308 Bacteria 1254
195 Ga0157375_10856524 3300013308 Bacteria 1055
196 Ga0157375_11437345 3300013308 Bacteria 813
197 Ga0163163_10100164 3300014325 Bacteria 2920
198 Ga0163163_10912250 3300014325 Bacteria 942
199 Ga0157380_10384246 3300014326 Bacteria 1326
200 Ga0157380_10421708 3300014326 Bacteria 1273
201 Ga0157380_10468725 3300014326 Bacteria 1214
202 Ga0182008_10143174 3300014497 Bacteria 1197
203 Ga0157377_10014093 3300014745 Bacteria 4062
204 Ga0157377_10117550 3300014745 Bacteria 1607
205 Ga0157379_10026335 3300014968 Bacteria 5177
206 Ga0157379_10061062 3300014968 Bacteria 3371
207 Ga0157376_10149678 3300014969 Bacteria 2104
208 Ga0163161_10054947 3300017792 Bacteria 2890
209 Ga0197907_10056093 3300020069 Bacteria 1417
210 Ga0197907_10747487 3300020069 Unclassified 1908
211 Ga0206356_10599348 3300020070 Unclassified 535
212 Ga0206356_11335322 3300020070 Unclassified 1567
213 Ga0206356_11609681 3300020070 Bacteria 616
214 Ga0206349_1369627 3300020075 Bacteria 1914
215 Ga0206349_1687648 3300020075 Bacteria 743
216 Ga0206349_1804314 3300020075 Unclassified 857
217 Ga0206355_1282185 3300020076 Bacteria 1132
218 Ga0206355_1294032 3300020076 Unclassified 1122
219 Ga0206351_10480664 3300020077 Unclassified 559
220 Ga0206351_10749310 3300020077 Bacteria 2203
221 Ga0206352_10180487 3300020078 Unclassified 719
222 Ga0206352_10871039 3300020078 Bacteria 1103
223 Ga0206350_10064166 3300020080 Unclassified 1660
224 Ga0206350_10078779 3300020080 Bacteria 1552
225 Ga0206354_10294091 3300020081 Bacteria 1086
226 Ga0206353_10042011 3300020082 Unclassified 1887
227 Ga0206353_11565488 3300020082 Bacteria 1020
228 Ga0154015_1022497 3300020610 Bacteria 680
229 Ga0154015_1635166 3300020610 Unclassified 3572
230 Ga0224712_10032091 3300022467 Bacteria 1912
231 Ga0224712_10081573 3300022467 Bacteria 1336
232 Ga0207688_10012635 3300025901 Bacteria 4595
233 Ga0207688_10040464 3300025901 Bacteria 2590
234 Ga0207688_10121459 3300025901 Bacteria 1525
235 Ga0207688_10261449 3300025901 Bacteria 1050
236 Ga0207647_10009962 3300025904 Bacteria 6731
237 Ga0207647_10018207 3300025904 Bacteria 4759
238 Ga0207647_10041889 3300025904 Bacteria 2876
239 Ga0207647_10201653 3300025904 Bacteria 1151
240 Ga0207643_10134792 3300025908 Bacteria 1472
241 Ga0207705_10092783 3300025909 Bacteria 2213
242 Ga0207705_10529870 3300025909 Bacteria 915
243 Ga0207654_10046686 3300025911 Bacteria 2471
244 Ga0207707_10000023 3300025912 Bacteria 183706
245 Ga0207707_10259073 3300025912 Bacteria 1509
246 Ga0207707_10568377 3300025912 Unclassified 962
247 Ga0207660_10000406 3300025917 Bacteria 28378
248 Ga0207660_10346158 3300025917 Bacteria 1191
249 Ga0207660_11067645 3300025917 Unclassified 658
250 Ga0207660_11511337 3300025917 Unclassified 542
251 Ga0207662_10260533 3300025918 Bacteria 1141
252 Ga0207662_10296969 3300025918 Bacteria 1073
253 Ga0207657_10017453 3300025919 Bacteria 6879
254 Ga0207657_10086834 3300025919 Bacteria 2618
255 Ga0207657_10247105 3300025919 Bacteria 1423
256 Ga0207657_10438386 3300025919 Bacteria 1026
257 Ga0207649_10426778 3300025920 Bacteria 996
258 Ga0207649_10686131 3300025920 Bacteria 793
259 Ga0207652_10000039 3300025921 Bacteria 131660
260 Ga0207652_10060526 3300025921 Bacteria 3267
261 Ga0207652_10078478 3300025921 Unclassified 2883
262 Ga0207652_10156462 3300025921 Bacteria 2042
263 Ga0207652_10331396 3300025921 Bacteria 1374
264 Ga0207652_10331679 3300025921 Bacteria 1374
265 Ga0207652_10670771 3300025921 Bacteria 926
266 Ga0207652_10826236 3300025921 Bacteria 822
267 Ga0207681_10699097 3300025923 Bacteria 843
268 Ga0207694_10674755 3300025924 Unclassified 871
269 Ga0207650_10290896 3300025925 Bacteria 1332
270 Ga0207659_10153298 3300025926 Bacteria 1801
271 Ga0207659_10217527 3300025926 Bacteria 1534
272 Ga0207687_10157992 3300025927 Bacteria 1737
273 Ga0207687_10978399 3300025927 Bacteria 725
274 Ga0207687_11097128 3300025927 Bacteria 683
275 Ga0207690_10149650 3300025932 Bacteria 1729
276 Ga0207706_10072510 3300025933 Bacteria 3029
277 Ga0207706_10236496 3300025933 Bacteria 1597
278 Ga0207686_10851184 3300025934 Bacteria 733
279 Ga0207709_10042633 3300025935 Bacteria 2731
280 Ga0207709_10578098 3300025935 Bacteria 887
281 Ga0207670_10252914 3300025936 Bacteria 1363
282 Ga0207704_10104821 3300025938 Bacteria 1895
283 Ga0207704_10246725 3300025938 Bacteria 1338
284 Ga0207711_10486011 3300025941 Bacteria 1150
285 Ga0207711_11257176 3300025941 Bacteria 682
286 Ga0207689_10002011 3300025942 Bacteria 19208
287 Ga0207689_10255345 3300025942 Bacteria 1450
288 Ga0207661_10029683 3300025944 Bacteria 4204
289 Ga0207661_10338618 3300025944 Bacteria 1355
290 Ga0207661_10613094 3300025944 Bacteria 999
291 Ga0207661_10697206 3300025944 Bacteria 934
292 Ga0207661_11273738 3300025944 Bacteria 676
293 Ga0207679_11052957 3300025945 Bacteria 746
294 Ga0207667_10157018 3300025949 Bacteria 2340
295 Ga0207712_10104945 3300025961 Bacteria 2108
296 Ga0207712_10758100 3300025961 Bacteria 851
297 Ga0207668_10176188 3300025972 Bacteria 1682
298 Ga0207640_10992748 3300025981 Bacteria 738
299 Ga0207658_10253664 3300025986 Bacteria 1496
300 Ga0207658_10529223 3300025986 Bacteria 1053
301 Ga0207677_10146636 3300026023 Bacteria 1814
302 Ga0207677_10181168 3300026023 Bacteria 1657
303 Ga0207677_10194505 3300026023 Bacteria 1607
304 Ga0207703_10247014 3300026035 Bacteria 1607
305 Ga0207639_11141436 3300026041 Bacteria 731
306 Ga0207678_10007784 3300026067 Bacteria 9464
307 Ga0207678_10046817 3300026067 Bacteria 3741
308 Ga0207678_10404595 3300026067 Bacteria 1182
309 Ga0207678_10493037 3300026067 Bacteria 1067
310 Ga0207678_10717249 3300026067 Bacteria 881
311 Ga0207702_10135486 3300026078 Bacteria 2221
312 Ga0207702_10444955 3300026078 Bacteria 1256
313 Ga0207702_10672122 3300026078 Unclassified 1019
314 Ga0207641_10206593 3300026088 Bacteria 1814
315 Ga0207641_10209740 3300026088 Bacteria 1801
316 Ga0207641_10404178 3300026088 Bacteria 1312
317 Ga0207641_10708030 3300026088 Bacteria 992
318 Ga0207676_10048625 3300026095 Bacteria 3294
319 Ga0207676_10049561 3300026095 Bacteria 3268
320 Ga0207676_10770216 3300026095 Bacteria 937
321 Ga0207674_10004600 3300026116 Bacteria 16569
322 Ga0207674_10051554 3300026116 Bacteria 4199
323 Ga0207674_10245824 3300026116 Bacteria 1736
324 Ga0207675_100105167 3300026118 Bacteria 2660
325 Ga0207683_10131268 3300026121 Bacteria 2253
326 Ga0207698_10363471 3300026142 Bacteria 1371
327 Ga0207698_10490693 3300026142 Bacteria 1193
328 Ga0268266_10281381 3300028379 Bacteria 1547
329 Ga0268266_10478742 3300028379 Bacteria 1186
330 Ga0268266_10649843 3300028379 Bacteria 1015
331 Ga0268264_10710894 3300028381 Bacteria 998
332 Ga0307410_10127694 3300031852 Bacteria 1864
333 Ga0307410_10623116 3300031852 Bacteria 902
334 Ga0326468_10029904 3300031889 Bacteria 715
335 Ga0307409_100203085 3300031995 Bacteria 1775
336 Ga0307409_101066117 3300031995 Bacteria 828
337 Ga0307416_100140412 3300032002 Bacteria 2195
338 Ga0307416_101360720 3300032002 Bacteria 816
339 Ga0307414_10926298 3300032004 Bacteria 800
340 Ga0395898_0244123 3300037466 Bacteria 1713
341 Ga0395898_1122371 3300037466 Bacteria 719
342 Ga0395905_0058110 3300037471 Bacteria 3618
343 Ga0436364_0817893 3300037853 Bacteria 6055
344 Ga0395901_0166276 3300038443 Bacteria 2316
345 Ga0395901_0179836 3300038443 Bacteria 2218
346 Ga0451800_1185200 3300041459 Bacteria 641
347 Ga0451837_0211190 3300041494 Bacteria 589
348 Ga0451853_0750303 3300041512 Bacteria 10687
349 Ga0451853_0881712 3300041512 Unclassified 735
350 Ga0439431_0114761 3300041997 Bacteria 748
351 Ga0466965_0096647 3300044683 Bacteria 1507
352 Ga0466965_0108556 3300044683 Unclassified 1425
353 Ga0466965_0332970 3300044683 Bacteria 829
354 Ga0466966_0778752 3300044684 Bacteria 577
355 Ga0466961_0078094 3300044693 Bacteria 2097
356 Ga0466961_0203702 3300044693 Bacteria 1223
357 Ga0466961_0727454 3300044693 Bacteria 594
358 Ga0466961_0767618 3300044693 Bacteria 576
359 Ga0466963_0013980 3300044694 Bacteria 4944
360 Ga0466963_0039194 3300044694 Bacteria 3102
361 Ga0466963_0088457 3300044694 Bacteria 2107
362 Ga0466963_0139559 3300044694 Bacteria 1678
363 Ga0466963_0238666 3300044694 Bacteria 1274
364 Ga0466963_0499650 3300044694 Bacteria 859
365 Ga0466963_0628613 3300044694 Bacteria 758
366 Ga0466964_0013981 3300044706 Bacteria 3049
367 Ga0466964_0018807 3300044706 Bacteria 2653
368 Ga0466964_0033284 3300044706 Bacteria 2053
369 Ga0466964_0366881 3300044706 Bacteria 744
370 Ga0466971_0028033 3300044719 Bacteria 2521
371 Ga0466971_0068066 3300044719 Bacteria 1614
372 Ga0466971_0218853 3300044719 Bacteria 902
373 Ga0466968_0012697 3300044735 Bacteria 3304
374 Ga0466970_0006319 3300044765 Bacteria 5916
375 Ga0466970_0021920 3300044765 Bacteria 3333
376 Ga0466970_0155226 3300044765 Bacteria 1265
377 Ga0466970_0575614 3300044765 Unclassified 652
378 Ga0466957_0087720 3300044842 Bacteria 1946
379 Ga0466957_0516222 3300044842 Bacteria 830
380 Ga0466957_0831703 3300044842 Bacteria 657
381 Ga0466960_0001358 3300044901 Bacteria 8895
382 Ga0466960_0015165 3300044901 Bacteria 3318
383 Ga0466960_0049951 3300044901 Bacteria 2015
384 Ga0466960_0242020 3300044901 Bacteria 999
385 Ga0466959_0145653 3300045049 Bacteria 1672
386 Ga0466959_0208016 3300045049 Bacteria 1360
387 Ga0451576_0203468 3300045051 Bacteria 2068
388 Ga0466958_0178682 3300045836 Bacteria 1346
389 Ga0466958_0389136 3300045836 Bacteria 899
390 Ga0466967_0007934 3300045976 Bacteria 7721
391 Ga0466967_0012209 3300045976 Bacteria 6557
392 Ga0466967_0032839 3300045976 Bacteria 4388
393 Ga0466967_0043969 3300045976 Bacteria 3870
394 Ga0466967_0064458 3300045976 Bacteria 3259
395 Ga0466967_0155540 3300045976 Bacteria 2141
396 Ga0466967_0179326 3300045976 Bacteria 1997
397 Ga0466967_0284638 3300045976 Bacteria 1587
398 Ga0466967_0380370 3300045976 Bacteria 1370
399 Ga0466967_0389367 3300045976 Bacteria 1355
400 Ga0466967_0610076 3300045976 Bacteria 1077
401 Ga0466967_0776024 3300045976 Bacteria 951
402 Ga0466967_1470574 3300045976 Unclassified 679
403 Ga0466967_1578629 3300045976 Bacteria 654
404 Ga0466967_2263381 3300045976 Bacteria 539
405 Ga0495641_0091279 3300046461 Bacteria 1361
406 Ga0495606_0483872 3300046507 Bacteria 628
407 Ga0495657_0790623 3300046675 Bacteria 543
408 Ga0495676_0643933 3300047321 Bacteria 688
409 Ga0495614_0386712 3300048089 Bacteria 656
410 Ga0496100_0229168 3300048903 Bacteria 1366
411 Ga0496100_0355658 3300048903 Bacteria 1107
412 Ga0496100_0380571 3300048903 Bacteria 1072
413 Ga0496101_1021622 3300048904 Bacteria 650
414 Ga0496102_0109844 3300048905 Bacteria 2570
415 Ga0496102_0221698 3300048905 Bacteria 1783
416 Ga0496102_0407256 3300048905 Bacteria 1278
417 Ga0496103_0140561 3300048906 Bacteria 1544
418 Ga0496104_0121054 3300048907 Bacteria 2513
419 Ga0496104_0334257 3300048907 Bacteria 1428
420 Ga0496104_0469084 3300048907 Unclassified 1170
421 Ga0496105_0013197 3300048908 Bacteria 6555
422 Ga0496105_0167276 3300048908 Bacteria 1804
423 Ga0496105_0274604 3300048908 Bacteria 1360
424 Ga0496105_0994499 3300048908 Bacteria 628
425 Ga0496106_0431890 3300048909 Bacteria 1058
426 Ga0496106_0569489 3300048909 Bacteria 908
427 Ga0496107_0299961 3300048910 Bacteria 1196
428 Ga0496107_0303204 3300048910 Unclassified 1189
429 Ga0496108_0027535 3300048911 Bacteria 4695
430 Ga0496108_0037329 3300048911 Bacteria 4046
431 Ga0496108_0114609 3300048911 Bacteria 2308
432 Ga0496108_0177748 3300048911 Bacteria 1843
433 Ga0496108_0197528 3300048911 Bacteria 1745
434 Ga0496108_0354058 3300048911 Bacteria 1281
435 Ga0496108_0423166 3300048911 Bacteria 1163
436 Ga0496108_0788952 3300048911 Bacteria 820
437 Ga0496109_0017820 3300048912 Bacteria 6230
438 Ga0496109_0029876 3300048912 Bacteria 4884
439 Ga0496109_0046607 3300048912 Bacteria 3938
440 Ga0496109_0123414 3300048912 Bacteria 2414
441 Ga0496109_0141492 3300048912 Bacteria 2250
442 Ga0496109_0209776 3300048912 Bacteria 1832
443 Ga0496109_0352103 3300048912 Bacteria 1391
444 Ga0496109_0995585 3300048912 Bacteria 776
445 Ga0496110_0080696 3300048913 Bacteria 2899
446 Ga0496110_0258788 3300048913 Bacteria 1584
447 Ga0496110_0785815 3300048913 Bacteria 856
448 Ga0496111_0009770 3300048914 Bacteria 6413
449 Ga0496111_0582140 3300048914 Bacteria 820
450 Ga0496111_0723918 3300048914 Bacteria 723
451 Ga0496112_0613932 3300048915 Bacteria 1019
452 Ga0496112_0884732 3300048915 Bacteria 816
453 Ga0496112_1028120 3300048915 Bacteria 743
454 Ga0496113_0213632 3300048916 Bacteria 1536
455 Ga0496113_0821149 3300048916 Bacteria 738
456 Ga0496114_0004253 3300048917 Bacteria 11091
457 Ga0496114_0011245 3300048917 Bacteria 7146
458 Ga0496114_0053277 3300048917 Bacteria 3372
459 Ga0496114_0062002 3300048917 Bacteria 3129
460 Ga0496114_0094687 3300048917 Bacteria 2541
461 Ga0496115_0079496 3300048918 Bacteria 2669
462 Ga0496115_0086237 3300048918 Bacteria 2562
463 Ga0496119_0003385 3300048922 Bacteria 16572
464 Ga0496120_0005539 3300048923 Bacteria 10041
465 Ga0496125_0103102 3300048928 Bacteria 2094
466 Ga0501031_0044848 3300049568 Bacteria 2885
467 Ga0501032_0003760 3300049569 Bacteria 11517
468 Ga0501032_0057139 3300049569 Bacteria 2622
469 Ga0501033_0004180 3300049570 Bacteria 11620
470 Ga0501033_0083152 3300049570 Bacteria 2347
471 Ga0501034_0073763 3300049571 Bacteria 3421
472 Ga0501034_0788379 3300049571 Bacteria 844
473 Ga0501034_1205484 3300049571 Bacteria 636
474 Ga0501036_0041413 3300049572 Bacteria 3897
475 Ga0501036_0441992 3300049572 Bacteria 1084
476 Ga0501036_0467185 3300049572 Bacteria 1051
477 Ga0501037_0006252 3300049573 Bacteria 8706
478 Ga0501037_0115980 3300049573 Bacteria 1927
479 Ga0501038_0039245 3300049574 Bacteria 4142
480 Ga0501039_0019559 3300049575 Bacteria 5192
481 Ga0501042_0426098 3300049578 Bacteria 962
482 Ga0501043_0191083 3300049579 Bacteria 1592
483 Ga0501043_0218056 3300049579 Bacteria 1477
484 Ga0501043_0313327 3300049579 Bacteria 1197
485 Ga0501046_0001814 3300049580 Bacteria 20332
486 Ga0501046_0023488 3300049580 Bacteria 5071
487 Ga0501046_0112948 3300049580 Bacteria 2074
488 Ga0501047_0070835 3300049581 Bacteria 3356
489 Ga0501047_0081170 3300049581 Bacteria 3117
490 Ga0501047_0156980 3300049581 Bacteria 2148
491 Ga0501048_0017188 3300049582 Bacteria 5329
492 Ga0501069_0416643 3300049585 Bacteria 796
493 Ga0501070_0122411 3300049586 Bacteria 2150
494 Ga0501070_0245419 3300049586 Bacteria 1465
495 Ga0501070_0257088 3300049586 Bacteria 1428
496 Ga0501070_0356775 3300049586 Bacteria 1186
497 Ga0501070_0561259 3300049586 Bacteria 913
498 Ga0501073_0273581 3300049589 Bacteria 1165
499 Ga0501079_0055482 3300049741 Bacteria 3058
500 Ga0501080_0057988 3300049742 Bacteria 3605
501 Ga0501080_0364833 3300049742 Bacteria 1303
502 Ga0501035_0013382 3300049822 Bacteria 7574
503 Ga0501035_0065560 3300049822 Bacteria 3225
504 Ga0501044_0007215 3300049823 Bacteria 12227
505 Ga0501044_0037907 3300049823 Bacteria 5036
506 Ga0501044_0440671 3300049823 Bacteria 1210
507 nmdc:mga03n38_507278_c1 3300050490 Bacteria 678
508 nmdc:mga00v17_2092_c1 3300050491 Bacteria 10278
509 nmdc:mga0yw44_13258_c1 3300050492 Bacteria 4333
510 nmdc:mga0yw44_879_c2 3300050492 Bacteria 9147
511 nmdc:mga07m45_21371_c1 3300050496 Bacteria 3524
512 nmdc:mga08y16_362686_c1 3300050511 Bacteria 1487
513 Ga0495619_0563586 3300053085 Bacteria 781
514 Ga0500616_0000287 3300053153 Bacteria 73549
515 Ga0466962_0025187 3300061719 Bacteria 2856
516 Ga0466962_0036989 3300061719 Bacteria 2336
517 2855389855 2855386786 Bacteria 4752232
518 Ga0207661_10392309
519 JGI24740J21852_10021231
520 JGI24735J21928_10163981
521 rootL2_10220255
522 Ga0058861_11678786
523 Ga0058861_11907541
524 Ga0058860_12223778
525 Ga0070658_10016964
526 Ga0070658_10064525
527 Ga0070658_10491349
528 Ga0070676_10127786
529 Ga0070683_100059671
530 Ga0070683_100085373
531 Ga0070683_100092722
532 Ga0070683_100259985
533 Ga0070683_100280013
534 Ga0070683_100440178
535 Ga0070683_101074476
536 Ga0070690_101137802
537 Ga0070670_100083026
538 Ga0070670_100615217
539 Ga0068869_100010662
540 Ga0070680_100002942
541 Ga0070680_100226343
542 Ga0070680_100377419
543 Ga0070680_100894207
544 Ga0070682_100007040
545 Ga0070682_100016087
546 Ga0070682_100049210
547 Ga0070682_100236858
548 Ga0070682_100309406
549 Ga0070682_100468356
550 Ga0070682_100531333
551 Ga0068868_100068693
552 Ga0068868_100093060
553 Ga0068868_100562021
554 Ga0070660_100005955
555 Ga0070660_100010799
556 Ga0070660_100330827
557 Ga0070660_100369181
558 Ga0070687_100247036
559 Ga0070687_100261707
560 Ga0070661_100391638
561 Ga0070692_10034326
562 Ga0070692_10048409
563 Ga0070692_10651519
564 Ga0070668_100039232
565 Ga0070668_101180109
566 Ga0070669_100340881
567 Ga0070675_100265835
568 Ga0070675_100968458
569 Ga0070671_100000553
570 Ga0070674_100430888
571 Ga0070688_100337362
572 Ga0070659_100026748
573 Ga0070667_100113261
574 Ga0070714_101221965
575 Ga0070663_100067442
576 Ga0070663_100278314
577 Ga0070663_101400598
578 Ga0070663_101569739
579 Ga0070678_100592740
580 Ga0070678_101766839
581 Ga0070662_100610512
582 Ga0070662_100759117
583 Ga0070662_100821101
584 Ga0070681_10000025
585 Ga0070681_10086299
586 Ga0070681_10673988
587 Ga0070681_10886946
588 Ga0070681_11081981
589 Ga0070681_11451749
590 Ga0070685_10022152
591 Ga0070685_10071207
592 Ga0070685_10673825
593 Ga0070679_100002372
594 Ga0070679_100036127
595 Ga0070679_100040822
596 Ga0070679_100092235
597 Ga0070679_100210770
598 Ga0070679_100449926
599 Ga0070679_100719642
600 Ga0070684_100006111
601 Ga0070684_100147873
602 Ga0070684_100330526
603 Ga0070684_100533455
604 Ga0070684_100605015
605 Ga0068853_101131752
606 Ga0068853_101167663
607 Ga0070672_100222921
608 Ga0070672_101144361
609 Ga0070686_100153290
610 Ga0070686_100339860
611 Ga0070693_100700172
612 Ga0070665_100039101
613 Ga0070665_100749638
614 Ga0070665_100837751
615 Ga0070665_101766998
616 Ga0068855_100238509
617 Ga0070664_100111991
618 Ga0070664_100518207
619 Ga0070664_101207741
620 Ga0068857_100027136
621 Ga0068857_100136884
622 Ga0068857_100703067
623 Ga0068854_100032380
624 Ga0068854_100074939
625 Ga0068856_100053916
626 Ga0070702_100069139
627 Ga0070702_100371255
628 Ga0068852_100059649
629 Ga0068852_100065395
630 Ga0068852_100068010
631 Ga0068852_101111124
632 Ga0068859_100250458
633 Ga0068864_100047420
634 Ga0068864_100086235
635 Ga0068866_10302673
636 Ga0068851_10334202
637 Ga0068870_10436357
638 Ga0068863_100224161
639 Ga0068863_100779050
640 Ga0068858_100076469
641 Ga0068858_101379751
642 Ga0068860_100166569
643 Ga0068860_100231759
644 Ga0068860_100299548
645 Ga0068862_101173551
646 Ga0081455_10020739
647 Ga0075365_10001922
648 Ga0075365_10017282
649 Ga0075365_10114956
650 Ga0075365_10135240
651 Ga0075363_100000556
652 Ga0075363_100191987
653 Ga0075370_10002681
654 Ga0068871_100082054
655 Ga0068865_100043280
656 Ga0068865_100141458
657 Ga0097620_100250471
658 Ga0111539_11091355
659 Ga0105245_10011247
660 Ga0105245_10052901
661 Ga0105245_11606483
662 Ga0105247_10334273
663 Ga0105247_10450208
664 Ga0105243_10015441
665 Ga0105243_10468063
666 Ga0105243_10720122
667 Ga0105243_12288347
668 Ga0105241_11217977
669 Ga0105242_10579311
670 Ga0105242_10949864
671 Ga0105242_11434541
672 Ga0105248_10119071
673 Ga0105248_10784277
674 Ga0105237_10305598
675 Ga0105238_10164937
676 Ga0105238_10211357
677 Ga0105238_10330911
678 Ga0105238_12580516
679 Ga0105249_10052425
680 Ga0105249_10064403
681 Ga0105239_10014807
682 Ga0105239_10019948
683 Ga0105239_11499953
684 Ga0105246_10002931
685 Ga0105246_10018069
686 Ga0157373_10093045
687 Ga0157371_10309073
688 Ga0157371_10418913
689 Ga0157370_10455740
690 Ga0157369_10048433
691 Ga0157369_10163448
692 Ga0157369_10238134
693 Ga0157369_10647268
694 Ga0157374_10279844
695 Ga0157378_10233673
696 Ga0163162_10008757
697 Ga0163162_10326714
698 Ga0163162_10659330
699 Ga0157372_10006339
700 Ga0157372_10039920
701 Ga0157372_10077004
702 Ga0157372_10077881
703 Ga0157372_10186637
704 Ga0157372_10226692
705 Ga0157372_10469003
706 Ga0157372_10892934
707 Ga0157372_11601346
708 Ga0157375_10008213
709 Ga0157375_10322573
710 Ga0157375_10409833
711 Ga0157375_10605800
712 Ga0157375_10856524
713 Ga0157375_11437345
714 Ga0163163_10100164
715 Ga0163163_10912250
716 Ga0157380_10384246
717 Ga0157380_10421708
718 Ga0157380_10468725
719 Ga0182008_10143174
720 Ga0157377_10014093
721 Ga0157377_10117550
722 Ga0157379_10026335
723 Ga0157379_10061062
724 Ga0157376_10149678
725 Ga0163161_10054947
726 Ga0197907_10056093
727 Ga0197907_10747487
728 Ga0206356_10599348
729 Ga0206356_11335322
730 Ga0206356_11609681
731 Ga0206349_1369627
732 Ga0206349_1687648
733 Ga0206349_1804314
734 Ga0206355_1282185
735 Ga0206355_1294032
736 Ga0206351_10480664
737 Ga0206351_10749310
738 Ga0206352_10180487
739 Ga0206352_10871039
740 Ga0206350_10064166
741 Ga0206350_10078779
742 Ga0206354_10294091
743 Ga0206353_10042011
744 Ga0206353_11565488
745 Ga0154015_1022497
746 Ga0154015_1635166
747 Ga0224712_10032091
748 Ga0224712_10081573
749 Ga0207688_10012635
750 Ga0207688_10040464
751 Ga0207688_10121459
752 Ga0207688_10261449
753 Ga0207647_10009962
754 Ga0207647_10018207
755 Ga0207647_10041889
756 Ga0207647_10201653
757 Ga0207643_10134792
758 Ga0207705_10092783
759 Ga0207705_10529870
760 Ga0207654_10046686
761 Ga0207707_10000023
762 Ga0207707_10259073
763 Ga0207707_10568377
764 Ga0207660_10000406
765 Ga0207660_10346158
766 Ga0207660_11067645
767 Ga0207660_11511337
768 Ga0207662_10260533
769 Ga0207662_10296969
770 Ga0207657_10017453
771 Ga0207657_10086834
772 Ga0207657_10247105
773 Ga0207657_10438386
774 Ga0207649_10426778
775 Ga0207649_10686131
776 Ga0207652_10000039
777 Ga0207652_10060526
778 Ga0207652_10078478
779 Ga0207652_10156462
780 Ga0207652_10331396
781 Ga0207652_10331679
782 Ga0207652_10670771
783 Ga0207652_10826236
784 Ga0207681_10699097
785 Ga0207694_10674755
786 Ga0207650_10290896
787 Ga0207659_10153298
788 Ga0207659_10217527
789 Ga0207687_10157992
790 Ga0207687_10978399
791 Ga0207687_11097128
792 Ga0207690_10149650
793 Ga0207706_10072510
794 Ga0207706_10236496
795 Ga0207686_10851184
796 Ga0207709_10042633
797 Ga0207709_10578098
798 Ga0207670_10252914
799 Ga0207704_10104821
800 Ga0207704_10246725
801 Ga0207711_10486011
802 Ga0207711_11257176
803 Ga0207689_10002011
804 Ga0207689_10255345
805 Ga0207661_10029683
806 Ga0207661_10338618
807 Ga0207661_10613094
808 Ga0207661_10697206
809 Ga0207661_11273738
810 Ga0207679_11052957
811 Ga0207667_10157018
812 Ga0207712_10104945
813 Ga0207712_10758100
814 Ga0207668_10176188
815 Ga0207640_10992748
816 Ga0207658_10253664
817 Ga0207658_10529223
818 Ga0207677_10146636
819 Ga0207677_10181168
820 Ga0207677_10194505
821 Ga0207703_10247014
822 Ga0207639_11141436
823 Ga0207678_10007784
824 Ga0207678_10046817
825 Ga0207678_10404595
826 Ga0207678_10493037
827 Ga0207678_10717249
828 Ga0207702_10135486
829 Ga0207702_10444955
830 Ga0207702_10672122
831 Ga0207641_10206593
832 Ga0207641_10209740
833 Ga0207641_10404178
834 Ga0207641_10708030
835 Ga0207676_10048625
836 Ga0207676_10049561
837 Ga0207676_10770216
838 Ga0207674_10004600
839 Ga0207674_10051554
840 Ga0207674_10245824
841 Ga0207675_100105167
842 Ga0207683_10131268
843 Ga0207698_10363471
844 Ga0207698_10490693
845 Ga0268266_10281381
846 Ga0268266_10478742
847 Ga0268266_10649843
848 Ga0268264_10710894
849 Ga0307410_10127694
850 Ga0307410_10623116
851 Ga0326468_10029904
852 Ga0307409_100203085
853 Ga0307409_101066117
854 Ga0307416_100140412
855 Ga0307416_101360720
856 Ga0307414_10926298
857 Ga0395898_0244123
858 Ga0395898_1122371
859 Ga0395905_0058110
860 Ga0436364_0817893
861 Ga0395901_0166276
862 Ga0395901_0179836
863 Ga0451800_1185200
864 Ga0451837_0211190
865 Ga0451853_0750303
866 Ga0451853_0881712
867 Ga0439431_0114761
868 Ga0466965_0096647
869 Ga0466965_0108556
870 Ga0466965_0332970
871 Ga0466966_0778752
872 Ga0466961_0078094
873 Ga0466961_0203702
874 Ga0466961_0727454
875 Ga0466961_0767618
876 Ga0466963_0013980
877 Ga0466963_0039194
878 Ga0466963_0088457
879 Ga0466963_0139559
880 Ga0466963_0238666
881 Ga0466963_0499650
882 Ga0466963_0628613
883 Ga0466964_0013981
884 Ga0466964_0018807
885 Ga0466964_0033284
886 Ga0466964_0366881
887 Ga0466971_0028033
888 Ga0466971_0068066
889 Ga0466971_0218853
890 Ga0466968_0012697
891 Ga0466970_0006319
892 Ga0466970_0021920
893 Ga0466970_0155226
894 Ga0466970_0575614
895 Ga0466957_0087720
896 Ga0466957_0516222
897 Ga0466957_0831703
898 Ga0466960_0001358
899 Ga0466960_0015165
900 Ga0466960_0049951
901 Ga0466960_0242020
902 Ga0466959_0145653
903 Ga0466959_0208016
904 Ga0451576_0203468
905 Ga0466958_0178682
906 Ga0466958_0389136
907 Ga0466967_0007934
908 Ga0466967_0012209
909 Ga0466967_0032839
910 Ga0466967_0043969
911 Ga0466967_0064458
912 Ga0466967_0155540
913 Ga0466967_0179326
914 Ga0466967_0284638
915 Ga0466967_0380370
916 Ga0466967_0389367
917 Ga0466967_0610076
918 Ga0466967_0776024
919 Ga0466967_1470574
920 Ga0466967_1578629
921 Ga0466967_2263381
922 Ga0495641_0091279
923 Ga0495606_0483872
924 Ga0495657_0790623
925 Ga0495676_0643933
926 Ga0495614_0386712
927 Ga0496100_0229168
928 Ga0496100_0355658
929 Ga0496100_0380571
930 Ga0496101_1021622
931 Ga0496102_0109844
932 Ga0496102_0221698
933 Ga0496102_0407256
934 Ga0496103_0140561
935 Ga0496104_0121054
936 Ga0496104_0334257
937 Ga0496104_0469084
938 Ga0496105_0013197
939 Ga0496105_0167276
940 Ga0496105_0274604
941 Ga0496105_0994499
942 Ga0496106_0431890
943 Ga0496106_0569489
944 Ga0496107_0299961
945 Ga0496107_0303204
946 Ga0496108_0027535
947 Ga0496108_0037329
948 Ga0496108_0114609
949 Ga0496108_0177748
950 Ga0496108_0197528
951 Ga0496108_0354058
952 Ga0496108_0423166
953 Ga0496108_0788952
954 Ga0496109_0017820
955 Ga0496109_0029876
956 Ga0496109_0046607
957 Ga0496109_0123414
958 Ga0496109_0141492
959 Ga0496109_0209776
960 Ga0496109_0352103
961 Ga0496109_0995585
962 Ga0496110_0080696
963 Ga0496110_0258788
964 Ga0496110_0785815
965 Ga0496111_0009770
966 Ga0496111_0582140
967 Ga0496111_0723918
968 Ga0496112_0613932
969 Ga0496112_0884732
970 Ga0496112_1028120
971 Ga0496113_0213632
972 Ga0496113_0821149
973 Ga0496114_0004253
974 Ga0496114_0011245
975 Ga0496114_0053277
976 Ga0496114_0062002
977 Ga0496114_0094687
978 Ga0496115_0079496
979 Ga0496115_0086237
980 Ga0496119_0003385
981 Ga0496120_0005539
982 Ga0496125_0103102
983 Ga0501031_0044848
984 Ga0501032_0003760
985 Ga0501032_0057139
986 Ga0501033_0004180
987 Ga0501033_0083152
988 Ga0501034_0073763
989 Ga0501034_0788379
990 Ga0501034_1205484
991 Ga0501036_0041413
992 Ga0501036_0441992
993 Ga0501036_0467185
994 Ga0501037_0006252
995 Ga0501037_0115980
996 Ga0501038_0039245
997 Ga0501039_0019559
998 Ga0501042_0426098
999 Ga0501043_0191083
1000 Ga0501043_0218056
1001 Ga0501043_0313327
1002 Ga0501046_0001814
1003 Ga0501046_0023488
1004 Ga0501046_0112948
1005 Ga0501047_0070835
1006 Ga0501047_0081170
1007 Ga0501047_0156980
1008 Ga0501048_0017188
1009 Ga0501069_0416643
1010 Ga0501070_0122411
1011 Ga0501070_0245419
1012 Ga0501070_0257088
1013 Ga0501070_0356775
1014 Ga0501070_0561259
1015 Ga0501073_0273581
1016 Ga0501079_0055482
1017 Ga0501080_0057988
1018 Ga0501080_0364833
1019 Ga0501035_0013382
1020 Ga0501035_0065560
1021 Ga0501044_0007215
1022 Ga0501044_0037907
1023 Ga0501044_0440671
1024 nmdc:mga03n38_507278_c1
1025 nmdc:mga00v17_2092_c1
1026 nmdc:mga0yw44_13258_c1
1027 nmdc:mga0yw44_879_c2
1028 nmdc:mga07m45_21371_c1
1029 nmdc:mga08y16_362686_c1
1030 Ga0495619_0563586
1031 Ga0500616_0000287
1032 Ga0466962_0025187
1033 Ga0466962_0036989
1034 2855389855

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04239

DUF421

YetF C-terminal domain

77

161

0.95

Map