F458071

General Info

Members Datasets Scaffolds Average Seq Length
516 331 441 334

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2510917015|2511102186
Length 385
Sequence LRAGLLTTVQDLGRPGYRHLGVATGGALDTLALEVGNRLVGNRPDAAGLEITFGPVALRFARATRVAITGTDFGATLGGRPVWSWWSLPVAAGEELVLNGAKRGMRAYVCAAGGIDVLPMLGSRSTDLAAGFGGLAGRALKDGDRLATGASFAPGRERAALDPGAPAFGVKAPVWCNFALADEPHHRRPRHPDGMAWAVPVRVLRGPEYDSFTPEAQRTLWSDEWQITPNSNRMGFRLTGTPLARASGADLLSHAVLPGTIQVPPSGQPIVLMADAQTTGGYPKIGSVIRADWWKLAQVRLTAGVRFVEATPAAARAALEEERAYLRQIDAAIAMHDERFASRRANGVASGVSSGISSGISSGISSGISSGVSGGVSGRVSSASA

Samples

Sample ID Description Type Environment
1 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
5 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
6 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
7 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
8 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
9 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
10 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
11 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
12 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
13 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
14 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
15 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
16 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
17 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
18 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
19 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
20 2643221658 Variovorax sp. Root411 Isolate Unclassified
21 2643221672 Variovorax sp. Root434 Isolate Unclassified
22 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
23 2738541277 Variovorax sp. GV051 Isolate Unclassified
24 2738541307 Variovorax sp. GV008 Isolate Unclassified
25 2738543013 Variovorax sp. BT01 Isolate Unclassified
26 2738543019 Variovorax sp. GV040 Isolate Unclassified
27 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
28 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
29 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
30 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
31 2818991436 Collimonas arenae 515 Isolate Unclassified
32 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
33 2818991446 Variovorax sp. 1180 Isolate Unclassified
34 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
35 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
36 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
37 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
38 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
39 2842677519 Variovorax sp. R-72495 Isolate Unclassified
40 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
41 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
42 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
43 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
44 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
45 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
46 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
47 2885198086 Variovorax sp. 679 Isolate Unclassified
48 2885211737 Variovorax sp. 553 Isolate Unclassified
49 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
50 2899924645 Variovorax sp. 369 Isolate Unclassified
51 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
52 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
53 2904456579 Variovorax sp. 2002 Isolate Unclassified
54 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
55 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
56 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
57 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
58 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
59 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
60 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
61 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
62 2928037797 Variovorax sp. 1126 Isolate Unclassified
63 2928044640 Variovorax sp. 1128 Isolate Unclassified
64 2928051484 Variovorax sp. 1133 Isolate Unclassified
65 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
66 2928070936 Variovorax gossypii 1167 Isolate Unclassified
67 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
68 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
69 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
70 2929520902 Variovorax beijingensis 502 Isolate Unclassified
71 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
72 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
73 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
74 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
75 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
76 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
77 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
78 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
79 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
80 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
81 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
82 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
83 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
84 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
85 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
86 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
87 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
88 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
89 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
90 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
91 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
92 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
93 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
94 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
95 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
96 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
97 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
98 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
99 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
100 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
101 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
102 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
103 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
104 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
105 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
106 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
107 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
108 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
109 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
110 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
111 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
112 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
113 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
114 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
115 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
116 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
117 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
118 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
119 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
120 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
121 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
124 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
139 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
142 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
143 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
153 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
154 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
155 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
158 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
159 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
160 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
191 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
192 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
197 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
198 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
199 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
218 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
219 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
220 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
221 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
222 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
227 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
228 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
235 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
268 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
278 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
281 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
305 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
310 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
311 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
312 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
313 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
314 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
315 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
316 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
317 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
318 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
319 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
320 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
323 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
324 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
327 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
328 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
329 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
330 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
331 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.88
Metatranscriptomes 0.58
Isolates 14.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.98
Nodule 2.91
Rhizoplane 1.74
Rhizosphere 47.67
Stem 0
Stem Tuber 0
Unclassified 15.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000459 3300002704 Bacteria 10374
2 JGI25155J39150_1000754 3300002704 Bacteria 5414
3 JGI25156J39149_1001386 3300002705 Bacteria 10368
4 JGI25156J39149_1011060 3300002705 Bacteria 2068
5 JGI25162J39368_1000023 3300002737 Bacteria 236658
6 JGI25154J39366_1000706 3300002738 Bacteria 15200
7 JGI25154J39366_1000836 3300002738 Bacteria 13393
8 JGI25157J39369_1000359 3300002741 Bacteria 31770
9 JGI25163J39215_1003613 3300002771 Bacteria 1211
10 JGI25152J39213_1006922 3300002773 Bacteria 2997
11 JGI25151J46595_10000872 3300003187 Bacteria 23847
12 JGI25151J46595_10001057 3300003187 Bacteria 20535
13 JGI25151J46595_10001511 3300003187 Bacteria 15561
14 JGI25151J46595_10055216 3300003187 Bacteria 1311
15 JGI25165J46597_1000030 3300003214 Bacteria 305254
16 rootL2_10111768 3300003322 Bacteria 3863
17 rootL2_10172394 3300003322 Bacteria 3385
18 rootH1_10008652 3300003323 Bacteria 3275
19 Ga0006562J51391_1077671 3300003578 Bacteria 10770
20 Ga0006562J51391_1077673 3300003578 Bacteria 6100
21 Ga0006562J51391_1081221 3300003578 Bacteria 3900
22 Ga0055538_1000017 3300003751 Bacteria 305254
23 Ga0055538_1000155 3300003751 Bacteria 46426
24 Ga0055539_1000022 3300003752 Bacteria 305254
25 Ga0055539_1000205 3300003752 Bacteria 46426
26 Ga0055533_1000030 3300003756 Bacteria 305254
27 Ga0055533_1000207 3300003756 Bacteria 46426
28 Ga0055532_1000023 3300003758 Bacteria 248212
29 Ga0055525_1000034 3300003759 Bacteria 305254
30 Ga0055525_1000284 3300003759 Bacteria 46426
31 Ga0055535_1000894 3300003761 Bacteria 20406
32 Ga0055542_1000074 3300003762 Bacteria 141185
33 Ga0055526_1008124 3300003771 Bacteria 5289
34 Ga0055526_1012806 3300003771 Bacteria 3618
35 Ga0055537_1000049 3300003773 Bacteria 87244
36 Ga0055537_1001494 3300003773 Bacteria 9000
37 Ga0055537_1001937 3300003773 Bacteria 7401
38 Ga0055524_1000491 3300003775 Bacteria 31117
39 Ga0055536_1008597 3300003781 Bacteria 4360
40 Ga0055534_1000049 3300003784 Bacteria 92974
41 Ga0055534_1000456 3300003784 Bacteria 23742
42 Ga0055534_1003358 3300003784 Bacteria 5062
43 Ga0055534_1004235 3300003784 Bacteria 4225
44 Ga0055534_1009666 3300003784 Bacteria 2077
45 Ga0055528_1001619 3300003790 Bacteria 13302
46 Ga0055528_1003830 3300003790 Bacteria 7402
47 Ga0055530_10001472 3300003791 Bacteria 17104
48 Ga0055530_10015884 3300003791 Bacteria 2432
49 Ga0055540_1000879 3300003792 Bacteria 19891
50 Ga0055540_1001733 3300003792 Bacteria 12525
51 Ga0055540_1012035 3300003792 Bacteria 2744
52 Ga0055531_10001127 3300003794 Bacteria 20691
53 Ga0055531_10006654 3300003794 Bacteria 6490
54 Ga0055541_1000015 3300003841 Bacteria 305254
55 Ga0055541_1000133 3300003841 Bacteria 46426
56 Ga0065714_10068536 3300005288 Bacteria 4663
57 Ga0070658_10216367 3300005327 Bacteria 1619
58 Ga0070660_100019826 3300005339 Bacteria 4933
59 Ga0070661_100042701 3300005344 Bacteria 3310
60 Ga0070674_100012504 3300005356 Bacteria 5214
61 Ga0068853_100006764 3300005539 Bacteria 9134
62 Ga0068855_100007926 3300005563 Bacteria 12835
63 Ga0068855_100016180 3300005563 Bacteria 8968
64 Ga0068855_100102792 3300005563 Bacteria 3289
65 Ga0068855_100290779 3300005563 Bacteria 1811
66 Ga0068857_100039265 3300005577 Bacteria 4193
67 Ga0068856_100055082 3300005614 Bacteria 3925
68 Ga0068852_100079388 3300005616 Bacteria 2907
69 Ga0068851_10008702 3300005834 Bacteria 4700
70 Ga0068862_100011851 3300005844 Bacteria 7200
71 Ga0075363_100033138 3300006048 Bacteria 2688
72 Ga0075363_100099578 3300006048 Bacteria 1607
73 Ga0075364_10007995 3300006051 Bacteria 6302
74 Ga0075364_10086761 3300006051 Bacteria 2074
75 Ga0075432_10006234 3300006058 Bacteria 4053
76 Ga0075362_10005019 3300006177 Bacteria 4805
77 Ga0075367_10171997 3300006178 Bacteria 1349
78 Ga0075366_10011218 3300006195 Bacteria 5055
79 Ga0075366_10082699 3300006195 Bacteria 1918
80 Ga0075370_10001114 3300006353 Bacteria 11245
81 Ga0075370_10003360 3300006353 Bacteria 7607
82 Ga0075370_10013768 3300006353 Bacteria 4303
83 Ga0075370_10122309 3300006353 Bacteria 1516
84 Ga0079104_1002433 3300006946 Bacteria 10055
85 Ga0079104_1033342 3300006946 Bacteria 1261
86 Ga0099826_10000007 3300006948 Bacteria 393518
87 Ga0099826_10007798 3300006948 Bacteria 7925
88 Ga0105251_10070916 3300009011 Bacteria 1622
89 Ga0105240_10006080 3300009093 Bacteria 17818
90 Ga0105240_10010984 3300009093 Bacteria 12680
91 Ga0105240_10045071 3300009093 Bacteria 5597
92 Ga0105240_10112118 3300009093 Bacteria 3298
93 Ga0105240_10187984 3300009093 Bacteria 2431
94 Ga0105237_10164482 3300009545 Bacteria 2217
95 Ga0105237_10304432 3300009545 Bacteria 1597
96 Ga0105237_10305507 3300009545 Bacteria 1594
97 Ga0105238_10002922 3300009551 Bacteria 17052
98 Ga0105246_10047951 3300011119 Bacteria 2919
99 Ga0157347_1000188 3300012502 Bacteria 3432
100 Ga0157373_10017716 3300013100 Bacteria 5186
101 Ga0157373_10197744 3300013100 Bacteria 1417
102 Ga0157371_10154689 3300013102 Bacteria 1636
103 Ga0157370_10015763 3300013104 Bacteria 7671
104 Ga0157369_10351559 3300013105 Bacteria 1531
105 Ga0182008_10005473 3300014497 Bacteria 7231
106 Ga0182008_10066865 3300014497 Bacteria 1769
107 Ga0182006_1001767 3300015261 Bacteria 12532
108 Ga0182006_1023681 3300015261 Bacteria 2541
109 Ga0182007_10000319 3300015262 Bacteria 30540
110 Ga0182007_10001545 3300015262 Bacteria 12265
111 Ga0182007_10007307 3300015262 Bacteria 4643
112 Ga0182007_10030712 3300015262 Bacteria 1834
113 Ga0182005_1000360 3300015265 Bacteria 25495
114 Ga0183362_10005 3300015683 Bacteria 437616
115 Ga0163161_10000320 3300017792 Bacteria 41236
116 Ga0163161_10004197 3300017792 Bacteria 10059
117 Ga0209435_100013 3300025206 Bacteria 366789
118 Ga0209435_100145 3300025206 Bacteria 23871
119 Ga0209436_105910 3300025208 Bacteria 2744
120 Ga0209784_100002 3300025224 Bacteria 1753105
121 Ga0209784_100034 3300025224 Bacteria 305504
122 Ga0209566_100003 3300025225 Bacteria 1753105
123 Ga0209566_100038 3300025225 Bacteria 305504
124 Ga0209674_100004 3300025226 Bacteria 1753105
125 Ga0209674_100056 3300025226 Bacteria 305504
126 Ga0209672_100480 3300025228 Bacteria 22362
127 Ga0209672_100925 3300025228 Bacteria 13270
128 Ga0209147_100030 3300025229 Bacteria 366789
129 Ga0209147_101353 3300025229 Bacteria 9225
130 Ga0209563_100006 3300025230 Bacteria 1753105
131 Ga0209563_100057 3300025230 Bacteria 305604
132 Ga0207427_100245 3300025231 Bacteria 43757
133 Ga0209437_100071 3300025233 Bacteria 305604
134 Ga0209437_100265 3300025233 Bacteria 80495
135 Ga0209258_100176 3300025242 Bacteria 141261
136 Ga0209258_100205 3300025242 Bacteria 119727
137 Ga0207425_1000274 3300025245 Bacteria 37943
138 Ga0209646_1000034 3300025246 Bacteria 366789
139 Ga0209646_1000321 3300025246 Bacteria 36870
140 Ga0209026_1000022 3300025250 Bacteria 366789
141 Ga0209026_1001923 3300025250 Bacteria 8400
142 Ga0209677_100003 3300025253 Bacteria 1753105
143 Ga0209677_100035 3300025253 Bacteria 305504
144 Ga0209148_1000033 3300025254 Bacteria 555508
145 Ga0209759_1000018 3300025256 Bacteria 366789
146 Ga0209759_1000599 3300025256 Bacteria 34894
147 Ga0209129_1000270 3300025258 Bacteria 50956
148 Ga0209129_1006434 3300025258 Bacteria 3791
149 Ga0209233_1000094 3300025261 Bacteria 305604
150 Ga0209565_1000020 3300025263 Bacteria 432627
151 Ga0209565_1000106 3300025263 Bacteria 122574
152 Ga0209565_1000484 3300025263 Bacteria 29227
153 Ga0209565_1001828 3300025263 Bacteria 8550
154 Ga0209455_1010908 3300025272 Bacteria 2274
155 Ga0209673_1000295 3300025273 Bacteria 92499
156 Ga0209673_1001140 3300025273 Bacteria 29216
157 Ga0209673_1002762 3300025273 Bacteria 11469
158 Ga0209130_1000558 3300025284 Bacteria 36936
159 Ga0209130_1000560 3300025284 Bacteria 36900
160 Ga0209130_1004616 3300025284 Bacteria 5135
161 Ga0209675_1000014 3300025291 Bacteria 421902
162 Ga0209675_1000168 3300025291 Bacteria 79360
163 Ga0209675_1000363 3300025291 Bacteria 38568
164 Ga0209675_1000506 3300025291 Bacteria 29087
165 Ga0209675_1004572 3300025291 Bacteria 6103
166 Ga0209675_1011140 3300025291 Bacteria 3002
167 Ga0209676_1000036 3300025292 Bacteria 457623
168 Ga0209676_1000048 3300025292 Bacteria 403716
169 Ga0209676_1000124 3300025292 Bacteria 194206
170 Ga0209676_1003151 3300025292 Bacteria 10532
171 Ga0209676_1029132 3300025292 Bacteria 1709
172 Ga0209676_1035313 3300025292 Bacteria 1467
173 Ga0209676_1047892 3300025292 Bacteria 1146
174 Ga0209025_1000204 3300025294 Bacteria 142193
175 Ga0209025_1000462 3300025294 Bacteria 79379
176 Ga0209025_1000733 3300025294 Bacteria 55578
177 Ga0209025_1001247 3300025294 Bacteria 35308
178 Ga0209025_1003410 3300025294 Bacteria 15079
179 Ga0209025_1007631 3300025294 Bacteria 8003
180 Ga0209025_1008440 3300025294 Bacteria 7413
181 Ga0209025_1032464 3300025294 Bacteria 2440
182 Ga0209564_1000753 3300025295 Bacteria 45895
183 Ga0209564_1000760 3300025295 Bacteria 45546
184 Ga0209564_1001348 3300025295 Bacteria 26048
185 Ga0209564_1003006 3300025295 Bacteria 12082
186 Ga0209564_1003952 3300025295 Bacteria 9443
187 Ga0209758_1000833 3300025297 Bacteria 43061
188 Ga0209758_1016188 3300025297 Bacteria 3802
189 Ga0209758_1021733 3300025297 Bacteria 2978
190 Ga0209050_1000012 3300025298 Bacteria 813717
191 Ga0209050_1001006 3300025298 Bacteria 35335
192 Ga0209050_1003791 3300025298 Bacteria 10807
193 Ga0209256_1000095 3300025299 Bacteria 206120
194 Ga0209256_1000220 3300025299 Bacteria 106021
195 Ga0209256_1000527 3300025299 Bacteria 55578
196 Ga0207426_1001012 3300025302 Bacteria 27217
197 Ga0207426_1001262 3300025302 Bacteria 22097
198 Ga0209051_1000019 3300025303 Bacteria 511268
199 Ga0209051_1000099 3300025303 Bacteria 165161
200 Ga0209051_1000579 3300025303 Bacteria 43794
201 Ga0209051_1019700 3300025303 Bacteria 2933
202 Ga0209257_1000024 3300025304 Bacteria 726068
203 Ga0209257_1000258 3300025304 Bacteria 122220
204 Ga0209257_1012279 3300025304 Bacteria 3984
205 Ga0207656_10016242 3300025321 Bacteria 2896
206 Ga0207656_10104418 3300025321 Bacteria 1302
207 Ga0207655_1012656 3300025728 Bacteria 4908
208 Ga0207705_10000761 3300025909 Bacteria 26624
209 Ga0207695_10006378 3300025913 Bacteria 15351
210 Ga0207695_10009955 3300025913 Bacteria 11684
211 Ga0207695_10111530 3300025913 Bacteria 2714
212 Ga0207671_10215873 3300025914 Bacteria 1502
213 Ga0207671_10280682 3300025914 Bacteria 1314
214 Ga0207681_10126460 3300025923 Bacteria 1883
215 Ga0207694_10002354 3300025924 Bacteria 15458
216 Ga0207706_10010483 3300025933 Bacteria 8469
217 Ga0207706_10108566 3300025933 Bacteria 2442
218 Ga0207709_10063408 3300025935 Bacteria 2317
219 Ga0207669_10101618 3300025937 Bacteria 1902
220 Ga0207667_10000276 3300025949 Bacteria 70838
221 Ga0207667_10000438 3300025949 Bacteria 55784
222 Ga0207667_10032940 3300025949 Bacteria 5577
223 Ga0207667_10181532 3300025949 Bacteria 2161
224 Ga0207668_10093851 3300025972 Bacteria 2212
225 Ga0207639_10156733 3300026041 Bacteria 1914
226 Ga0207702_10020507 3300026078 Bacteria 5471
227 Ga0207674_10030972 3300026116 Bacteria 5622
228 Ga0207698_10298690 3300026142 Bacteria 1498
229 Ga0209281_1016793 3300027111 Bacteria 1497
230 Ga0209282_1000061 3300027666 Bacteria 96444
231 Ga0209282_1000501 3300027666 Bacteria 19021
232 Ga0207428_10143218 3300027907 Bacteria 1823
233 Ga0268266_10064452 3300028379 Bacteria 3165
234 Ga0268265_10017960 3300028380 Bacteria 4894
235 Ga0265338_10001135 3300028800 Bacteria 44081
236 Ga0314311_1043350 3300030733 Bacteria 3455
237 Ga0316178_1108165 3300030735 Bacteria 2376
238 Ga0316183_1097411 3300030742 Bacteria 8021
239 Ga0316181_1138108 3300030744 Bacteria 2155
240 Ga0265340_10069869 3300031247 Bacteria 1666
241 Ga0265331_10022699 3300031250 Bacteria 3199
242 Ga0265327_10000698 3300031251 Bacteria 53455
243 Ga0265327_10001208 3300031251 Bacteria 34808
244 Ga0307513_10113721 3300031456 Bacteria 2694
245 Ga0307514_10015883 3300031649 Bacteria 6203
246 Ga0307405_10018086 3300031731 Bacteria 3881
247 Ga0307405_10064576 3300031731 Bacteria 2327
248 Ga0307413_10022834 3300031824 Bacteria 3380
249 Ga0307406_10011586 3300031901 Bacteria 5009
250 Ga0307406_10215711 3300031901 Bacteria 1423
251 Ga0307412_10065481 3300031911 Bacteria 2459
252 Ga0307412_10120698 3300031911 Bacteria 1886
253 Ga0307414_10128368 3300032004 Bacteria 1963
254 Ga0307411_10000669 3300032005 Bacteria 12542
255 Ga0307411_10201294 3300032005 Bacteria 1529
256 Ga0395899_0000308 3300037312 Bacteria 62516
257 Ga0395900_0000159 3300037418 Bacteria 111486
258 Ga0395900_0005041 3300037418 Bacteria 13859
259 Ga0395898_0000425 3300037466 Bacteria 89768
260 Ga0395898_0002495 3300037466 Bacteria 21639
261 Ga0395898_0020013 3300037466 Bacteria 6803
262 Ga0395905_0024463 3300037471 Bacteria 5700
263 Ga0395901_0000017 3300038443 Bacteria 345003
264 Ga0395901_0000109 3300038443 Bacteria 112882
265 Ga0395901_0296773 3300038443 Bacteria 1676
266 Ga0436361_0159409 3300039447 Bacteria 43692
267 Ga0436361_0339053 3300039447 Bacteria 16474
268 Ga0436361_0371158 3300039447 Unclassified 2139
269 Ga0439436_0008551 3300041404 Bacteria 3148
270 Ga0439466_0003682 3300041411 Bacteria 5917
271 Ga0439442_000830 3300042002 Bacteria 6368
272 Ga0450898_002806 3300042134 Bacteria 2447
273 Ga0450906_000601 3300042145 Bacteria 7655
274 Ga0450908_001510 3300042184 Bacteria 4520
275 Ga0439434_0000518 3300042435 Bacteria 10981
276 Ga0466969_0019995 3300044656 Bacteria 3470
277 Ga0466969_0041349 3300044656 Bacteria 2306
278 Ga0466969_0070707 3300044656 Bacteria 1678
279 Ga0466972_0099177 3300044658 Bacteria 1379
280 Ga0466973_0080925 3300044659 Bacteria 2844
281 Ga0466977_0000036 3300044666 Bacteria 22554
282 Ga0466965_0030449 3300044683 Bacteria 2629
283 Ga0466966_0000024 3300044684 Bacteria 110205
284 Ga0466966_0000134 3300044684 Bacteria 47765
285 Ga0466966_0007082 3300044684 Bacteria 7432
286 Ga0466961_0006172 3300044693 Bacteria 7607
287 Ga0466961_0023570 3300044693 Bacteria 3960
288 Ga0466961_0115861 3300044693 Bacteria 1684
289 Ga0466963_0004731 3300044694 Bacteria 7944
290 Ga0466963_0057530 3300044694 Bacteria 2589
291 Ga0466964_0020470 3300044706 Bacteria 2548
292 Ga0453684_0034048 3300044712 Bacteria 7083
293 Ga0466971_0001591 3300044719 Bacteria 9582
294 Ga0466971_0002073 3300044719 Bacteria 8499
295 Ga0466970_0009385 3300044765 Bacteria 4946
296 Ga0466970_0016868 3300044765 Bacteria 3770
297 Ga0466970_0019354 3300044765 Bacteria 3528
298 Ga0466957_0003563 3300044842 Bacteria 8576
299 Ga0466957_0011686 3300044842 Bacteria 5074
300 Ga0466959_0002275 3300045049 Bacteria 12245
301 Ga0466959_0018078 3300045049 Bacteria 5173
302 Ga0466959_0089478 3300045049 Bacteria 2212
303 Ga0466959_0134267 3300045049 Bacteria 1752
304 Ga0466958_0003950 3300045836 Bacteria 7777
305 Ga0466958_0007169 3300045836 Bacteria 6112
306 Ga0466958_0009829 3300045836 Bacteria 5338
307 Ga0466958_0016375 3300045836 Bacteria 4268
308 Ga0495627_002649 3300046453 Bacteria 8415
309 Ga0495592_0017597 3300046454 Bacteria 5433
310 Ga0495592_0222599 3300046454 Bacteria 1261
311 Ga0495629_0036316 3300046459 Bacteria 3479
312 Ga0495638_0024113 3300046460 Bacteria 3971
313 Ga0495651_0004685 3300046462 Bacteria 10466
314 Ga0495651_0120242 3300046462 Bacteria 1930
315 Ga0495653_0015984 3300046463 Bacteria 6116
316 Ga0495653_0081072 3300046463 Bacteria 2398
317 Ga0495650_0002137 3300046471 Bacteria 16818
318 Ga0495650_0023101 3300046471 Bacteria 2967
319 Ga0495605_0007314 3300046474 Bacteria 6272
320 Ga0495664_0014022 3300046477 Bacteria 4540
321 Ga0495596_0000331 3300046500 Bacteria 30844
322 Ga0495607_0051518 3300046501 Bacteria 2390
323 Ga0495606_0029896 3300046507 Bacteria 3817
324 Ga0495608_0008736 3300046511 Bacteria 7086
325 Ga0495610_0000728 3300046512 Bacteria 31222
326 Ga0495616_0000650 3300046513 Bacteria 25854
327 Ga0495616_0007076 3300046513 Bacteria 6739
328 Ga0495618_0005814 3300046514 Bacteria 7501
329 Ga0495620_0004324 3300046515 Bacteria 8029
330 Ga0495628_0002031 3300046516 Bacteria 18340
331 Ga0495628_0007114 3300046516 Bacteria 9692
332 Ga0495631_0000264 3300046518 Bacteria 36684
333 Ga0495637_0020550 3300046520 Bacteria 3038
334 Ga0495637_0025109 3300046520 Bacteria 2689
335 Ga0495652_0004043 3300046529 Bacteria 14180
336 Ga0495652_0010845 3300046529 Bacteria 8256
337 Ga0495652_0013397 3300046529 Bacteria 7379
338 Ga0495654_0008138 3300046530 Bacteria 5808
339 Ga0495665_0009285 3300046531 Bacteria 5327
340 Ga0495609_0027795 3300046538 Bacteria 2583
341 Ga0495597_0019622 3300046542 Bacteria 3160
342 Ga0495645_0017013 3300046543 Bacteria 5205
343 Ga0495645_0042019 3300046543 Bacteria 3333
344 Ga0495656_0000809 3300046615 Bacteria 10113
345 Ga0495625_0000045 3300046660 Bacteria 202475
346 Ga0495625_0004071 3300046660 Bacteria 13965
347 Ga0495625_0208498 3300046660 Bacteria 1285
348 Ga0495635_0061198 3300046663 Bacteria 2586
349 Ga0495635_0072896 3300046663 Bacteria 2352
350 Ga0495661_0057517 3300046665 Bacteria 2321
351 Ga0495588_0018593 3300046674 Bacteria 3391
352 Ga0495588_0192739 3300046674 Bacteria 1076
353 Ga0495657_0011596 3300046675 Bacteria 6586
354 Ga0495599_0017939 3300046678 Bacteria 4408
355 Ga0495623_0002736 3300046679 Bacteria 11644
356 Ga0495623_0029166 3300046679 Bacteria 3551
357 Ga0495646_0000603 3300046680 Bacteria 19560
358 Ga0495646_0003142 3300046680 Bacteria 10251
359 Ga0495646_0242325 3300046680 Bacteria 968
360 Ga0495658_0167705 3300046683 Bacteria 1357
361 Ga0495669_0078118 3300046684 Bacteria 1516
362 Ga0495624_0008091 3300046690 Bacteria 7360
363 Ga0495624_0016909 3300046690 Bacteria 4906
364 Ga0495670_0105522 3300046691 Bacteria 1455
365 Ga0495671_0001551 3300046692 Bacteria 15270
366 Ga0495671_0001739 3300046692 Bacteria 14116
367 Ga0495649_0023951 3300046694 Bacteria 3408
368 Ga0495600_0038852 3300046809 Bacteria 3098
369 Ga0495660_0057537 3300046810 Bacteria 2097
370 Ga0495604_0008587 3300047317 Bacteria 8071
371 Ga0495680_0018092 3300047322 Bacteria 5996
372 Ga0495680_0076624 3300047322 Bacteria 2535
373 Ga0495673_0031911 3300047469 Bacteria 2463
374 Ga0495686_0000067 3300047472 Bacteria 218601
375 Ga0495593_0016011 3300047673 Bacteria 4233
376 Ga0495593_0020913 3300047673 Bacteria 3658
377 Ga0495602_0044487 3300048088 Bacteria 4026
378 Ga0495602_0070715 3300048088 Bacteria 2984
379 Ga0495602_0194292 3300048088 Bacteria 1553
380 Ga0495614_0027682 3300048089 Bacteria 2443
381 Ga0496101_0003950 3300048904 Bacteria 9271
382 Ga0496103_0394964 3300048906 Bacteria 888
383 Ga0496104_0103221 3300048907 Bacteria 2731
384 Ga0496105_0016499 3300048908 Bacteria 5897
385 Ga0496111_0220179 3300048914 Bacteria 1410
386 Ga0496114_0164150 3300048917 Bacteria 1933
387 Ga0496116_0014689 3300048919 Bacteria 6238
388 Ga0496116_0060971 3300048919 Bacteria 2444
389 Ga0496117_0014867 3300048920 Bacteria 6678
390 Ga0496118_0010807 3300048921 Bacteria 8993
391 Ga0496118_0077489 3300048921 Bacteria 2357
392 Ga0496121_0036415 3300048924 Bacteria 4385
393 Ga0496122_0003887 3300048925 Bacteria 19143
394 Ga0496122_0006857 3300048925 Bacteria 12901
395 Ga0496122_0026487 3300048925 Bacteria 4996
396 Ga0496123_0002370 3300048926 Bacteria 23635
397 Ga0496123_0004365 3300048926 Bacteria 14939
398 Ga0496123_0024866 3300048926 Bacteria 4534
399 Ga0496123_0056230 3300048926 Bacteria 2574
400 Ga0496125_0007438 3300048928 Bacteria 11649
401 Ga0496125_0025066 3300048928 Bacteria 5472
402 Ga0496125_0069303 3300048928 Bacteria 2769
403 Ga0496125_0157444 3300048928 Bacteria 1549
404 Ga0496126_0097268 3300048929 Bacteria 2580
405 Ga0501043_0024311 3300049579 Bacteria 4755
406 Ga0501225_0031288 3300049705 Bacteria 1464
407 nmdc:mga03683_14529_c1 3300050489 Bacteria 2915
408 nmdc:mga0k408_22596_c1 3300050493 Bacteria 3542
409 nmdc:mga07m45_139405_c1 3300050496 Bacteria 1404
410 nmdc:mga07m45_636_c1 3300050496 Bacteria 14923
411 nmdc:mga07m45_927_c1 3300050496 Bacteria 12821
412 Ga0495601_0109801 3300053077 Bacteria 1786
413 Ga0500610_0002074 3300053079 Bacteria 7211
414 Ga0500610_0063098 3300053079 Bacteria 1932
415 Ga0500651_0001130 3300053093 Bacteria 13214
416 Ga0500571_000655 3300053110 Bacteria 14384
417 Ga0500593_000088 3300053117 Bacteria 33611
418 Ga0500594_0014651 3300053118 Bacteria 1880
419 Ga0500595_000834 3300053119 Bacteria 17625
420 Ga0500607_001303 3300053121 Bacteria 22821
421 Ga0500607_016032 3300053121 Bacteria 4308
422 Ga0500608_028154 3300053122 Bacteria 2651
423 Ga0500618_002131 3300053125 Bacteria 7808
424 Ga0500618_016150 3300053125 Bacteria 1873
425 Ga0500626_002948 3300053128 Bacteria 6062
426 Ga0500655_002542 3300053133 Bacteria 3312
427 Ga0500658_0004135 3300053134 Bacteria 5451
428 Ga0500658_0004150 3300053134 Bacteria 5443
429 Ga0500559_0017055 3300053136 Bacteria 3067
430 Ga0500564_008194 3300053138 Bacteria 4480
431 Ga0500568_0001273 3300053139 Bacteria 16617
432 Ga0500574_000508 3300053141 Bacteria 4971
433 Ga0500616_0013890 3300053153 Bacteria 4649
434 Ga0500619_000259 3300053154 Bacteria 11195
435 Ga0500627_0000349 3300053158 Bacteria 12529
436 Ga0500638_000681 3300053162 Bacteria 8980
437 Ga0500636_0013371 3300053177 Bacteria 4819
438 Ga0466962_0001598 3300061719 Bacteria 10607
439 Ga0466962_0002324 3300061719 Bacteria 9008
440 Ga0466962_0003387 3300061719 Bacteria 7590
441 Ga0466962_0070401 3300061719 Bacteria 1671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10008652 rootH1_100086522 267
2 3300046680 Ga0495646_0242325 Ga0495646_0242325_106_936 270
3 3300048906 Ga0496103_0394964 Ga0496103_0394964_28_858 270
4 3300025321 Ga0207656_10104418 Ga0207656_101044182 279
5 3300044712 Ga0453684_0034048 Ga0453684_0034048_667_1602 296
6 3300046514 Ga0495618_0005814 Ga0495618_0005814_856_1764 296
7 iso_pu_bacteria 2840878972 2840879231 302
8 3300044693 Ga0466961_0023570 Ga0466961_0023570_60_1025 305
9 3300031250 Ga0265331_10022699 Ga0265331_100226992 307
10 3300031251 Ga0265327_10000698 Ga0265327_1000069844 307
11 3300003187 JGI25151J46595_10001057 JGI25151J46595_1000105713 309
12 3300006178 Ga0075367_10171997 Ga0075367_101719972 309
13 3300006195 Ga0075366_10011218 Ga0075366_100112184 309
14 3300006353 Ga0075370_10013768 Ga0075370_100137685 309
15 3300025258 Ga0209129_1006434 Ga0209129_10064343 309
16 3300025294 Ga0209025_1000204 Ga0209025_1000204114 309
17 3300050493 nmdc:mga0k408_22596_c1 nmdc:mga0k408_22596_c1_1863_2861 309
18 3300050496 nmdc:mga07m45_636_c1 nmdc:mga07m45_636_c1_6747_7745 309
19 3300003773 Ga0055537_1001937 Ga0055537_10019376 311
20 3300003784 Ga0055534_1009666 Ga0055534_10096662 311
21 3300003790 Ga0055528_1003830 Ga0055528_10038307 311
22 3300005844 Ga0068862_100011851 Ga0068862_1000118516 311
23 3300025273 Ga0209673_1001140 Ga0209673_100114012 311
24 3300025273 Ga0209673_1002762 Ga0209673_10027628 311
25 3300025284 Ga0209130_1000560 Ga0209130_100056011 311
26 3300025291 Ga0209675_1000506 Ga0209675_100050618 311
27 3300025294 Ga0209025_1003410 Ga0209025_10034104 311
28 3300025295 Ga0209564_1000760 Ga0209564_100076034 311
29 3300025299 Ga0209256_1000095 Ga0209256_1000095104 311
30 3300025302 Ga0207426_1001262 Ga0207426_100126212 311
31 3300028380 Ga0268265_10017960 Ga0268265_100179602 311
32 3300046674 Ga0495588_0192739 Ga0495588_0192739_106_1059 311
33 3300053122 Ga0500608_028154 Ga0500608_028154_413_1411 311
34 3300031251 Ga0265327_10001208 Ga0265327_1000120829 313
35 3300048919 Ga0496116_0060971 Ga0496116_0060971_17_979 314
36 3300046810 Ga0495660_0057537 Ga0495660_0057537_676_1674 315
37 3300053121 Ga0500607_001303 Ga0500607_001303_7298_8296 315
38 iso_pu_bacteria 2818991436 2819542173 315
39 3300044684 Ga0466966_0000024 Ga0466966_0000024_63661_64707 317
40 3300044694 Ga0466963_0057530 Ga0466963_0057530_1094_2140 317
41 3300044719 Ga0466971_0002073 Ga0466971_0002073_2201_3247 317
42 3300045836 Ga0466958_0009829 Ga0466958_0009829_1180_2226 317
43 3300061719 Ga0466962_0002324 Ga0466962_0002324_6535_7581 317
44 3300039447 Ga0436361_0159409 Ga0436361_0159409_29353_30324 318
45 3300039447 Ga0436361_0371158 Ga0436361_0371158_854_1825 318
46 iso_pu_bacteria 2721755763 2723875909 318
47 3300002737 JGI25162J39368_1000023 JGI25162J39368_1000023113 319
48 3300002771 JGI25163J39215_1003613 JGI25163J39215_10036131 319
49 3300003214 JGI25165J46597_1000030 JGI25165J46597_1000030187 319
50 3300003751 Ga0055538_1000017 Ga0055538_1000017113 319
51 3300003752 Ga0055539_1000022 Ga0055539_1000022113 319
52 3300003756 Ga0055533_1000030 Ga0055533_1000030113 319
53 3300003759 Ga0055525_1000034 Ga0055525_1000034113 319
54 3300003841 Ga0055541_1000015 Ga0055541_1000015113 319
55 3300015262 Ga0182007_10001545 Ga0182007_1000154511 319
56 3300015262 Ga0182007_10007307 Ga0182007_100073073 319
57 3300015265 Ga0182005_1000360 Ga0182005_100036016 319
58 3300025224 Ga0209784_100034 Ga0209784_100034187 319
59 3300025225 Ga0209566_100038 Ga0209566_100038112 319
60 3300025226 Ga0209674_100056 Ga0209674_100056187 319
61 3300025230 Ga0209563_100057 Ga0209563_100057112 319
62 3300025231 Ga0207427_100245 Ga0207427_10024528 319
63 3300025233 Ga0209437_100071 Ga0209437_100071112 319
64 3300025253 Ga0209677_100035 Ga0209677_100035187 319
65 3300025261 Ga0209233_1000094 Ga0209233_1000094112 319
66 3300046454 Ga0495592_0017597 Ga0495592_0017597_3613_4590 319
67 3300046462 Ga0495651_0004685 Ga0495651_0004685_5650_6627 319
68 3300046462 Ga0495651_0120242 Ga0495651_0120242_394_1371 319
69 3300046463 Ga0495653_0015984 Ga0495653_0015984_2303_3280 319
70 3300046511 Ga0495608_0008736 Ga0495608_0008736_5722_6699 319
71 3300046516 Ga0495628_0002031 Ga0495628_0002031_11847_12824 319
72 3300046516 Ga0495628_0007114 Ga0495628_0007114_7118_8095 319
73 3300046529 Ga0495652_0004043 Ga0495652_0004043_12638_13615 319
74 3300046529 Ga0495652_0010845 Ga0495652_0010845_5515_6492 319
75 3300046529 Ga0495652_0013397 Ga0495652_0013397_5856_6833 319
76 3300046663 Ga0495635_0061198 Ga0495635_0061198_1328_2305 319
77 3300046675 Ga0495657_0011596 Ga0495657_0011596_2408_3385 319
78 3300046678 Ga0495599_0017939 Ga0495599_0017939_432_1409 319
79 3300046679 Ga0495623_0002736 Ga0495623_0002736_5189_6166 319
80 3300046680 Ga0495646_0000603 Ga0495646_0000603_1606_2583 319
81 3300046680 Ga0495646_0003142 Ga0495646_0003142_6498_7475 319
82 3300046690 Ga0495624_0008091 Ga0495624_0008091_5488_6465 319
83 3300046809 Ga0495600_0038852 Ga0495600_0038852_1627_2604 319
84 3300047317 Ga0495604_0008587 Ga0495604_0008587_703_1680 319
85 3300048088 Ga0495602_0044487 Ga0495602_0044487_384_1361 319
86 3300048088 Ga0495602_0070715 Ga0495602_0070715_1535_2512 319
87 3300053077 Ga0495601_0109801 Ga0495601_0109801_350_1327 319
88 3300053119 Ga0500595_000834 Ga0500595_000834_10304_11281 319
89 3300053141 Ga0500574_000508 Ga0500574_000508_2372_3349 319
90 3300053154 Ga0500619_000259 Ga0500619_000259_1827_2804 319
91 3300015683 Ga0183362_10005 Ga0183362_10005293 320
92 3300003322 rootL2_10111768 rootL2_101117686 321
93 3300003784 Ga0055534_1003358 Ga0055534_10033585 321
94 3300025284 Ga0209130_1004616 Ga0209130_10046162 321
95 3300025291 Ga0209675_1011140 Ga0209675_10111404 321
96 3300025292 Ga0209676_1003151 Ga0209676_10031519 321
97 3300025304 Ga0209257_1012279 Ga0209257_10122794 321
98 3300031456 Ga0307513_10113721 Ga0307513_101137213 321
99 3300044666 Ga0466977_0000036 Ga0466977_0000036_13909_14919 321
100 3300049579 Ga0501043_0024311 Ga0501043_0024311_1277_2287 321
101 iso_pu_bacteria 2738543013 2739251965 321
102 iso_pu_bacteria 2513020051 2513230621 322
103 iso_pu_bacteria 2599185214 2599626305 322
104 iso_pu_bacteria 2599185226 2599676371 322
105 iso_pu_bacteria 2599185227 2599682007 322
106 iso_pu_bacteria 2599185229 2599695657 322
107 iso_pu_bacteria 2643221628 2644161745 322
108 iso_pu_bacteria 2643221658 2644328478 322
109 iso_pu_bacteria 2643221672 2644399711 322
110 iso_pu_bacteria 2738541277 2738721275 322
111 iso_pu_bacteria 2738541307 2738880619 322
112 iso_pu_bacteria 2738543019 2739280944 322
113 iso_pu_bacteria 2818991446 2819601583 322
114 iso_pu_bacteria 2831265667 2831269197 322
115 iso_pu_bacteria 2838054893 2838059171 322
116 iso_pu_bacteria 2842677519 2842679715 322
117 iso_pu_bacteria 2899924645 2899930646 322
118 iso_pu_bacteria 2904449895 2904452555 322
119 iso_pu_bacteria 2904456579 2904460846 322
120 iso_pu_bacteria 2919462493 2919463815 322
121 iso_pu_bacteria 2928037797 2928041032 322
122 iso_pu_bacteria 2928044640 2928047874 322
123 iso_pu_bacteria 2928051484 2928055766 322
124 iso_pu_bacteria 2928064002 2928069865 322
125 iso_pu_bacteria 2928070936 2928075274 322
126 iso_pu_bacteria 2928084124 2928088566 322
127 iso_pu_bacteria 2929520902 2929522812 322
128 iso_pu_bacteria 2945909444 2945909896 322
129 iso_pu_bacteria 2945945610 2945945940 322
130 iso_pu_bacteria 2945972063 2945975558 322
131 iso_pu_bacteria 2945984333 2945988143 322
132 3300005356 Ga0070674_100012504 Ga0070674_1000125043 323
133 3300009011 Ga0105251_10070916 Ga0105251_100709162 323
134 3300025937 Ga0207669_10101618 Ga0207669_101016182 323
135 3300028379 Ga0268266_10064452 Ga0268266_100644522 323
136 iso_pu_bacteria 2885198086 2885203091 323
137 iso_pu_bacteria 2885211737 2885216512 323
138 3300044693 Ga0466961_0006172 Ga0466961_0006172_5014_6045 324
139 3300044765 Ga0466970_0016868 Ga0466970_0016868_1566_2597 324
140 3300045049 Ga0466959_0089478 Ga0466959_0089478_1077_2108 324
141 3300046454 Ga0495592_0222599 Ga0495592_0222599_87_1118 324
142 3300046471 Ga0495650_0023101 Ga0495650_0023101_1023_2054 324
143 3300046543 Ga0495645_0042019 Ga0495645_0042019_2216_3247 324
144 3300047472 Ga0495686_0000067 Ga0495686_0000067_134911_135942 324
145 3300048914 Ga0496111_0220179 Ga0496111_0220179_259_1290 324
146 3300003187 JGI25151J46595_10000872 JGI25151J46595_1000087211 325
147 3300003187 JGI25151J46595_10001511 JGI25151J46595_100015116 325
148 3300003771 Ga0055526_1008124 Ga0055526_10081242 325
149 3300003771 Ga0055526_1012806 Ga0055526_10128065 325
150 3300003773 Ga0055537_1001494 Ga0055537_10014949 325
151 3300003775 Ga0055524_1000491 Ga0055524_100049118 325
152 3300003784 Ga0055534_1000456 Ga0055534_100045615 325
153 3300003784 Ga0055534_1004235 Ga0055534_10042352 325
154 3300006948 Ga0099826_10000007 Ga0099826_1000000799 325
155 3300017792 Ga0163161_10004197 Ga0163161_100041978 325
156 3300025263 Ga0209565_1000106 Ga0209565_100010642 325
157 3300025291 Ga0209675_1000168 Ga0209675_100016815 325
158 3300025291 Ga0209675_1000363 Ga0209675_100036314 325
159 3300025292 Ga0209676_1000036 Ga0209676_1000036179 325
160 3300025294 Ga0209025_1000462 Ga0209025_100046214 325
161 3300025294 Ga0209025_1001247 Ga0209025_100124724 325
162 3300025294 Ga0209025_1032464 Ga0209025_10324642 325
163 3300025295 Ga0209564_1001348 Ga0209564_100134815 325
164 3300025295 Ga0209564_1003006 Ga0209564_10030068 325
165 3300025295 Ga0209564_1003952 Ga0209564_10039525 325
166 3300025297 Ga0209758_1016188 Ga0209758_10161883 325
167 3300025299 Ga0209256_1000220 Ga0209256_100022057 325
168 3300025923 Ga0207681_10126460 Ga0207681_101264602 325
169 3300027666 Ga0209282_1000061 Ga0209282_100006184 325
170 3300030733 Ga0314311_1043350 Ga0314311_10433504 325
171 3300030735 Ga0316178_1108165 Ga0316178_11081652 325
172 3300030744 Ga0316181_1138108 Ga0316181_11381082 325
173 3300031731 Ga0307405_10018086 Ga0307405_100180862 325
174 3300031731 Ga0307405_10064576 Ga0307405_100645763 325
175 3300031911 Ga0307412_10120698 Ga0307412_101206982 325
176 3300046474 Ga0495605_0007314 Ga0495605_0007314_368_1387 325
177 3300046500 Ga0495596_0000331 Ga0495596_0000331_6738_7757 325
178 3300046501 Ga0495607_0051518 Ga0495607_0051518_1319_2338 325
179 3300046512 Ga0495610_0000728 Ga0495610_0000728_6755_7774 325
180 3300046513 Ga0495616_0007076 Ga0495616_0007076_1555_2574 325
181 3300046538 Ga0495609_0027795 Ga0495609_0027795_64_1083 325
182 3300046542 Ga0495597_0019622 Ga0495597_0019622_646_1665 325
183 3300046665 Ga0495661_0057517 Ga0495661_0057517_134_1153 325
184 3300046684 Ga0495669_0078118 Ga0495669_0078118_337_1356 325
185 3300046692 Ga0495671_0001739 Ga0495671_0001739_5049_6068 325
186 3300046694 Ga0495649_0023951 Ga0495649_0023951_1258_2277 325
187 3300047469 Ga0495673_0031911 Ga0495673_0031911_465_1484 325
188 3300048924 Ga0496121_0036415 Ga0496121_0036415_1196_2215 325
189 3300048925 Ga0496122_0003887 Ga0496122_0003887_16542_17561 325
190 3300048926 Ga0496123_0004365 Ga0496123_0004365_1627_2646 325
191 3300048929 Ga0496126_0097268 Ga0496126_0097268_541_1560 325
192 iso_pu_bacteria 2501025504 2501410251 325
193 iso_pu_bacteria 2510917013 2511090189 325
194 iso_pu_bacteria 2510917014 2511095569 325
195 iso_pu_bacteria 2510917015 2511102186 325
196 iso_pu_bacteria 2513237082 2513554626 325
197 iso_pu_bacteria 2513237083 2513563577 325
198 iso_pu_bacteria 2515154123 2515688171 325
199 iso_pu_bacteria 2515154189 2516018605 325
200 iso_pu_bacteria 2856287931 2856292311 325
201 iso_pu_bacteria 2857357740 2857365537 325
202 iso_pu_bacteria 2883087390 2883096232 325
203 iso_pu_bacteria 8003955200 8003960324 325
204 3300002773 JGI25152J39213_1006922 JGI25152J39213_10069223 326
205 3300003187 JGI25151J46595_10055216 JGI25151J46595_100552161 326
206 3300003322 rootL2_10172394 rootL2_101723941 326
207 3300003578 Ga0006562J51391_1077671 Ga0006562J51391_10776716 326
208 3300003578 Ga0006562J51391_1077673 Ga0006562J51391_10776736 326
209 3300003578 Ga0006562J51391_1081221 Ga0006562J51391_10812212 326
210 3300003761 Ga0055535_1000894 Ga0055535_10008947 326
211 3300003762 Ga0055542_1000074 Ga0055542_1000074125 326
212 3300003773 Ga0055537_1000049 Ga0055537_100004960 326
213 3300003781 Ga0055536_1008597 Ga0055536_10085973 326
214 3300003784 Ga0055534_1000049 Ga0055534_100004939 326
215 3300003790 Ga0055528_1001619 Ga0055528_10016193 326
216 3300003791 Ga0055530_10001472 Ga0055530_100014727 326
217 3300003791 Ga0055530_10015884 Ga0055530_100158843 326
218 3300003792 Ga0055540_1000879 Ga0055540_100087914 326
219 3300003792 Ga0055540_1001733 Ga0055540_10017336 326
220 3300003792 Ga0055540_1012035 Ga0055540_10120352 326
221 3300003794 Ga0055531_10001127 Ga0055531_100011278 326
222 3300003794 Ga0055531_10006654 Ga0055531_100066547 326
223 3300005288 Ga0065714_10068536 Ga0065714_100685362 326
224 3300005344 Ga0070661_100042701 Ga0070661_1000427014 326
225 3300005539 Ga0068853_100006764 Ga0068853_10000676411 326
226 3300005577 Ga0068857_100039265 Ga0068857_1000392652 326
227 3300005616 Ga0068852_100079388 Ga0068852_1000793884 326
228 3300005834 Ga0068851_10008702 Ga0068851_100087025 326
229 3300006048 Ga0075363_100033138 Ga0075363_1000331382 326
230 3300006048 Ga0075363_100099578 Ga0075363_1000995782 326
231 3300006051 Ga0075364_10007995 Ga0075364_100079954 326
232 3300006051 Ga0075364_10086761 Ga0075364_100867612 326
233 3300006058 Ga0075432_10006234 Ga0075432_100062343 326
234 3300006177 Ga0075362_10005019 Ga0075362_100050195 326
235 3300006195 Ga0075366_10082699 Ga0075366_100826992 326
236 3300006353 Ga0075370_10001114 Ga0075370_100011146 326
237 3300006353 Ga0075370_10003360 Ga0075370_100033608 326
238 3300006353 Ga0075370_10122309 Ga0075370_101223092 326
239 3300006946 Ga0079104_1033342 Ga0079104_10333422 326
240 3300006948 Ga0099826_10007798 Ga0099826_100077983 326
241 3300009093 Ga0105240_10187984 Ga0105240_101879843 326
242 3300009545 Ga0105237_10305507 Ga0105237_103055071 326
243 3300011119 Ga0105246_10047951 Ga0105246_100479513 326
244 3300012502 Ga0157347_1000188 Ga0157347_10001884 326
245 3300013100 Ga0157373_10017716 Ga0157373_100177162 326
246 3300013100 Ga0157373_10197744 Ga0157373_101977442 326
247 3300013102 Ga0157371_10154689 Ga0157371_101546892 326
248 3300014497 Ga0182008_10005473 Ga0182008_100054732 326
249 3300014497 Ga0182008_10066865 Ga0182008_100668651 326
250 3300015261 Ga0182006_1001767 Ga0182006_10017677 326
251 3300015262 Ga0182007_10000319 Ga0182007_1000031922 326
252 3300017792 Ga0163161_10000320 Ga0163161_1000032023 326
253 3300025208 Ga0209436_105910 Ga0209436_1059103 326
254 3300025228 Ga0209672_100925 Ga0209672_1009256 326
255 3300025229 Ga0209147_101353 Ga0209147_1013538 326
256 3300025242 Ga0209258_100176 Ga0209258_10017615 326
257 3300025245 Ga0207425_1000274 Ga0207425_100027425 326
258 3300025254 Ga0209148_1000033 Ga0209148_1000033146 326
259 3300025258 Ga0209129_1000270 Ga0209129_100027018 326
260 3300025263 Ga0209565_1000020 Ga0209565_1000020345 326
261 3300025263 Ga0209565_1000484 Ga0209565_100048412 326
262 3300025263 Ga0209565_1001828 Ga0209565_10018288 326
263 3300025273 Ga0209673_1000295 Ga0209673_100029539 326
264 3300025284 Ga0209130_1000558 Ga0209130_100055823 326
265 3300025291 Ga0209675_1000014 Ga0209675_1000014334 326
266 3300025291 Ga0209675_1004572 Ga0209675_10045722 326
267 3300025292 Ga0209676_1000048 Ga0209676_1000048183 326
268 3300025292 Ga0209676_1000124 Ga0209676_1000124159 326
269 3300025292 Ga0209676_1029132 Ga0209676_10291322 326
270 3300025292 Ga0209676_1035313 Ga0209676_10353132 326
271 3300025292 Ga0209676_1047892 Ga0209676_10478921 326
272 3300025294 Ga0209025_1000733 Ga0209025_100073342 326
273 3300025294 Ga0209025_1007631 Ga0209025_10076318 326
274 3300025294 Ga0209025_1008440 Ga0209025_10084402 326
275 3300025295 Ga0209564_1000753 Ga0209564_100075335 326
276 3300025297 Ga0209758_1000833 Ga0209758_10008337 326
277 3300025297 Ga0209758_1021733 Ga0209758_10217333 326
278 3300025298 Ga0209050_1000012 Ga0209050_1000012183 326
279 3300025298 Ga0209050_1001006 Ga0209050_100100624 326
280 3300025298 Ga0209050_1003791 Ga0209050_10037917 326
281 3300025299 Ga0209256_1000527 Ga0209256_100052718 326
282 3300025302 Ga0207426_1001012 Ga0207426_100101218 326
283 3300025303 Ga0209051_1000019 Ga0209051_1000019102 326
284 3300025303 Ga0209051_1000099 Ga0209051_1000099114 326
285 3300025303 Ga0209051_1000579 Ga0209051_100057922 326
286 3300025303 Ga0209051_1019700 Ga0209051_10197003 326
287 3300025304 Ga0209257_1000024 Ga0209257_1000024129 326
288 3300025304 Ga0209257_1000258 Ga0209257_100025872 326
289 3300025321 Ga0207656_10016242 Ga0207656_100162422 326
290 3300025728 Ga0207655_1012656 Ga0207655_10126562 326
291 3300025914 Ga0207671_10280682 Ga0207671_102806822 326
292 3300025933 Ga0207706_10010483 Ga0207706_100104836 326
293 3300025933 Ga0207706_10108566 Ga0207706_101085663 326
294 3300025935 Ga0207709_10063408 Ga0207709_100634083 326
295 3300026041 Ga0207639_10156733 Ga0207639_101567332 326
296 3300026116 Ga0207674_10030972 Ga0207674_100309726 326
297 3300026142 Ga0207698_10298690 Ga0207698_102986902 326
298 3300027111 Ga0209281_1016793 Ga0209281_10167931 326
299 3300027666 Ga0209282_1000501 Ga0209282_10005012 326
300 3300027907 Ga0207428_10143218 Ga0207428_101432182 326
301 3300030742 Ga0316183_1097411 Ga0316183_10974111 326
302 3300031649 Ga0307514_10015883 Ga0307514_100158831 326
303 3300031824 Ga0307413_10022834 Ga0307413_100228343 326
304 3300031901 Ga0307406_10011586 Ga0307406_100115867 326
305 3300031901 Ga0307406_10215711 Ga0307406_102157112 326
306 3300031911 Ga0307412_10065481 Ga0307412_100654812 326
307 3300032004 Ga0307414_10128368 Ga0307414_101283681 326
308 3300032005 Ga0307411_10000669 Ga0307411_100006699 326
309 3300032005 Ga0307411_10201294 Ga0307411_102012942 326
310 3300041404 Ga0439436_0008551 Ga0439436_0008551_1338_2336 326
311 3300041411 Ga0439466_0003682 Ga0439466_0003682_1138_2136 326
312 3300042002 Ga0439442_000830 Ga0439442_000830_2630_3628 326
313 3300042134 Ga0450898_002806 Ga0450898_002806_637_1635 326
314 3300042145 Ga0450906_000601 Ga0450906_000601_4066_5064 326
315 3300042184 Ga0450908_001510 Ga0450908_001510_1449_2447 326
316 3300042435 Ga0439434_0000518 Ga0439434_0000518_9954_10952 326
317 3300046453 Ga0495627_002649 Ga0495627_002649_5202_6200 326
318 3300046460 Ga0495638_0024113 Ga0495638_0024113_979_1977 326
319 3300046513 Ga0495616_0000650 Ga0495616_0000650_7922_8920 326
320 3300046515 Ga0495620_0004324 Ga0495620_0004324_2444_3442 326
321 3300046518 Ga0495631_0000264 Ga0495631_0000264_18893_19891 326
322 3300046520 Ga0495637_0020550 Ga0495637_0020550_824_1822 326
323 3300046520 Ga0495637_0025109 Ga0495637_0025109_189_1187 326
324 3300046530 Ga0495654_0008138 Ga0495654_0008138_3829_4827 326
325 3300046660 Ga0495625_0000045 Ga0495625_0000045_100360_101358 326
326 3300046660 Ga0495625_0208498 Ga0495625_0208498_218_1216 326
327 3300046674 Ga0495588_0018593 Ga0495588_0018593_198_1196 326
328 3300046683 Ga0495658_0167705 Ga0495658_0167705_318_1316 326
329 3300046691 Ga0495670_0105522 Ga0495670_0105522_259_1257 326
330 3300046692 Ga0495671_0001551 Ga0495671_0001551_6823_7821 326
331 3300047673 Ga0495593_0020913 Ga0495593_0020913_1583_2581 326
332 3300048089 Ga0495614_0027682 Ga0495614_0027682_900_1898 326
333 3300048904 Ga0496101_0003950 Ga0496101_0003950_6789_7787 326
334 3300048919 Ga0496116_0014689 Ga0496116_0014689_696_1694 326
335 3300048920 Ga0496117_0014867 Ga0496117_0014867_3456_4454 326
336 3300048921 Ga0496118_0010807 Ga0496118_0010807_355_1353 326
337 3300048921 Ga0496118_0077489 Ga0496118_0077489_391_1389 326
338 3300048925 Ga0496122_0026487 Ga0496122_0026487_1594_2592 326
339 3300048926 Ga0496123_0024866 Ga0496123_0024866_903_1901 326
340 3300048926 Ga0496123_0056230 Ga0496123_0056230_790_1788 326
341 3300048928 Ga0496125_0025066 Ga0496125_0025066_219_1217 326
342 3300048928 Ga0496125_0157444 Ga0496125_0157444_456_1454 326
343 3300049705 Ga0501225_0031288 Ga0501225_0031288_92_1090 326
344 3300050489 nmdc:mga03683_14529_c1 nmdc:mga03683_14529_c1_1162_2160 326
345 3300050496 nmdc:mga07m45_139405_c1 nmdc:mga07m45_139405_c1_11_1009 326
346 3300050496 nmdc:mga07m45_927_c1 nmdc:mga07m45_927_c1_6714_7712 326
347 3300053079 Ga0500610_0002074 Ga0500610_0002074_6048_7046 326
348 3300053079 Ga0500610_0063098 Ga0500610_0063098_769_1767 326
349 3300053093 Ga0500651_0001130 Ga0500651_0001130_7236_8234 326
350 3300053110 Ga0500571_000655 Ga0500571_000655_6162_7160 326
351 3300053117 Ga0500593_000088 Ga0500593_000088_25036_26034 326
352 3300053118 Ga0500594_0014651 Ga0500594_0014651_376_1374 326
353 3300053121 Ga0500607_016032 Ga0500607_016032_165_1163 326
354 3300053125 Ga0500618_016150 Ga0500618_016150_105_1103 326
355 3300053128 Ga0500626_002948 Ga0500626_002948_1345_2343 326
356 3300053133 Ga0500655_002542 Ga0500655_002542_1339_2337 326
357 3300053134 Ga0500658_0004135 Ga0500658_0004135_2251_3249 326
358 3300053134 Ga0500658_0004150 Ga0500658_0004150_2241_3239 326
359 3300053136 Ga0500559_0017055 Ga0500559_0017055_290_1288 326
360 3300053138 Ga0500564_008194 Ga0500564_008194_3328_4326 326
361 3300053139 Ga0500568_0001273 Ga0500568_0001273_4110_5108 326
362 3300053153 Ga0500616_0013890 Ga0500616_0013890_2371_3369 326
363 3300053158 Ga0500627_0000349 Ga0500627_0000349_7531_8529 326
364 3300053162 Ga0500638_000681 Ga0500638_000681_7257_8255 326
365 3300053177 Ga0500636_0013371 Ga0500636_0013371_3789_4787 326
366 3300009093 Ga0105240_10112118 Ga0105240_101121184 327
367 3300013105 Ga0157369_10351559 Ga0157369_103515591 327
368 3300025913 Ga0207695_10111530 Ga0207695_101115302 327
369 3300037471 Ga0395905_0024463 Ga0395905_0024463_2764_3804 327
370 3300046459 Ga0495629_0036316 Ga0495629_0036316_970_2010 327
371 3300046463 Ga0495653_0081072 Ga0495653_0081072_814_1854 327
372 3300046477 Ga0495664_0014022 Ga0495664_0014022_3023_4063 327
373 3300046507 Ga0495606_0029896 Ga0495606_0029896_321_1361 327
374 3300046531 Ga0495665_0009285 Ga0495665_0009285_902_1942 327
375 3300046543 Ga0495645_0017013 Ga0495645_0017013_141_1181 327
376 3300046663 Ga0495635_0072896 Ga0495635_0072896_1010_2050 327
377 3300046679 Ga0495623_0029166 Ga0495623_0029166_1652_2692 327
378 3300046690 Ga0495624_0016909 Ga0495624_0016909_957_1997 327
379 3300047322 Ga0495680_0018092 Ga0495680_0018092_2379_3419 327
380 3300047322 Ga0495680_0076624 Ga0495680_0076624_938_1978 327
381 3300047673 Ga0495593_0016011 Ga0495593_0016011_1313_2353 327
382 3300048088 Ga0495602_0194292 Ga0495602_0194292_234_1274 327
383 3300048907 Ga0496104_0103221 Ga0496104_0103221_1198_2238 327
384 3300048908 Ga0496105_0016499 Ga0496105_0016499_3642_4682 327
385 3300002704 JGI25155J39150_1000754 JGI25155J39150_10007542 328
386 3300002705 JGI25156J39149_1011060 JGI25156J39149_10110602 328
387 3300002738 JGI25154J39366_1000836 JGI25154J39366_100083614 328
388 3300025206 Ga0209435_100145 Ga0209435_10014517 328
389 3300025246 Ga0209646_1000321 Ga0209646_100032114 328
390 3300025256 Ga0209759_1000599 Ga0209759_100059926 328
391 3300025972 Ga0207668_10093851 Ga0207668_100938512 328
392 3300046615 Ga0495656_0000809 Ga0495656_0000809_843_1889 328
393 3300048917 Ga0496114_0164150 Ga0496114_0164150_348_1394 328
394 3300005327 Ga0070658_10216367 Ga0070658_102163672 329
395 3300005339 Ga0070660_100019826 Ga0070660_1000198264 329
396 3300005563 Ga0068855_100016180 Ga0068855_10001618010 329
397 3300009545 Ga0105237_10164482 Ga0105237_101644821 329
398 3300013104 Ga0157370_10015763 Ga0157370_100157638 329
399 3300015261 Ga0182006_1023681 Ga0182006_10236812 329
400 3300015262 Ga0182007_10030712 Ga0182007_100307122 329
401 3300025228 Ga0209672_100480 Ga0209672_1004807 329
402 3300025909 Ga0207705_10000761 Ga0207705_1000076119 329
403 3300025949 Ga0207667_10000276 Ga0207667_1000027627 329
404 3300028800 Ga0265338_10001135 Ga0265338_1000113518 329
405 3300031247 Ga0265340_10069869 Ga0265340_100698692 329
406 3300037312 Ga0395899_0000308 Ga0395899_0000308_15105_16154 329
407 3300037418 Ga0395900_0000159 Ga0395900_0000159_15105_16154 329
408 3300037418 Ga0395900_0005041 Ga0395900_0005041_232_1281 329
409 3300037466 Ga0395898_0000425 Ga0395898_0000425_73615_74664 329
410 3300037466 Ga0395898_0002495 Ga0395898_0002495_15360_16409 329
411 3300037466 Ga0395898_0020013 Ga0395898_0020013_4640_5689 329
412 3300038443 Ga0395901_0000017 Ga0395901_0000017_258395_259444 329
413 3300038443 Ga0395901_0000109 Ga0395901_0000109_91018_92067 329
414 3300038443 Ga0395901_0296773 Ga0395901_0296773_565_1614 329
415 3300044656 Ga0466969_0019995 Ga0466969_0019995_515_1564 329
416 3300044656 Ga0466969_0041349 Ga0466969_0041349_656_1705 329
417 3300044656 Ga0466969_0070707 Ga0466969_0070707_392_1441 329
418 3300044658 Ga0466972_0099177 Ga0466972_0099177_121_1170 329
419 3300044659 Ga0466973_0080925 Ga0466973_0080925_200_1249 329
420 3300044683 Ga0466965_0030449 Ga0466965_0030449_857_1906 329
421 3300044684 Ga0466966_0000134 Ga0466966_0000134_39228_40289 329
422 3300044684 Ga0466966_0007082 Ga0466966_0007082_3844_4893 329
423 3300044693 Ga0466961_0115861 Ga0466961_0115861_87_1136 329
424 3300044694 Ga0466963_0004731 Ga0466963_0004731_5270_6331 329
425 3300044706 Ga0466964_0020470 Ga0466964_0020470_334_1383 329
426 3300044719 Ga0466971_0001591 Ga0466971_0001591_5726_6775 329
427 3300044765 Ga0466970_0009385 Ga0466970_0009385_1482_2531 329
428 3300044765 Ga0466970_0019354 Ga0466970_0019354_601_1650 329
429 3300044842 Ga0466957_0003563 Ga0466957_0003563_1786_2835 329
430 3300044842 Ga0466957_0011686 Ga0466957_0011686_3319_4368 329
431 3300045049 Ga0466959_0002275 Ga0466959_0002275_6128_7177 329
432 3300045049 Ga0466959_0018078 Ga0466959_0018078_4077_5126 329
433 3300045049 Ga0466959_0134267 Ga0466959_0134267_231_1280 329
434 3300045836 Ga0466958_0003950 Ga0466958_0003950_515_1564 329
435 3300045836 Ga0466958_0007169 Ga0466958_0007169_533_1582 329
436 3300045836 Ga0466958_0016375 Ga0466958_0016375_2629_3678 329
437 3300046471 Ga0495650_0002137 Ga0495650_0002137_2497_3552 329
438 3300061719 Ga0466962_0001598 Ga0466962_0001598_1564_2613 329
439 3300061719 Ga0466962_0003387 Ga0466962_0003387_6242_7303 329
440 3300061719 Ga0466962_0070401 Ga0466962_0070401_352_1401 329
441 iso_pu_bacteria 2928115317 2928119311 329
442 iso_pu_bacteria 2511231003 2511250870 332
443 iso_pu_bacteria 2511231026 2511387523 332
444 iso_pu_bacteria 2521172590 2521557714 332
445 iso_pu_bacteria 2548876994 2550692636 332
446 iso_pu_bacteria 2551306416 2553002830 332
447 iso_pu_bacteria 2765235838 2765570113 332
448 iso_pu_bacteria 2808606386 2808981601 332
449 iso_pu_bacteria 2808606415 2809129184 332
450 iso_pu_bacteria 2808606419 2809148804 332
451 iso_pu_bacteria 2818991445 2819591567 332
452 iso_pu_bacteria 2818991449 2819615152 332
453 iso_pu_bacteria 2839094727 2839096947 332
454 iso_pu_bacteria 2852618963 2852621342 332
455 iso_pu_bacteria 2884811622 2884816911 332
456 iso_pu_bacteria 2884836552 2884837377 332
457 iso_pu_bacteria 2884852848 2884853668 332
458 iso_pu_bacteria 2896154374 2896155215 332
459 iso_pu_bacteria 2904439833 2904441545 332
460 iso_pu_bacteria 2904530477 2904531525 332
461 iso_pu_bacteria 2904584206 2904586838 332
462 iso_pu_bacteria 2904589729 2904593129 332
463 iso_pu_bacteria 2904601388 2904603025 332
464 iso_pu_bacteria 2919046199 2919050850 332
465 iso_pu_bacteria 2919079590 2919083954 332
466 iso_pu_bacteria 2923510766 2923510920 332
467 iso_pu_bacteria 2928130867 2928130892 332
468 3300025224 Ga0209784_100002 Ga0209784_1000021177 335
469 3300025225 Ga0209566_100003 Ga0209566_1000031177 335
470 3300025226 Ga0209674_100004 Ga0209674_1000041177 335
471 3300025230 Ga0209563_100006 Ga0209563_1000061177 335
472 3300025253 Ga0209677_100003 Ga0209677_1000031177 335
473 3300002704 JGI25155J39150_1000459 JGI25155J39150_10004597 336
474 3300002705 JGI25156J39149_1001386 JGI25156J39149_10013867 336
475 3300002738 JGI25154J39366_1000706 JGI25154J39366_10007068 336
476 3300002741 JGI25157J39369_1000359 JGI25157J39369_10003594 336
477 3300003751 Ga0055538_1000155 Ga0055538_100015525 336
478 3300003752 Ga0055539_1000205 Ga0055539_100020525 336
479 3300003756 Ga0055533_1000207 Ga0055533_100020725 336
480 3300003758 Ga0055532_1000023 Ga0055532_1000023233 336
481 3300003759 Ga0055525_1000284 Ga0055525_100028425 336
482 3300003841 Ga0055541_1000133 Ga0055541_100013324 336
483 3300005563 Ga0068855_100007926 Ga0068855_1000079267 336
484 3300005563 Ga0068855_100102792 Ga0068855_1001027922 336
485 3300005563 Ga0068855_100290779 Ga0068855_1002907791 336
486 3300005614 Ga0068856_100055082 Ga0068856_1000550821 336
487 3300006946 Ga0079104_1002433 Ga0079104_100243314 336
488 3300009093 Ga0105240_10006080 Ga0105240_100060807 336
489 3300009093 Ga0105240_10010984 Ga0105240_100109849 336
490 3300009093 Ga0105240_10045071 Ga0105240_100450712 336
491 3300009545 Ga0105237_10304432 Ga0105237_103044322 336
492 3300009551 Ga0105238_10002922 Ga0105238_1000292212 336
493 3300025206 Ga0209435_100013 Ga0209435_100013345 336
494 3300025229 Ga0209147_100030 Ga0209147_10003011 336
495 3300025233 Ga0209437_100265 Ga0209437_10026525 336
496 3300025242 Ga0209258_100205 Ga0209258_10020510 336
497 3300025246 Ga0209646_1000034 Ga0209646_1000034345 336
498 3300025250 Ga0209026_1000022 Ga0209026_1000022345 336
499 3300025250 Ga0209026_1001923 Ga0209026_10019237 336
500 3300025256 Ga0209759_1000018 Ga0209759_1000018345 336
501 3300025272 Ga0209455_1010908 Ga0209455_10109082 336
502 3300025913 Ga0207695_10006378 Ga0207695_100063787 336
503 3300025913 Ga0207695_10009955 Ga0207695_100099557 336
504 3300025914 Ga0207671_10215873 Ga0207671_102158732 336
505 3300025924 Ga0207694_10002354 Ga0207694_100023549 336
506 3300025949 Ga0207667_10000438 Ga0207667_1000043827 336
507 3300025949 Ga0207667_10032940 Ga0207667_100329405 336
508 3300025949 Ga0207667_10181532 Ga0207667_101815322 336
509 3300026078 Ga0207702_10020507 Ga0207702_100205074 336
510 3300039447 Ga0436361_0339053 Ga0436361_0339053_3996_5030 336
511 3300046660 Ga0495625_0004071 Ga0495625_0004071_6032_7042 336
512 3300048925 Ga0496122_0006857 Ga0496122_0006857_5599_6609 336
513 3300048926 Ga0496123_0002370 Ga0496123_0002370_16945_17955 336
514 3300048928 Ga0496125_0007438 Ga0496125_0007438_5740_6750 336
515 3300048928 Ga0496125_0069303 Ga0496125_0069303_735_1745 336
516 3300053125 Ga0500618_002131 Ga0500618_002131_2364_3389 336

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02626

CT_A_B

Carboxyltransferase domain, subdomain A and B

20

309

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dud-assembly1.cif.gz_A crystal structure of e. coli ybgjk 0.9656 1 321
5dud-assembly1.cif.gz_A crystal structure of e. coli ybgjk 0.9593 1 321
5dud-assembly2.cif.gz_C crystal structure of e. coli ybgjk 0.9506 1 327
5dud-assembly2.cif.gz_C crystal structure of e. coli ybgjk 0.9475 1 327
3mml-assembly2.cif.gz_E allophanate hydrolase complex from mycobacterium smegmatis, msmeg0435-msmeg0436 0.9214 2 301
ID Description Score Start End Superfamily
5dudA02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9773 189 319 2.40.100.10
3mmlG02 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9486 188 299 2.40.100.10
af_Q2FXW9_143_281_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9485 189 326 2.40.100.10
af_Q2G094_189_326_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9379 190 324 2.40.100.10
af_Q2FXW9_143_281_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9354 189 326 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A0P9U5F5-F1-model_v4 Allophanate hydrolase 2 subunit 2 0.9873 194 324 GO:0005524
GO:0016787
AF-W1Y8Y5-F1-model_v4 Carboxyltransferase domain-containing protein 0.9822 199 307 GO:0005524
GO:0016787
AF-I6DQQ4-F1-model_v4 deleted 0.9812 195 324
AF-A0A6C9QK81-F1-model_v4 5-oxoprolinase subunit PxpC (EC 3.5.2.9) 0.9812 209 325 GO:0005524
GO:0017168
AF-W4QA83-F1-model_v4 Allophanate hydrolase 2 subunit 2 0.9772 202 325 GO:0005524
GO:0016787

Feature Viewer

pLDDT pTM Quality
89.75 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map