F458007

General Info

Members Datasets Scaffolds Average Seq Length
516 304 499 255

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_10142350|Ga0207639_101423502
Length 277
Sequence LTAQARGDVAVGLFKRWLAVLRSALFVLWMVLTVVPFALAAVGLSLFVRGDPVYWVCIAWLRLCIHGARVLCGVRHRVSGMEHLPGADSQSAVLLCPKHQSTWETFAFPTLMSHPLCYVFKRELLYIPFFGWAIGRLDMIHIDRSKRTAAWNKVAEQGRKYMARGNWVIMFPEGTRTPRGRQGTYKSGAARLAITVGVPVVPIAVTSAKCWPRKSFVLKPGVIDISIGRPIAPTGRQPDELMREVEAWIEAEMHRLDPEAYAAAAPAPAAREEVAAP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
3 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
4 2643221585 Pelomonas sp. Root662 Isolate Unclassified
5 2643221609 Acidovorax sp. Root217 Isolate Unclassified
6 2643221611 Acidovorax sp. Root219 Isolate Unclassified
7 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
8 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
9 2643221656 Pelomonas sp. Root405 Isolate Unclassified
10 2643221660 Methylibium sp. Root1272 Isolate Unclassified
11 2721755523 Delftia sp. HK171 Isolate Unclassified
12 2738541337 Pelomonas sp. BT06 Isolate Unclassified
13 2738543012 Acidovorax sp. CF301 Isolate Unclassified
14 2816332133 Acidovorax radicis 2721A Isolate Unclassified
15 2831864461 Roseateles noduli HZ7 Isolate Nodule
16 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
17 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
18 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
19 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
20 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
37 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
113 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
166 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
167 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
176 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
177 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
178 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
188 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
211 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
212 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
213 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
214 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
215 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
216 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
217 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
218 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
219 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
220 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
221 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
222 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
223 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
243 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
244 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
257 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
273 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
277 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
278 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
279 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
282 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
291 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
292 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
293 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
294 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
295 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
296 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
297 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
298 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
299 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
300 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
301 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
302 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
303 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
304 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 0.39
Isolates 3.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.77
Nodule 0.97
Rhizoplane 1.74
Rhizosphere 63.18
Stem 0
Stem Tuber 0
Unclassified 14.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1255461 2162886007 Bacteria 1148
2 JGI25156J39149_1007508 3300002705 Bacteria 2850
3 JGI25154J39366_1000651 3300002738 Bacteria 16202
4 JGI25157J39369_1000096 3300002741 Bacteria 74559
5 JGI25150J39212_1006813 3300002774 Bacteria 2332
6 JGI25153J46596_10007684 3300003215 Bacteria 5254
7 rootH1_10003266 3300003316 Bacteria 13926
8 rootH1_10004183 3300003316 Bacteria 10577
9 rootL2_10000378 3300003322 Bacteria 39457
10 rootL2_10005421 3300003322 Bacteria 4254
11 rootH1_10001557 3300003323 Bacteria 6887
12 rootH1_10002067 3300003316 Bacteria 3896
13 rootH1_10002067 3300003323 Bacteria 25565
14 rootH1_10019904 3300003323 Bacteria 2365
15 rootH1_10061828 3300003323 Bacteria 2682
16 Ga0055539_1000676 3300003752 Bacteria 8915
17 Ga0055533_1000214 3300003756 Bacteria 43957
18 Ga0055525_1000054 3300003759 Bacteria 216523
19 Ga0055525_1001583 3300003759 Bacteria 3679
20 Ga0055535_1000631 3300003761 Bacteria 28134
21 Ga0055529_1000053 3300003763 Bacteria 198996
22 Ga0055526_1006260 3300003771 Bacteria 6519
23 Ga0055526_1011878 3300003771 Bacteria 3864
24 Ga0055524_1000898 3300003775 Bacteria 19271
25 Ga0055528_1039952 3300003790 Bacteria 1065
26 Ga0055530_10028181 3300003791 Bacteria 1520
27 Ga0055540_1001614 3300003792 Bacteria 13126
28 Ga0055540_1005114 3300003792 Bacteria 5648
29 Ga0055531_10000001 3300003794 Bacteria 543586
30 Ga0055531_10005920 3300003794 Bacteria 7036
31 Ga0055531_10008014 3300003794 Bacteria 5648
32 Ga0065165_1000081 3300005262 Bacteria 158849
33 Ga0065165_1000289 3300005262 Bacteria 85848
34 Ga0065165_1007177 3300005262 Bacteria 5569
35 Ga0065704_10092073 3300005289 Bacteria 2676
36 Ga0070658_10048400 3300005327 Bacteria 3442
37 Ga0070658_10056642 3300005327 Bacteria 3186
38 Ga0070658_10108263 3300005327 Bacteria 2300
39 Ga0070658_10137891 3300005327 Bacteria 2036
40 Ga0070690_100008273 3300005330 Bacteria 5983
41 Ga0070677_10003148 3300005333 Bacteria 5305
42 Ga0070677_10013829 3300005333 Bacteria 2832
43 Ga0070677_10039266 3300005333 Bacteria 1857
44 Ga0070677_10060189 3300005333 Bacteria 1564
45 Ga0068869_100068123 3300005334 Bacteria 2628
46 Ga0068869_100117795 3300005334 Bacteria 2028
47 Ga0068868_100013213 3300005338 Bacteria 6048
48 Ga0068868_100024001 3300005338 Bacteria 4622
49 Ga0068868_100191130 3300005338 Bacteria 1703
50 Ga0070660_100123028 3300005339 Bacteria 2071
51 Ga0070660_100277631 3300005339 Bacteria 1370
52 Ga0070660_100483714 3300005339 Bacteria 1029
53 Ga0070668_100167693 3300005347 Bacteria 1786
54 Ga0070669_100348964 3300005353 Bacteria 1201
55 Ga0070675_100634266 3300005354 Bacteria 971
56 Ga0070671_100003297 3300005355 Bacteria 12596
57 Ga0070671_100021732 3300005355 Bacteria 5241
58 Ga0070671_100290230 3300005355 Bacteria 1392
59 Ga0070674_100017177 3300005356 Bacteria 4546
60 Ga0070673_100023688 3300005364 Bacteria 4489
61 Ga0070673_100100257 3300005364 Bacteria 2384
62 Ga0070673_100273018 3300005364 Bacteria 1481
63 Ga0070667_100035110 3300005367 Bacteria 4200
64 Ga0070667_100074568 3300005367 Bacteria 2895
65 Ga0070667_100434813 3300005367 Bacteria 1198
66 Ga0070700_100028559 3300005441 Bacteria 3320
67 Ga0070678_100007693 3300005456 Bacteria 6407
68 Ga0070678_100023480 3300005456 Bacteria 4111
69 Ga0070678_100292197 3300005456 Bacteria 1382
70 Ga0070662_100190088 3300005457 Bacteria 1623
71 Ga0068867_100000944 3300005459 Bacteria 19778
72 Ga0068867_100022723 3300005459 Bacteria 4486
73 Ga0068867_100273637 3300005459 Bacteria 1382
74 Ga0070707_100372609 3300005468 Bacteria 1387
75 Ga0070672_100085145 3300005543 Bacteria 2540
76 Ga0070672_100141846 3300005543 Bacteria 1982
77 Ga0068855_100169215 3300005563 Bacteria 2475
78 Ga0068855_100187510 3300005563 Bacteria 2335
79 Ga0068857_100005763 3300005577 Bacteria 10588
80 Ga0068857_100180973 3300005577 Bacteria 1918
81 Ga0068857_100195997 3300005577 Bacteria 1840
82 Ga0068856_100038424 3300005614 Bacteria 4699
83 Ga0068856_100177174 3300005614 Bacteria 2145
84 Ga0068852_100108834 3300005616 Bacteria 2516
85 Ga0068859_100031092 3300005617 Bacteria 5360
86 Ga0068864_100008889 3300005618 Bacteria 8281
87 Ga0068864_100045610 3300005618 Bacteria 3760
88 Ga0068861_100001966 3300005719 Bacteria 13244
89 Ga0068861_100286357 3300005719 Bacteria 1421
90 Ga0068863_100087911 3300005841 Bacteria 2945
91 Ga0068860_100001570 3300005843 Bacteria 24608
92 Ga0068860_100411866 3300005843 Bacteria 1339
93 Ga0068862_100029724 3300005844 Bacteria 4605
94 Ga0068862_100029831 3300005844 Bacteria 4595
95 Ga0068862_100031733 3300005844 Bacteria 4462
96 Ga0075368_10047088 3300006042 Bacteria 1706
97 Ga0075363_100137682 3300006048 Bacteria 1373
98 Ga0075364_10031906 3300006051 Bacteria 3384
99 Ga0075362_10018376 3300006177 Bacteria 2891
100 Ga0075362_10074039 3300006177 Bacteria 1560
101 Ga0075367_10037421 3300006178 Bacteria 2820
102 Ga0075367_10055958 3300006178 Bacteria 2342
103 Ga0075369_10002395 3300006186 Bacteria 6682
104 Ga0075366_10007830 3300006195 Bacteria 5911
105 Ga0075366_10036754 3300006195 Bacteria 2888
106 Ga0075366_10064258 3300006195 Bacteria 2182
107 Ga0075366_10127425 3300006195 Bacteria 1535
108 Ga0075366_10169184 3300006195 Bacteria 1326
109 Ga0097621_100490811 3300006237 Bacteria 1111
110 Ga0075370_10000343 3300006353 Bacteria 16803
111 Ga0075370_10008599 3300006353 Bacteria 5263
112 Ga0075370_10014249 3300006353 Bacteria 4238
113 Ga0068871_100055678 3300006358 Bacteria 3211
114 Ga0075430_100482259 3300006846 Bacteria 1023
115 Ga0068865_100001706 3300006881 Bacteria 12884
116 Ga0068865_100215129 3300006881 Bacteria 1500
117 Ga0097620_100031092 3300006931 Bacteria 5360
118 Ga0099823_1000077 3300006944 Bacteria 46840
119 Ga0079104_1000020 3300006946 Bacteria 256848
120 Ga0105250_10001077 3300009092 Bacteria 15460
121 Ga0105240_10003122 3300009093 Bacteria 26091
122 Ga0105240_10034236 3300009093 Bacteria 6555
123 Ga0114129_10027435 3300009147 Bacteria 8062
124 Ga0105243_10008651 3300009148 Bacteria 7807
125 Ga0105243_10152476 3300009148 Bacteria 1984
126 Ga0105243_10165006 3300009148 Bacteria 1913
127 Ga0105243_10518383 3300009148 Bacteria 1133
128 Ga0105241_10016802 3300009174 Bacteria 5371
129 Ga0105241_10148197 3300009174 Bacteria 1917
130 Ga0105242_10032793 3300009176 Bacteria 4155
131 Ga0105248_10001770 3300009177 Bacteria 24034
132 Ga0105237_10000678 3300009545 Bacteria 47128
133 Ga0105237_10030700 3300009545 Bacteria 5456
134 Ga0105238_10003973 3300009551 Bacteria 14670
135 Ga0105238_10344526 3300009551 Bacteria 1479
136 Ga0105249_10014900 3300009553 Bacteria 6877
137 Ga0105249_10226797 3300009553 Bacteria 1841
138 Ga0105239_10000292 3300010375 Bacteria 73809
139 Ga0105239_10062596 3300010375 Bacteria 4084
140 Ga0105239_10063734 3300010375 Bacteria 4046
141 Ga0157319_1000022 3300012497 Bacteria 83966
142 Ga0157371_10360584 3300013102 Bacteria 1059
143 Ga0157369_10027747 3300013105 Bacteria 6272
144 Ga0157374_10433433 3300013296 Bacteria 1314
145 Ga0157378_10006999 3300013297 Bacteria 9843
146 Ga0157378_10421063 3300013297 Bacteria 1320
147 Ga0157378_10431277 3300013297 Bacteria 1304
148 Ga0163162_10000708 3300013306 Bacteria 30877
149 Ga0163162_10141689 3300013306 Bacteria 2518
150 Ga0157372_10277677 3300013307 Bacteria 1948
151 Ga0157375_10073956 3300013308 Bacteria 3428
152 Ga0157375_10088296 3300013308 Bacteria 3155
153 Ga0157375_10315834 3300013308 Bacteria 1727
154 Ga0157375_10623311 3300013308 Bacteria 1236
155 Ga0157376_10021838 3300014969 Bacteria 4977
156 Ga0157376_10063132 3300014969 Bacteria 3119
157 Ga0157376_10323214 3300014969 Bacteria 1467
158 Ga0157376_10881445 3300014969 Bacteria 912
159 Ga0163161_10414314 3300017792 Bacteria 1083
160 Ga0213872_10000031 3300021361 Bacteria 139321
161 Ga0213872_10000091 3300021361 Bacteria 83723
162 Ga0213872_10000107 3300021361 Bacteria 77234
163 Ga0213872_10000213 3300021361 Bacteria 51454
164 Ga0213872_10175846 3300021361 Bacteria 926
165 Ga0209674_100255 3300025226 Bacteria 44009
166 Ga0209672_104333 3300025228 Bacteria 2653
167 Ga0209563_100075 3300025230 Bacteria 216575
168 Ga0209563_100168 3300025230 Bacteria 47369
169 Ga0207427_100845 3300025231 Bacteria 13689
170 Ga0209258_100684 3300025242 Bacteria 23521
171 Ga0209258_101880 3300025242 Bacteria 6280
172 Ga0207425_1001204 3300025245 Bacteria 11430
173 Ga0209646_1000039 3300025246 Bacteria 349637
174 Ga0209026_1000006 3300025250 Bacteria 677225
175 Ga0209677_100192 3300025253 Bacteria 49564
176 Ga0209677_100211 3300025253 Bacteria 44009
177 Ga0209677_105866 3300025253 Bacteria 3081
178 Ga0209148_1017912 3300025254 Bacteria 1196
179 Ga0209759_1000020 3300025256 Bacteria 344904
180 Ga0209759_1000863 3300025256 Bacteria 23454
181 Ga0209759_1006699 3300025256 Bacteria 3826
182 Ga0209759_1014663 3300025256 Bacteria 2060
183 Ga0209129_1000043 3300025258 Bacteria 298978
184 Ga0209455_1000066 3300025272 Bacteria 316811
185 Ga0209673_1008903 3300025273 Bacteria 4415
186 Ga0209673_1020977 3300025273 Bacteria 2297
187 Ga0209025_1001908 3300025294 Bacteria 24280
188 Ga0209564_1000008 3300025295 Bacteria 953227
189 Ga0209564_1000014 3300025295 Bacteria 621501
190 Ga0209758_1000093 3300025297 Bacteria 241169
191 Ga0209050_1001427 3300025298 Bacteria 25782
192 Ga0209050_1001729 3300025298 Bacteria 21739
193 Ga0209256_1001882 3300025299 Bacteria 19339
194 Ga0209256_1003219 3300025299 Bacteria 11780
195 Ga0209051_1001575 3300025303 Bacteria 18829
196 Ga0209051_1006186 3300025303 Bacteria 6786
197 Ga0209051_1033995 3300025303 Bacteria 1917
198 Ga0209051_1071026 3300025303 Bacteria 1048
199 Ga0209257_1000033 3300025304 Bacteria 671006
200 Ga0209257_1000935 3300025304 Bacteria 40348
201 Ga0209257_1002822 3300025304 Bacteria 16317
202 Ga0209257_1010246 3300025304 Bacteria 4793
203 Ga0209257_1016075 3300025304 Bacteria 3055
204 Ga0209257_1044660 3300025304 Bacteria 1292
205 Ga0207696_1002469 3300025711 Bacteria 9040
206 Ga0207682_10007232 3300025893 Bacteria 4437
207 Ga0207645_10025599 3300025907 Bacteria 3817
208 Ga0207705_10115372 3300025909 Bacteria 1987
209 Ga0207705_10448513 3300025909 Bacteria 1000
210 Ga0207695_10020879 3300025913 Bacteria 7484
211 Ga0207695_10045132 3300025913 Bacteria 4681
212 Ga0207695_10302348 3300025913 Bacteria 1491
213 Ga0207671_10018908 3300025914 Bacteria 5278
214 Ga0207671_10076195 3300025914 Bacteria 2509
215 Ga0207657_10060136 3300025919 Bacteria 3261
216 Ga0207646_10064646 3300025922 Bacteria 3266
217 Ga0207681_10007721 3300025923 Bacteria 6587
218 Ga0207681_10068692 3300025923 Bacteria 2462
219 Ga0207681_10176198 3300025923 Bacteria 1625
220 Ga0207694_10027495 3300025924 Bacteria 4332
221 Ga0207694_10038625 3300025924 Bacteria 3671
222 Ga0207650_10015531 3300025925 Bacteria 5303
223 Ga0207650_10235437 3300025925 Bacteria 1478
224 Ga0207659_10001279 3300025926 Bacteria 15051
225 Ga0207687_10269183 3300025927 Bacteria 1361
226 Ga0207644_10001397 3300025931 Bacteria 15575
227 Ga0207644_10025360 3300025931 Bacteria 4078
228 Ga0207644_10154652 3300025931 Bacteria 1777
229 Ga0207706_10181613 3300025933 Bacteria 1848
230 Ga0207686_10054947 3300025934 Bacteria 2496
231 Ga0207709_10000267 3300025935 Bacteria 61457
232 Ga0207709_10047582 3300025935 Bacteria 2608
233 Ga0207709_10120522 3300025935 Bacteria 1770
234 Ga0207709_10183868 3300025935 Bacteria 1478
235 Ga0207709_10239446 3300025935 Bacteria 1319
236 Ga0207670_10066012 3300025936 Bacteria 2485
237 Ga0207669_10006121 3300025937 Bacteria 5468
238 Ga0207704_10000941 3300025938 Bacteria 12892
239 Ga0207704_10291393 3300025938 Bacteria 1246
240 Ga0207691_10012568 3300025940 Bacteria 8116
241 Ga0207691_10037949 3300025940 Bacteria 4459
242 Ga0207691_10086494 3300025940 Bacteria 2812
243 Ga0207689_10014458 3300025942 Bacteria 6714
244 Ga0207689_10084494 3300025942 Bacteria 2609
245 Ga0207689_10376891 3300025942 Bacteria 1181
246 Ga0207667_10012039 3300025949 Bacteria 10007
247 Ga0207667_10132901 3300025949 Bacteria 2563
248 Ga0207651_10001690 3300025960 Bacteria 10166
249 Ga0207651_10005949 3300025960 Bacteria 6319
250 Ga0207651_10030385 3300025960 Bacteria 3439
251 Ga0207712_10039710 3300025961 Bacteria 3226
252 Ga0207640_10213547 3300025981 Bacteria 1472
253 Ga0207658_10025617 3300025986 Bacteria 4131
254 Ga0207658_10028962 3300025986 Bacteria 3905
255 Ga0207658_10244045 3300025986 Bacteria 1523
256 Ga0207677_10003923 3300026023 Bacteria 7923
257 Ga0207677_10008382 3300026023 Bacteria 5770
258 Ga0207677_10050804 3300026023 Bacteria 2807
259 Ga0207639_10142350 3300026041 Bacteria 1999
260 Ga0207639_10239303 3300026041 Bacteria 1577
261 Ga0207678_10022183 3300026067 Bacteria 5564
262 Ga0207708_10021908 3300026075 Bacteria 4822
263 Ga0207702_10002440 3300026078 Bacteria 17619
264 Ga0207702_10304643 3300026078 Bacteria 1513
265 Ga0207648_10000277 3300026089 Bacteria 55513
266 Ga0207648_10010471 3300026089 Bacteria 8785
267 Ga0207648_10011629 3300026089 Bacteria 8284
268 Ga0207648_10293862 3300026089 Bacteria 1455
269 Ga0207676_10070506 3300026095 Bacteria 2803
270 Ga0207674_10016404 3300026116 Bacteria 8109
271 Ga0207674_10043033 3300026116 Bacteria 4658
272 Ga0207674_10223407 3300026116 Bacteria 1832
273 Ga0207674_10352198 3300026116 Bacteria 1423
274 Ga0207675_100012518 3300026118 Bacteria 7925
275 Ga0207675_100279426 3300026118 Bacteria 1622
276 Ga0207675_100721190 3300026118 Bacteria 1007
277 Ga0207683_10035749 3300026121 Bacteria 4321
278 Ga0207683_10060745 3300026121 Bacteria 3323
279 Ga0207683_10067351 3300026121 Bacteria 3158
280 Ga0209281_1000002 3300027111 Bacteria 1924012
281 Ga0209389_1006620 3300027296 Bacteria 10093
282 Ga0209968_1001158 3300027526 Bacteria 4020
283 Ga0209999_1026723 3300027543 Bacteria 1067
284 Ga0268266_10035490 3300028379 Bacteria 4242
285 Ga0268265_10033434 3300028380 Bacteria 3739
286 Ga0268265_10033531 3300028380 Bacteria 3734
287 Ga0268265_10211695 3300028380 Bacteria 1689
288 Ga0268264_10072558 3300028381 Bacteria 2919
289 Ga0268264_10099698 3300028381 Bacteria 2521
290 Ga0268264_10197332 3300028381 Bacteria 1838
291 Ga0268264_10287025 3300028381 Bacteria 1544
292 Ga0265336_10000065 3300028666 Bacteria 96073
293 Ga0307517_10004249 3300028786 Bacteria 22093
294 Ga0307517_10060587 3300028786 Bacteria 3598
295 Ga0307515_10000062 3300028794 Bacteria 247284
296 Ga0307515_10000398 3300028794 Bacteria 105087
297 Ga0307515_10009881 3300028794 Bacteria 18380
298 Ga0307515_10016105 3300028794 Bacteria 13712
299 Ga0307515_10051869 3300028794 Bacteria 6101
300 Ga0307515_10055358 3300028794 Bacteria 5798
301 Ga0307515_10098083 3300028794 Bacteria 3573
302 Ga0307515_10123151 3300028794 Bacteria 2919
303 Ga0265324_10009371 3300029957 Bacteria 3827
304 Ga0307511_10033541 3300030521 Bacteria 4529
305 Ga0307512_10065289 3300030522 Bacteria 2761
306 Ga0265331_10005041 3300031250 Bacteria 8084
307 Ga0265327_10000080 3300031251 Bacteria 206086
308 Ga0307513_10003241 3300031456 Bacteria 22179
309 Ga0307509_10001361 3300031507 Bacteria 41386
310 Ga0307509_10010234 3300031507 Bacteria 11535
311 Ga0307509_10436399 3300031507 Bacteria 1007
312 Ga0307408_100000016 3300031548 Bacteria 356896
313 Ga0307408_100000153 3300031548 Bacteria 76717
314 Ga0307408_100007939 3300031548 Bacteria 7017
315 Ga0307408_100008377 3300031548 Bacteria 6828
316 Ga0307408_100160903 3300031548 Bacteria 1783
317 Ga0307508_10035009 3300031616 Bacteria 4525
318 Ga0307508_10080654 3300031616 Bacteria 2835
319 Ga0307508_10110291 3300031616 Bacteria 2351
320 Ga0307508_10210806 3300031616 Bacteria 1543
321 Ga0307514_10000727 3300031649 Bacteria 56822
322 Ga0307514_10028455 3300031649 Bacteria 4507
323 Ga0307514_10124924 3300031649 Bacteria 1785
324 Ga0307516_10000045 3300031730 Bacteria 132787
325 Ga0307516_10000556 3300031730 Bacteria 50206
326 Ga0307516_10002240 3300031730 Bacteria 26141
327 Ga0307516_10013210 3300031730 Bacteria 8818
328 Ga0307516_10020847 3300031730 Bacteria 6763
329 Ga0307516_10099929 3300031730 Bacteria 2717
330 Ga0307405_10615403 3300031731 Bacteria 888
331 Ga0316577_10030526 3300031733 Bacteria 3010
332 Ga0307518_10165236 3300031838 Bacteria 1516
333 Ga0307406_10001713 3300031901 Bacteria 12049
334 Ga0307406_10195543 3300031901 Bacteria 1484
335 Ga0307416_100031242 3300032002 Bacteria 4006
336 Ga0307414_10222246 3300032004 Bacteria 1551
337 Ga0307411_10052126 3300032005 Bacteria 2673
338 Ga0307411_10096285 3300032005 Bacteria 2080
339 Ga0307507_10281485 3300033179 Bacteria 1039
340 Ga0307510_10001484 3300033180 Bacteria 25882
341 Ga0307510_10022280 3300033180 Bacteria 7362
342 Ga0307510_10171997 3300033180 Bacteria 1743
343 Ga0307510_10226030 3300033180 Bacteria 1378
344 Ga0373959_0030857 3300034820 Bacteria 1081
345 Ga0373939_0000041 3300035114 Bacteria 45477
346 Ga0373960_0000058 3300035121 Bacteria 15245
347 Ga0373960_0033093 3300035121 Bacteria 1456
348 Ga0373962_0012976 3300035242 Bacteria 2104
349 Ga0316574_0139886 3300035398 Bacteria 1559
350 Ga0373931_0001264 3300035691 Bacteria 10807
351 Ga0373931_0003471 3300035691 Bacteria 7080
352 Ga0373927_0036763 3300035695 Bacteria 3183
353 Ga0373925_0001991 3300037068 Bacteria 16921
354 Ga0395899_0001218 3300037312 Bacteria 22536
355 Ga0395900_0063680 3300037418 Bacteria 3790
356 Ga0395900_0162044 3300037418 Bacteria 2281
357 Ga0395898_0003783 3300037466 Bacteria 16746
358 Ga0395898_0080441 3300037466 Bacteria 3143
359 Ga0395905_0000782 3300037471 Bacteria 41773
360 Ga0395905_0001240 3300037471 Bacteria 31665
361 Ga0395905_0009294 3300037471 Bacteria 9615
362 Ga0395905_0025989 3300037471 Bacteria 5520
363 Ga0395905_0376682 3300037471 Bacteria 1313
364 Ga0395901_0076068 3300038443 Bacteria 3502
365 Ga0436361_0108836 3300039447 Bacteria 3773
366 Ga0436361_0269328 3300039447 Bacteria 3483
367 Ga0436361_0401075 3300039447 Bacteria 45979
368 Ga0436361_0403255 3300039447 Bacteria 13044
369 Ga0436361_0524686 3300039447 Bacteria 114368
370 Ga0436361_0714431 3300039447 Bacteria 79592
371 Ga0439461_0035485 3300041410 Bacteria 1058
372 Ga0451795_0506121 3300041456 Bacteria 1269
373 Ga0451833_1399142 3300041491 Bacteria 877
374 Ga0451849_0025850 3300041505 Bacteria 1330
375 Ga0439437_000112 3300042000 Bacteria 6253
376 Ga0450913_000133 3300042117 Bacteria 2216
377 Ga0450917_000499 3300042120 Bacteria 2947
378 Ga0450888_001908 3300042126 Bacteria 2024
379 Ga0450890_003125 3300042127 Bacteria 2217
380 Ga0450891_000334 3300042129 Bacteria 4836
381 Ga0450892_000852 3300042130 Bacteria 3345
382 Ga0450898_007725 3300042134 Bacteria 1680
383 Ga0439459_0029183 3300042438 Bacteria 1112
384 Ga0450916_007625 3300042530 Bacteria 1303
385 Ga0450893_0008755 3300042532 Bacteria 1649
386 Ga0451577_0003833 3300042876 Bacteria 16360
387 Ga0451577_0013510 3300042876 Bacteria 7638
388 Ga0451577_0659585 3300042876 Bacteria 948
389 Ga0453683_0003166 3300044673 Bacteria 12245
390 Ga0453683_0414065 3300044673 Bacteria 869
391 Ga0466965_0004677 3300044683 Bacteria 6102
392 Ga0466966_0000733 3300044684 Bacteria 20852
393 Ga0466961_0035110 3300044693 Bacteria 3219
394 Ga0466963_0283282 3300044694 Bacteria 1165
395 Ga0466964_0013376 3300044706 Bacteria 3113
396 Ga0453684_0016403 3300044712 Bacteria 11585
397 Ga0453684_0184932 3300044712 Bacteria 2443
398 Ga0453684_0219316 3300044712 Bacteria 2205
399 Ga0453684_0504132 3300044712 Bacteria 1340
400 Ga0466971_0001807 3300044719 Bacteria 9085
401 Ga0466957_0054218 3300044842 Bacteria 2446
402 Ga0466959_0004169 3300045049 Bacteria 9629
403 Ga0451576_0018331 3300045051 Bacteria 7676
404 Ga0451576_0023757 3300045051 Bacteria 6633
405 Ga0451576_0026474 3300045051 Bacteria 6239
406 Ga0451576_0052507 3300045051 Bacteria 4271
407 Ga0451576_0101848 3300045051 Bacteria 2987
408 Ga0451576_0317331 3300045051 Bacteria 1630
409 Ga0451576_1329431 3300045051 Bacteria 749
410 Ga0466958_0044630 3300045836 Bacteria 2671
411 Ga0495592_0000495 3300046454 Bacteria 28713
412 Ga0495590_0025954 3300046457 Bacteria 2058
413 Ga0495638_0040024 3300046460 Bacteria 2972
414 Ga0495638_0058109 3300046460 Bacteria 2398
415 Ga0495650_0002349 3300046471 Bacteria 15614
416 Ga0495650_0003420 3300046471 Bacteria 11594
417 Ga0495639_0036255 3300046475 Bacteria 2208
418 Ga0495585_0028301 3300046492 Bacteria 3197
419 Ga0495583_0000296 3300046506 Bacteria 78991
420 Ga0495606_0000444 3300046507 Bacteria 67633
421 Ga0495618_0303097 3300046514 Bacteria 993
422 Ga0495620_0064017 3300046515 Bacteria 1522
423 Ga0495630_0026460 3300046517 Bacteria 4295
424 Ga0495631_0172074 3300046518 Bacteria 928
425 Ga0495632_0096814 3300046519 Bacteria 1393
426 Ga0495666_0071604 3300046526 Bacteria 1648
427 Ga0495654_0006639 3300046530 Bacteria 6548
428 Ga0495587_0187158 3300046536 Bacteria 1173
429 Ga0495622_0143513 3300046557 Bacteria 1083
430 Ga0495668_0012958 3300046616 Bacteria 4936
431 Ga0495625_0103799 3300046660 Bacteria 1949
432 Ga0495625_0113811 3300046660 Bacteria 1847
433 Ga0495649_0001120 3300046694 Bacteria 20832
434 Ga0495649_0009602 3300046694 Bacteria 5737
435 Ga0495589_0002238 3300046794 Bacteria 10869
436 Ga0495676_0015875 3300047321 Bacteria 6693
437 Ga0495626_0045886 3300048091 Bacteria 2038
438 Ga0496104_0048483 3300048907 Bacteria 4005
439 Ga0496104_0433519 3300048907 Bacteria 1226
440 Ga0496105_0097822 3300048908 Bacteria 2424
441 Ga0496108_0023998 3300048911 Bacteria 5021
442 Ga0496108_0051243 3300048911 Bacteria 3458
443 Ga0496109_0139454 3300048912 Bacteria 2267
444 Ga0496112_0032680 3300048915 Bacteria 5052
445 Ga0496113_0035023 3300048916 Bacteria 3668
446 Ga0496122_0034711 3300048925 Bacteria 4121
447 Ga0496123_0042607 3300048926 Bacteria 3130
448 Ga0496124_0006989 3300048927 Bacteria 12100
449 Ga0496124_0093981 3300048927 Bacteria 2440
450 Ga0496125_0002173 3300048928 Bacteria 26201
451 Ga0496125_0149249 3300048928 Bacteria 1609
452 Ga0496126_0022448 3300048929 Bacteria 6141
453 Ga0501310_006880 3300049130 Bacteria 1204
454 Ga0501300_002760 3300049523 Bacteria 2625
455 Ga0501314_000361 3300049530 Bacteria 2734
456 Ga0501037_0174406 3300049573 Bacteria 1527
457 Ga0501046_0288471 3300049580 Bacteria 1201
458 Ga0501222_004588 3300049662 Bacteria 1876
459 Ga0501249_042880 3300049679 Bacteria 1029
460 Ga0501221_000668 3300049704 Bacteria 5478
461 Ga0501229_005167 3300049706 Bacteria 1598
462 Ga0501079_0213561 3300049741 Bacteria 1507
463 Ga0501267_000931 3300049764 Bacteria 2401
464 Ga0501274_004542 3300049771 Bacteria 1149
465 Ga0501035_0041405 3300049822 Bacteria 4159
466 Ga0501044_0081305 3300049823 Bacteria 3280
467 nmdc:mga03683_27814_c1 3300050489 Bacteria 2244
468 nmdc:mga0k408_105069_c1 3300050493 Bacteria 1144
469 nmdc:mga0k408_105650_c1 3300050493 Bacteria 1663
470 nmdc:mga0k408_10619_c1 3300050493 Bacteria 4986
471 nmdc:mga0k408_128918_c1 3300050493 Bacteria 1501
472 nmdc:mga0k408_26555_c1 3300050493 Bacteria 3284
473 nmdc:mga0k408_329603_c1 3300050493 Bacteria 911
474 nmdc:mga0k408_61098_c1 3300050493 Bacteria 2190
475 nmdc:mga06z11_17706_c1 3300050494 Bacteria 3240
476 nmdc:mga07m45_144995_c1 3300050496 Bacteria 1376
477 nmdc:mga07m45_240_c1 3300050496 Bacteria 22136
478 nmdc:mga07m45_24233_c1 3300050496 Bacteria 3323
479 nmdc:mga07m45_2456_c1 3300050496 Bacteria 8699
480 nmdc:mga07m45_29676_c1 3300050496 Bacteria 3026
481 nmdc:mga07m45_3372_c1 3300050496 Bacteria 7695
482 nmdc:mga0qj67_244274_c1 3300050509 Bacteria 1456
483 Ga0500635_0000040 3300053080 Bacteria 91731
484 Ga0500644_0078780 3300053088 Bacteria 1206
485 Ga0500583_0082506 3300053092 Bacteria 1555
486 Ga0500651_0024609 3300053093 Bacteria 3776
487 Ga0500651_0107626 3300053093 Bacteria 1704
488 Ga0500650_0093323 3300053098 Bacteria 1409
489 Ga0500593_086754 3300053117 Bacteria 1331
490 Ga0500594_0007947 3300053118 Bacteria 2408
491 Ga0500559_0001133 3300053136 Bacteria 16045
492 Ga0500564_132549 3300053138 Bacteria 1077
493 Ga0500619_004840 3300053154 Bacteria 2937
494 Ga0500622_0006149 3300053156 Bacteria 7043
495 Ga0500622_0013213 3300053156 Bacteria 4457
496 Ga0500636_0007724 3300053177 Bacteria 6218
497 Ga0500645_000911 3300053730 Bacteria 17004
498 Ga0500661_002640 3300055283 Bacteria 3387
499 Ga0466962_0032718 3300061719 Bacteria 2488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0184932 Ga0453684_0184932_1167_1919 212
2 3300028794 Ga0307515_10000062 Ga0307515_10000062172 217
3 3300045051 Ga0451576_1329431 Ga0451576_1329431_45_737 220
4 3300005353 Ga0070669_100348964 Ga0070669_1003489642 226
5 3300046536 Ga0495587_0187158 Ga0495587_0187158_323_1057 226
6 3300025273 Ga0209673_1020977 Ga0209673_10209773 232
7 3300006042 Ga0075368_10047088 Ga0075368_100470882 233
8 3300006048 Ga0075363_100137682 Ga0075363_1001376821 233
9 3300006178 Ga0075367_10037421 Ga0075367_100374212 233
10 3300041456 Ga0451795_0506121 Ga0451795_0506121_40_780 233
11 3300041505 Ga0451849_0025850 Ga0451849_0025850_133_873 233
12 iso_pu_bacteria 2585428057 2587725735 233
13 3300025925 Ga0207650_10235437 Ga0207650_102354371 234
14 3300028786 Ga0307517_10004249 Ga0307517_100042496 234
15 3300028786 Ga0307517_10060587 Ga0307517_100605873 234
16 3300028794 Ga0307515_10009881 Ga0307515_1000988110 234
17 3300030522 Ga0307512_10065289 Ga0307512_100652893 234
18 3300031507 Ga0307509_10001361 Ga0307509_100013617 234
19 3300031616 Ga0307508_10080654 Ga0307508_100806542 234
20 3300031649 Ga0307514_10028455 Ga0307514_100284555 234
21 3300031649 Ga0307514_10124924 Ga0307514_101249243 234
22 3300031730 Ga0307516_10000556 Ga0307516_1000055612 234
23 3300031838 Ga0307518_10165236 Ga0307518_101652362 234
24 3300033180 Ga0307510_10022280 Ga0307510_100222807 234
25 3300033180 Ga0307510_10226030 Ga0307510_102260302 234
26 3300044673 Ga0453683_0414065 Ga0453683_0414065_20_760 234
27 3300045051 Ga0451576_0026474 Ga0451576_0026474_3322_4062 234
28 3300046454 Ga0495592_0000495 Ga0495592_0000495_19592_20335 234
29 3300046514 Ga0495618_0303097 Ga0495618_0303097_16_759 234
30 3300046517 Ga0495630_0026460 Ga0495630_0026460_85_828 234
31 3300046526 Ga0495666_0071604 Ga0495666_0071604_822_1565 234
32 3300046557 Ga0495622_0143513 Ga0495622_0143513_244_987 234
33 3300046660 Ga0495625_0103799 Ga0495625_0103799_770_1513 234
34 3300047321 Ga0495676_0015875 Ga0495676_0015875_3185_3928 234
35 3300053088 Ga0500644_0078780 Ga0500644_0078780_110_853 234
36 3300053092 Ga0500583_0082506 Ga0500583_0082506_704_1447 234
37 3300053118 Ga0500594_0007947 Ga0500594_0007947_383_1126 234
38 3300053136 Ga0500559_0001133 Ga0500559_0001133_3309_4052 234
39 3300053138 Ga0500564_132549 Ga0500564_132549_159_902 234
40 3300053154 Ga0500619_004840 Ga0500619_004840_862_1602 234
41 3300053156 Ga0500622_0013213 Ga0500622_0013213_535_1278 234
42 3300005333 Ga0070677_10013829 Ga0070677_100138293 235
43 3300005333 Ga0070677_10039266 Ga0070677_100392663 235
44 3300005338 Ga0068868_100013213 Ga0068868_1000132133 235
45 3300005338 Ga0068868_100024001 Ga0068868_1000240013 235
46 3300005338 Ga0068868_100191130 Ga0068868_1001911302 235
47 3300005364 Ga0070673_100023688 Ga0070673_1000236884 235
48 3300005364 Ga0070673_100100257 Ga0070673_1001002573 235
49 3300005367 Ga0070667_100434813 Ga0070667_1004348131 235
50 3300005456 Ga0070678_100023480 Ga0070678_1000234803 235
51 3300005457 Ga0070662_100190088 Ga0070662_1001900882 235
52 3300005543 Ga0070672_100141846 Ga0070672_1001418462 235
53 3300005577 Ga0068857_100180973 Ga0068857_1001809732 235
54 3300005843 Ga0068860_100411866 Ga0068860_1004118662 235
55 3300013297 Ga0157378_10431277 Ga0157378_104312772 235
56 3300013308 Ga0157375_10088296 Ga0157375_100882963 235
57 3300014969 Ga0157376_10021838 Ga0157376_100218383 235
58 3300021361 Ga0213872_10000031 Ga0213872_1000003128 235
59 3300025923 Ga0207681_10176198 Ga0207681_101761982 235
60 3300025927 Ga0207687_10269183 Ga0207687_102691832 235
61 3300025931 Ga0207644_10025360 Ga0207644_100253603 235
62 3300025940 Ga0207691_10012568 Ga0207691_100125686 235
63 3300025940 Ga0207691_10037949 Ga0207691_100379493 235
64 3300025942 Ga0207689_10084494 Ga0207689_100844942 235
65 3300025960 Ga0207651_10005949 Ga0207651_100059494 235
66 3300026023 Ga0207677_10003923 Ga0207677_100039233 235
67 3300026023 Ga0207677_10008382 Ga0207677_100083823 235
68 3300026023 Ga0207677_10050804 Ga0207677_100508042 235
69 3300026089 Ga0207648_10010471 Ga0207648_100104712 235
70 3300026116 Ga0207674_10352198 Ga0207674_103521981 235
71 3300026121 Ga0207683_10060745 Ga0207683_100607453 235
72 3300028381 Ga0268264_10197332 Ga0268264_101973323 235
73 3300028794 Ga0307515_10016105 Ga0307515_1001610510 235
74 3300028794 Ga0307515_10051869 Ga0307515_100518696 235
75 3300028794 Ga0307515_10055358 Ga0307515_100553582 235
76 3300031507 Ga0307509_10010234 Ga0307509_100102349 235
77 3300031616 Ga0307508_10035009 Ga0307508_100350094 235
78 3300031616 Ga0307508_10110291 Ga0307508_101102912 235
79 3300031730 Ga0307516_10099929 Ga0307516_100999292 235
80 3300032002 Ga0307416_100031242 Ga0307416_1000312423 235
81 3300033179 Ga0307507_10281485 Ga0307507_102814852 235
82 3300033180 Ga0307510_10171997 Ga0307510_101719972 235
83 3300037471 Ga0395905_0001240 Ga0395905_0001240_19028_19762 235
84 3300039447 Ga0436361_0401075 Ga0436361_0401075_5371_6120 235
85 3300042438 Ga0439459_0029183 Ga0439459_0029183_391_1101 235
86 3300044712 Ga0453684_0219316 Ga0453684_0219316_531_1283 235
87 3300044712 Ga0453684_0504132 Ga0453684_0504132_463_1212 235
88 3300046460 Ga0495638_0040024 Ga0495638_0040024_258_1004 235
89 3300048911 Ga0496108_0051243 Ga0496108_0051243_110_862 235
90 3300048912 Ga0496109_0139454 Ga0496109_0139454_60_812 235
91 3300053093 Ga0500651_0024609 Ga0500651_0024609_2801_3535 235
92 3300053117 Ga0500593_086754 Ga0500593_086754_120_827 235
93 3300021361 Ga0213872_10000213 Ga0213872_100002137 236
94 3300027526 Ga0209968_1001158 Ga0209968_10011583 236
95 3300027543 Ga0209999_1026723 Ga0209999_10267232 236
96 3300037312 Ga0395899_0001218 Ga0395899_0001218_15613_16350 236
97 3300037418 Ga0395900_0063680 Ga0395900_0063680_1251_1988 236
98 3300037466 Ga0395898_0003783 Ga0395898_0003783_9804_10541 236
99 3300037471 Ga0395905_0025989 Ga0395905_0025989_2032_2769 236
100 3300038443 Ga0395901_0076068 Ga0395901_0076068_734_1471 236
101 3300039447 Ga0436361_0524686 Ga0436361_0524686_48471_49217 236
102 3300042876 Ga0451577_0013510 Ga0451577_0013510_2198_2953 236
103 3300046530 Ga0495654_0006639 Ga0495654_0006639_2597_3334 236
104 3300002705 JGI25156J39149_1007508 JGI25156J39149_10075083 237
105 3300003761 Ga0055535_1000631 Ga0055535_100063110 237
106 3300003763 Ga0055529_1000053 Ga0055529_100005316 237
107 3300005262 Ga0065165_1000081 Ga0065165_100008133 237
108 3300005327 Ga0070658_10056642 Ga0070658_100566421 237
109 3300005327 Ga0070658_10108263 Ga0070658_101082632 237
110 3300005354 Ga0070675_100634266 Ga0070675_1006342662 237
111 3300005367 Ga0070667_100074568 Ga0070667_1000745682 237
112 3300005577 Ga0068857_100195997 Ga0068857_1001959972 237
113 3300005616 Ga0068852_100108834 Ga0068852_1001088342 237
114 3300006051 Ga0075364_10031906 Ga0075364_100319062 237
115 3300006177 Ga0075362_10018376 Ga0075362_100183763 237
116 3300006178 Ga0075367_10055958 Ga0075367_100559583 237
117 3300006186 Ga0075369_10002395 Ga0075369_100023954 237
118 3300006353 Ga0075370_10000343 Ga0075370_100003439 237
119 3300006946 Ga0079104_1000020 Ga0079104_100002086 237
120 3300009092 Ga0105250_10001077 Ga0105250_100010778 237
121 3300009148 Ga0105243_10008651 Ga0105243_100086513 237
122 3300009148 Ga0105243_10165006 Ga0105243_101650062 237
123 3300010375 Ga0105239_10063734 Ga0105239_100637342 237
124 3300025228 Ga0209672_104333 Ga0209672_1043332 237
125 3300025242 Ga0209258_100684 Ga0209258_10068416 237
126 3300025253 Ga0209677_105866 Ga0209677_1058663 237
127 3300025254 Ga0209148_1017912 Ga0209148_10179122 237
128 3300025256 Ga0209759_1000863 Ga0209759_100086316 237
129 3300025256 Ga0209759_1014663 Ga0209759_10146632 237
130 3300025272 Ga0209455_1000066 Ga0209455_100006616 237
131 3300025711 Ga0207696_1002469 Ga0207696_10024699 237
132 3300025909 Ga0207705_10115372 Ga0207705_101153722 237
133 3300025909 Ga0207705_10448513 Ga0207705_104485132 237
134 3300025935 Ga0207709_10000267 Ga0207709_1000026738 237
135 3300025935 Ga0207709_10047582 Ga0207709_100475822 237
136 3300025949 Ga0207667_10132901 Ga0207667_101329013 237
137 3300025981 Ga0207640_10213547 Ga0207640_102135472 237
138 3300025986 Ga0207658_10028962 Ga0207658_100289623 237
139 3300026067 Ga0207678_10022183 Ga0207678_100221837 237
140 3300026116 Ga0207674_10016404 Ga0207674_100164043 237
141 3300027111 Ga0209281_1000002 Ga0209281_1000002659 237
142 3300028381 Ga0268264_10287025 Ga0268264_102870251 237
143 3300028794 Ga0307515_10123151 Ga0307515_101231512 237
144 3300031507 Ga0307509_10436399 Ga0307509_104363992 237
145 3300031649 Ga0307514_10000727 Ga0307514_1000072724 237
146 3300037471 Ga0395905_0376682 Ga0395905_0376682_338_1096 237
147 3300041410 Ga0439461_0035485 Ga0439461_0035485_129_878 237
148 3300046457 Ga0495590_0025954 Ga0495590_0025954_1264_2016 237
149 3300046506 Ga0495583_0000296 Ga0495583_0000296_3551_4309 237
150 3300046507 Ga0495606_0000444 Ga0495606_0000444_47395_48153 237
151 3300046515 Ga0495620_0064017 Ga0495620_0064017_647_1399 237
152 3300046518 Ga0495631_0172074 Ga0495631_0172074_151_903 237
153 3300046519 Ga0495632_0096814 Ga0495632_0096814_249_1001 237
154 3300046616 Ga0495668_0012958 Ga0495668_0012958_2971_3729 237
155 3300046660 Ga0495625_0113811 Ga0495625_0113811_698_1456 237
156 3300046694 Ga0495649_0001120 Ga0495649_0001120_15385_16143 237
157 3300046694 Ga0495649_0009602 Ga0495649_0009602_1453_2205 237
158 3300046794 Ga0495589_0002238 Ga0495589_0002238_5889_6647 237
159 3300048091 Ga0495626_0045886 Ga0495626_0045886_496_1248 237
160 3300050489 nmdc:mga03683_27814_c1 nmdc:mga03683_27814_c1_1248_2000 237
161 3300050493 nmdc:mga0k408_10619_c1 nmdc:mga0k408_10619_c1_1790_2542 237
162 3300050494 nmdc:mga06z11_17706_c1 nmdc:mga06z11_17706_c1_1404_2156 237
163 3300050496 nmdc:mga07m45_240_c1 nmdc:mga07m45_240_c1_13680_14438 237
164 3300050496 nmdc:mga07m45_24233_c1 nmdc:mga07m45_24233_c1_1121_1873 237
165 3300053093 Ga0500651_0107626 Ga0500651_0107626_835_1593 237
166 3300053098 Ga0500650_0093323 Ga0500650_0093323_225_977 237
167 iso_pu_bacteria 2721755523 2722885859 237
168 iso_pu_bacteria 2839138175 2839144023 237
169 3300002774 JGI25150J39212_1006813 JGI25150J39212_10068133 238
170 3300003215 JGI25153J46596_10007684 JGI25153J46596_100076844 238
171 3300003771 Ga0055526_1011878 Ga0055526_10118784 238
172 3300005262 Ga0065165_1000289 Ga0065165_100028939 238
173 3300006353 Ga0075370_10008599 Ga0075370_100085993 238
174 3300021361 Ga0213872_10000107 Ga0213872_1000010759 238
175 3300025245 Ga0207425_1001204 Ga0207425_10012045 238
176 3300025258 Ga0209129_1000043 Ga0209129_100004349 238
177 3300025295 Ga0209564_1000014 Ga0209564_1000014156 238
178 3300025297 Ga0209758_1000093 Ga0209758_1000093169 238
179 3300025304 Ga0209257_1010246 Ga0209257_10102464 238
180 3300031616 Ga0307508_10210806 Ga0307508_102108062 238
181 3300032005 Ga0307411_10096285 Ga0307411_100962852 238
182 3300037418 Ga0395900_0162044 Ga0395900_0162044_986_1732 238
183 3300037471 Ga0395905_0009294 Ga0395905_0009294_506_1267 238
184 3300039447 Ga0436361_0403255 Ga0436361_0403255_1065_1820 238
185 3300042134 Ga0450898_007725 Ga0450898_007725_480_1250 238
186 3300045051 Ga0451576_0317331 Ga0451576_0317331_208_960 238
187 3300049580 Ga0501046_0288471 Ga0501046_0288471_164_937 238
188 3300050496 nmdc:mga07m45_29676_c1 nmdc:mga07m45_29676_c1_1808_2569 238
189 iso_pu_bacteria 2738543012 2739241849 238
190 iso_pu_bacteria 2816332133 2816470846 238
191 3300002738 JGI25154J39366_1000651 JGI25154J39366_10006516 239
192 3300002741 JGI25157J39369_1000096 JGI25157J39369_100009651 239
193 3300003316 rootH1_10004183 rootH1_100041836 239
194 3300003322 rootL2_10000378 rootL2_1000037821 239
195 3300003323 rootH1_10001557 rootH1_100015577 239
196 3300003323 rootH1_10019904 rootH1_100199043 239
197 3300003323 rootH1_10061828 rootH1_100618282 239
198 3300003752 Ga0055539_1000676 Ga0055539_10006764 239
199 3300003756 Ga0055533_1000214 Ga0055533_100021416 239
200 3300003759 Ga0055525_1000054 Ga0055525_100005459 239
201 3300003759 Ga0055525_1001583 Ga0055525_10015832 239
202 3300005327 Ga0070658_10048400 Ga0070658_100484003 239
203 3300005327 Ga0070658_10137891 Ga0070658_101378912 239
204 3300005330 Ga0070690_100008273 Ga0070690_1000082732 239
205 3300005334 Ga0068869_100068123 Ga0068869_1000681232 239
206 3300005339 Ga0070660_100123028 Ga0070660_1001230282 239
207 3300005339 Ga0070660_100277631 Ga0070660_1002776312 239
208 3300005339 Ga0070660_100483714 Ga0070660_1004837141 239
209 3300005459 Ga0068867_100273637 Ga0068867_1002736372 239
210 3300005563 Ga0068855_100169215 Ga0068855_1001692153 239
211 3300005563 Ga0068855_100187510 Ga0068855_1001875103 239
212 3300005577 Ga0068857_100005763 Ga0068857_1000057633 239
213 3300005614 Ga0068856_100038424 Ga0068856_1000384243 239
214 3300005719 Ga0068861_100286357 Ga0068861_1002863572 239
215 3300006195 Ga0075366_10036754 Ga0075366_100367542 239
216 3300009093 Ga0105240_10034236 Ga0105240_100342364 239
217 3300009147 Ga0114129_10027435 Ga0114129_100274355 239
218 3300009174 Ga0105241_10016802 Ga0105241_100168023 239
219 3300009176 Ga0105242_10032793 Ga0105242_100327934 239
220 3300009545 Ga0105237_10030700 Ga0105237_100307003 239
221 3300009551 Ga0105238_10344526 Ga0105238_103445262 239
222 3300010375 Ga0105239_10062596 Ga0105239_100625963 239
223 3300013105 Ga0157369_10027747 Ga0157369_100277474 239
224 3300013296 Ga0157374_10433433 Ga0157374_104334331 239
225 3300013307 Ga0157372_10277677 Ga0157372_102776772 239
226 3300013308 Ga0157375_10623311 Ga0157375_106233112 239
227 3300014969 Ga0157376_10881445 Ga0157376_108814451 239
228 3300025226 Ga0209674_100255 Ga0209674_10025526 239
229 3300025230 Ga0209563_100075 Ga0209563_100075137 239
230 3300025230 Ga0209563_100168 Ga0209563_10016826 239
231 3300025231 Ga0207427_100845 Ga0207427_10084510 239
232 3300025242 Ga0209258_101880 Ga0209258_1018807 239
233 3300025246 Ga0209646_1000039 Ga0209646_100003916 239
234 3300025250 Ga0209026_1000006 Ga0209026_1000006585 239
235 3300025253 Ga0209677_100192 Ga0209677_10019226 239
236 3300025253 Ga0209677_100211 Ga0209677_10021126 239
237 3300025256 Ga0209759_1000020 Ga0209759_1000020240 239
238 3300025256 Ga0209759_1006699 Ga0209759_10066994 239
239 3300025913 Ga0207695_10045132 Ga0207695_100451322 239
240 3300025913 Ga0207695_10302348 Ga0207695_103023482 239
241 3300025914 Ga0207671_10076195 Ga0207671_100761953 239
242 3300025919 Ga0207657_10060136 Ga0207657_100601364 239
243 3300025924 Ga0207694_10038625 Ga0207694_100386253 239
244 3300025934 Ga0207686_10054947 Ga0207686_100549472 239
245 3300025936 Ga0207670_10066012 Ga0207670_100660121 239
246 3300025942 Ga0207689_10014458 Ga0207689_100144582 239
247 3300025949 Ga0207667_10012039 Ga0207667_100120398 239
248 3300025960 Ga0207651_10001690 Ga0207651_100016907 239
249 3300026041 Ga0207639_10239303 Ga0207639_102393032 239
250 3300026078 Ga0207702_10002440 Ga0207702_100024407 239
251 3300026116 Ga0207674_10043033 Ga0207674_100430332 239
252 3300026116 Ga0207674_10223407 Ga0207674_102234072 239
253 3300026118 Ga0207675_100279426 Ga0207675_1002794262 239
254 3300030521 Ga0307511_10033541 Ga0307511_100335413 239
255 3300031250 Ga0265331_10005041 Ga0265331_100050413 239
256 3300031251 Ga0265327_10000080 Ga0265327_1000008051 239
257 3300031730 Ga0307516_10002240 Ga0307516_100022409 239
258 3300037466 Ga0395898_0080441 Ga0395898_0080441_1824_2588 239
259 3300044694 Ga0466963_0283282 Ga0466963_0283282_142_951 239
260 3300046471 Ga0495650_0003420 Ga0495650_0003420_6358_7122 239
261 3300046475 Ga0495639_0036255 Ga0495639_0036255_477_1241 239
262 3300048927 Ga0496124_0093981 Ga0496124_0093981_475_1230 239
263 3300049573 Ga0501037_0174406 Ga0501037_0174406_676_1425 239
264 3300049822 Ga0501035_0041405 Ga0501035_0041405_1989_2750 239
265 3300050493 nmdc:mga0k408_105069_c1 nmdc:mga0k408_105069_c1_367_1131 239
266 3300053080 Ga0500635_0000040 Ga0500635_0000040_71837_72601 239
267 3300053177 Ga0500636_0007724 Ga0500636_0007724_4222_4986 239
268 3300055283 Ga0500661_002640 Ga0500661_002640_1694_2458 239
269 iso_pu_bacteria 2643221660 2644338067 239
270 3300005262 Ga0065165_1007177 Ga0065165_10071775 240
271 3300031730 Ga0307516_10020847 Ga0307516_100208474 240
272 3300033180 Ga0307510_10001484 Ga0307510_1000148415 240
273 3300037471 Ga0395905_0000782 Ga0395905_0000782_26186_26980 240
274 3300042876 Ga0451577_0003833 Ga0451577_0003833_12324_13097 240
275 3300003791 Ga0055530_10028181 Ga0055530_100281812 241
276 3300003794 Ga0055531_10000001 Ga0055531_10000001268 241
277 3300025298 Ga0209050_1001427 Ga0209050_10014276 241
278 3300025304 Ga0209257_1000033 Ga0209257_1000033355 241
279 3300028666 Ga0265336_10000065 Ga0265336_1000006567 241
280 3300029957 Ga0265324_10009371 Ga0265324_100093714 241
281 3300041491 Ga0451833_1399142 Ga0451833_1399142_77_844 241
282 3300044673 Ga0453683_0003166 Ga0453683_0003166_10662_11420 241
283 3300045051 Ga0451576_0018331 Ga0451576_0018331_3534_4292 241
284 3300046460 Ga0495638_0058109 Ga0495638_0058109_832_1668 241
285 3300048927 Ga0496124_0006989 Ga0496124_0006989_10987_11766 241
286 iso_pu_bacteria 2643221609 2644057578 241
287 iso_pu_bacteria 2643221611 2644072333 241
288 3300025303 Ga0209051_1033995 Ga0209051_10339952 242
289 3300028794 Ga0307515_10000398 Ga0307515_1000039854 242
290 3300031548 Ga0307408_100008377 Ga0307408_1000083772 242
291 3300031730 Ga0307516_10013210 Ga0307516_100132103 242
292 3300031901 Ga0307406_10195543 Ga0307406_101955432 242
293 3300053156 Ga0500622_0006149 Ga0500622_0006149_1157_1975 242
294 3300053730 Ga0500645_000911 Ga0500645_000911_7818_8579 242
295 3300003771 Ga0055526_1006260 Ga0055526_10062604 243
296 3300003792 Ga0055540_1001614 Ga0055540_10016146 243
297 3300005333 Ga0070677_10003148 Ga0070677_100031482 243
298 3300005347 Ga0070668_100167693 Ga0070668_1001676932 243
299 3300005355 Ga0070671_100003297 Ga0070671_1000032973 243
300 3300005355 Ga0070671_100021732 Ga0070671_1000217322 243
301 3300005355 Ga0070671_100290230 Ga0070671_1002902302 243
302 3300005364 Ga0070673_100273018 Ga0070673_1002730181 243
303 3300005459 Ga0068867_100022723 Ga0068867_1000227231 243
304 3300005618 Ga0068864_100008889 Ga0068864_1000088895 243
305 3300005618 Ga0068864_100045610 Ga0068864_1000456102 243
306 3300005841 Ga0068863_100087911 Ga0068863_1000879113 243
307 3300006195 Ga0075366_10064258 Ga0075366_100642583 243
308 3300006358 Ga0068871_100055678 Ga0068871_1000556782 243
309 3300006881 Ga0068865_100215129 Ga0068865_1002151292 243
310 3300009177 Ga0105248_10001770 Ga0105248_100017703 243
311 3300013306 Ga0163162_10141689 Ga0163162_101416893 243
312 3300013308 Ga0157375_10315834 Ga0157375_103158342 243
313 3300014969 Ga0157376_10063132 Ga0157376_100631322 243
314 3300025295 Ga0209564_1000008 Ga0209564_1000008130 243
315 3300025893 Ga0207682_10007232 Ga0207682_100072324 243
316 3300025907 Ga0207645_10025599 Ga0207645_100255993 243
317 3300025923 Ga0207681_10007721 Ga0207681_100077215 243
318 3300025925 Ga0207650_10015531 Ga0207650_100155312 243
319 3300025926 Ga0207659_10001279 Ga0207659_1000127911 243
320 3300025931 Ga0207644_10001397 Ga0207644_100013978 243
321 3300025931 Ga0207644_10154652 Ga0207644_101546521 243
322 3300025933 Ga0207706_10181613 Ga0207706_101816132 243
323 3300025938 Ga0207704_10291393 Ga0207704_102913932 243
324 3300025960 Ga0207651_10030385 Ga0207651_100303852 243
325 3300025986 Ga0207658_10025617 Ga0207658_100256174 243
326 3300026041 Ga0207639_10142350 Ga0207639_101423502 243
327 3300026089 Ga0207648_10011629 Ga0207648_100116296 243
328 3300026095 Ga0207676_10070506 Ga0207676_100705062 243
329 3300026118 Ga0207675_100721190 Ga0207675_1007211901 243
330 3300026121 Ga0207683_10035749 Ga0207683_100357494 243
331 3300028379 Ga0268266_10035490 Ga0268266_100354903 243
332 3300031548 Ga0307408_100000153 Ga0307408_10000015329 243
333 3300031548 Ga0307408_100160903 Ga0307408_1001609031 243
334 3300031731 Ga0307405_10615403 Ga0307405_106154031 243
335 3300031901 Ga0307406_10001713 Ga0307406_100017139 243
336 3300048907 Ga0496104_0048483 Ga0496104_0048483_2188_2967 243
337 3300048908 Ga0496105_0097822 Ga0496105_0097822_869_1648 243
338 3300048911 Ga0496108_0023998 Ga0496108_0023998_672_1451 243
339 3300048915 Ga0496112_0032680 Ga0496112_0032680_2681_3460 243
340 3300048916 Ga0496113_0035023 Ga0496113_0035023_1095_1874 243
341 3300049823 Ga0501044_0081305 Ga0501044_0081305_1875_2639 243
342 3300050493 nmdc:mga0k408_329603_c1 nmdc:mga0k408_329603_c1_45_818 243
343 3300050496 nmdc:mga07m45_144995_c1 nmdc:mga07m45_144995_c1_482_1252 243
344 3300003775 Ga0055524_1000898 Ga0055524_100089817 244
345 3300003794 Ga0055531_10005920 Ga0055531_100059204 244
346 3300005614 Ga0068856_100177174 Ga0068856_1001771742 244
347 3300006195 Ga0075366_10169184 Ga0075366_101691842 244
348 3300006353 Ga0075370_10014249 Ga0075370_100142493 244
349 3300012497 Ga0157319_1000022 Ga0157319_100002263 244
350 3300013102 Ga0157371_10360584 Ga0157371_103605841 244
351 3300026078 Ga0207702_10304643 Ga0207702_103046432 244
352 3300031733 Ga0316577_10030526 Ga0316577_100305263 244
353 3300035398 Ga0316574_0139886 Ga0316574_0139886_406_1200 244
354 3300035691 Ga0373931_0003471 Ga0373931_0003471_4726_5505 244
355 3300046492 Ga0495585_0028301 Ga0495585_0028301_1897_2676 244
356 3300048907 Ga0496104_0433519 Ga0496104_0433519_358_1149 244
357 3300003323 rootH1_10002067 rootH1_1000206717 245
358 3300003790 Ga0055528_1039952 Ga0055528_10399521 245
359 3300003794 Ga0055531_10008014 Ga0055531_100080144 245
360 3300005468 Ga0070707_100372609 Ga0070707_1003726092 245
361 3300006944 Ga0099823_1000077 Ga0099823_10000776 245
362 3300025273 Ga0209673_1008903 Ga0209673_10089033 245
363 3300025298 Ga0209050_1001729 Ga0209050_10017292 245
364 3300025299 Ga0209256_1001882 Ga0209256_100188217 245
365 3300025299 Ga0209256_1003219 Ga0209256_100321910 245
366 3300025303 Ga0209051_1001575 Ga0209051_100157512 245
367 3300025303 Ga0209051_1071026 Ga0209051_10710262 245
368 3300025304 Ga0209257_1000935 Ga0209257_100093521 245
369 3300025304 Ga0209257_1002822 Ga0209257_10028223 245
370 3300025922 Ga0207646_10064646 Ga0207646_100646464 245
371 3300027296 Ga0209389_1006620 Ga0209389_10066206 245
372 3300031548 Ga0307408_100007939 Ga0307408_1000079393 245
373 3300034820 Ga0373959_0030857 Ga0373959_0030857_158_952 245
374 3300035114 Ga0373939_0000041 Ga0373939_0000041_695_1489 245
375 3300035121 Ga0373960_0000058 Ga0373960_0000058_9385_10179 245
376 3300035242 Ga0373962_0012976 Ga0373962_0012976_1016_1810 245
377 3300035691 Ga0373931_0001264 Ga0373931_0001264_6189_6983 245
378 3300039447 Ga0436361_0108836 Ga0436361_0108836_2856_3632 245
379 3300042000 Ga0439437_000112 Ga0439437_000112_5256_6050 245
380 3300042117 Ga0450913_000133 Ga0450913_000133_758_1552 245
381 3300042120 Ga0450917_000499 Ga0450917_000499_995_1789 245
382 3300042126 Ga0450888_001908 Ga0450888_001908_1126_1920 245
383 3300042127 Ga0450890_003125 Ga0450890_003125_756_1550 245
384 3300042129 Ga0450891_000334 Ga0450891_000334_2920_3714 245
385 3300042130 Ga0450892_000852 Ga0450892_000852_1067_1861 245
386 3300042530 Ga0450916_007625 Ga0450916_007625_54_848 245
387 3300042532 Ga0450893_0008755 Ga0450893_0008755_775_1569 245
388 3300044683 Ga0466965_0004677 Ga0466965_0004677_4906_5688 245
389 3300044684 Ga0466966_0000733 Ga0466966_0000733_8809_9591 245
390 3300044693 Ga0466961_0035110 Ga0466961_0035110_1138_1920 245
391 3300044706 Ga0466964_0013376 Ga0466964_0013376_374_1156 245
392 3300044719 Ga0466971_0001807 Ga0466971_0001807_6081_6863 245
393 3300044842 Ga0466957_0054218 Ga0466957_0054218_322_1104 245
394 3300045049 Ga0466959_0004169 Ga0466959_0004169_6080_6862 245
395 3300045836 Ga0466958_0044630 Ga0466958_0044630_1787_2569 245
396 3300046471 Ga0495650_0002349 Ga0495650_0002349_11247_12026 245
397 3300050493 nmdc:mga0k408_105650_c1 nmdc:mga0k408_105650_c1_777_1586 245
398 3300050496 nmdc:mga07m45_2456_c1 nmdc:mga07m45_2456_c1_4998_5792 245
399 3300050496 nmdc:mga07m45_3372_c1 nmdc:mga07m45_3372_c1_5945_6754 245
400 3300061719 Ga0466962_0032718 Ga0466962_0032718_299_1081 245
401 iso_pu_bacteria 2738541337 2739056305 245
402 3300003792 Ga0055540_1005114 Ga0055540_10051142 246
403 3300005333 Ga0070677_10060189 Ga0070677_100601892 246
404 3300005334 Ga0068869_100117795 Ga0068869_1001177953 246
405 3300005356 Ga0070674_100017177 Ga0070674_1000171773 246
406 3300005367 Ga0070667_100035110 Ga0070667_1000351102 246
407 3300005441 Ga0070700_100028559 Ga0070700_1000285593 246
408 3300005456 Ga0070678_100292197 Ga0070678_1002921971 246
409 3300005459 Ga0068867_100000944 Ga0068867_10000094417 246
410 3300005543 Ga0070672_100085145 Ga0070672_1000851452 246
411 3300005617 Ga0068859_100031092 Ga0068859_1000310925 246
412 3300005719 Ga0068861_100001966 Ga0068861_10000196611 246
413 3300005843 Ga0068860_100001570 Ga0068860_1000015709 246
414 3300005844 Ga0068862_100029724 Ga0068862_1000297244 246
415 3300005844 Ga0068862_100029831 Ga0068862_1000298313 246
416 3300005844 Ga0068862_100031733 Ga0068862_1000317333 246
417 3300006177 Ga0075362_10074039 Ga0075362_100740392 246
418 3300006195 Ga0075366_10007830 Ga0075366_100078304 246
419 3300006237 Ga0097621_100490811 Ga0097621_1004908112 246
420 3300006846 Ga0075430_100482259 Ga0075430_1004822592 246
421 3300006881 Ga0068865_100001706 Ga0068865_1000017063 246
422 3300006931 Ga0097620_100031092 Ga0097620_1000310925 246
423 3300009148 Ga0105243_10152476 Ga0105243_101524762 246
424 3300009148 Ga0105243_10518383 Ga0105243_105183832 246
425 3300009553 Ga0105249_10014900 Ga0105249_100149003 246
426 3300009553 Ga0105249_10226797 Ga0105249_102267972 246
427 3300013297 Ga0157378_10006999 Ga0157378_100069992 246
428 3300013297 Ga0157378_10421063 Ga0157378_104210632 246
429 3300013306 Ga0163162_10000708 Ga0163162_1000070816 246
430 3300013308 Ga0157375_10073956 Ga0157375_100739563 246
431 3300014969 Ga0157376_10323214 Ga0157376_103232142 246
432 3300017792 Ga0163161_10414314 Ga0163161_104143142 246
433 3300025294 Ga0209025_1001908 Ga0209025_100190823 246
434 3300025303 Ga0209051_1006186 Ga0209051_10061867 246
435 3300025304 Ga0209257_1044660 Ga0209257_10446602 246
436 3300025923 Ga0207681_10068692 Ga0207681_100686922 246
437 3300025935 Ga0207709_10120522 Ga0207709_101205222 246
438 3300025935 Ga0207709_10183868 Ga0207709_101838682 246
439 3300025935 Ga0207709_10239446 Ga0207709_102394462 246
440 3300025937 Ga0207669_10006121 Ga0207669_100061213 246
441 3300025938 Ga0207704_10000941 Ga0207704_1000094111 246
442 3300025940 Ga0207691_10086494 Ga0207691_100864942 246
443 3300025942 Ga0207689_10376891 Ga0207689_103768912 246
444 3300025961 Ga0207712_10039710 Ga0207712_100397104 246
445 3300025986 Ga0207658_10244045 Ga0207658_102440452 246
446 3300026075 Ga0207708_10021908 Ga0207708_100219083 246
447 3300026089 Ga0207648_10000277 Ga0207648_1000027720 246
448 3300026089 Ga0207648_10293862 Ga0207648_102938621 246
449 3300026118 Ga0207675_100012518 Ga0207675_1000125185 246
450 3300028380 Ga0268265_10033434 Ga0268265_100334344 246
451 3300028380 Ga0268265_10033531 Ga0268265_100335312 246
452 3300028380 Ga0268265_10211695 Ga0268265_102116952 246
453 3300028381 Ga0268264_10072558 Ga0268264_100725582 246
454 3300028381 Ga0268264_10099698 Ga0268264_100996982 246
455 3300031456 Ga0307513_10003241 Ga0307513_100032417 246
456 3300031730 Ga0307516_10000045 Ga0307516_1000004572 246
457 3300035121 Ga0373960_0033093 Ga0373960_0033093_159_941 246
458 3300035695 Ga0373927_0036763 Ga0373927_0036763_1182_1970 246
459 3300037068 Ga0373925_0001991 Ga0373925_0001991_9157_9945 246
460 3300049741 Ga0501079_0213561 Ga0501079_0213561_336_1124 246
461 3300050493 nmdc:mga0k408_26555_c1 nmdc:mga0k408_26555_c1_972_1760 246
462 3300050509 nmdc:mga0qj67_244274_c1 nmdc:mga0qj67_244274_c1_569_1357 246
463 iso_pu_bacteria 2904541872 2904547313 246
464 iso_pu_bacteria 2929160207 2929165826 246
465 3300003316 rootH1_10003266 rootH1_1000326613 247
466 3300003322 rootL2_10005421 rootL2_100054214 247
467 3300005456 Ga0070678_100007693 Ga0070678_1000076936 247
468 3300006195 Ga0075366_10127425 Ga0075366_101274252 247
469 3300009093 Ga0105240_10003122 Ga0105240_1000312216 247
470 3300009174 Ga0105241_10148197 Ga0105241_101481974 247
471 3300009545 Ga0105237_10000678 Ga0105237_1000067847 247
472 3300009551 Ga0105238_10003973 Ga0105238_100039734 247
473 3300010375 Ga0105239_10000292 Ga0105239_1000029256 247
474 3300025304 Ga0209257_1016075 Ga0209257_10160752 247
475 3300025913 Ga0207695_10020879 Ga0207695_100208797 247
476 3300025914 Ga0207671_10018908 Ga0207671_100189085 247
477 3300025924 Ga0207694_10027495 Ga0207694_100274955 247
478 3300026121 Ga0207683_10067351 Ga0207683_100673512 247
479 3300028794 Ga0307515_10098083 Ga0307515_100980832 247
480 3300032004 Ga0307414_10222246 Ga0307414_102222462 247
481 3300032005 Ga0307411_10052126 Ga0307411_100521263 247
482 3300044712 Ga0453684_0016403 Ga0453684_0016403_10103_10957 247
483 3300045051 Ga0451576_0023757 Ga0451576_0023757_4344_5144 247
484 3300045051 Ga0451576_0052507 Ga0451576_0052507_1670_2470 247
485 3300045051 Ga0451576_0101848 Ga0451576_0101848_1730_2527 247
486 3300049130 Ga0501310_006880 Ga0501310_006880_318_1118 247
487 3300049523 Ga0501300_002760 Ga0501300_002760_73_873 247
488 3300049530 Ga0501314_000361 Ga0501314_000361_1779_2579 247
489 3300049662 Ga0501222_004588 Ga0501222_004588_466_1266 247
490 3300049679 Ga0501249_042880 Ga0501249_042880_146_946 247
491 3300049704 Ga0501221_000668 Ga0501221_000668_2266_3066 247
492 3300049706 Ga0501229_005167 Ga0501229_005167_293_1093 247
493 3300049764 Ga0501267_000931 Ga0501267_000931_517_1317 247
494 3300049771 Ga0501274_004542 Ga0501274_004542_108_908 247
495 3300050493 nmdc:mga0k408_128918_c1 nmdc:mga0k408_128918_c1_276_1079 247
496 3300050493 nmdc:mga0k408_61098_c1 nmdc:mga0k408_61098_c1_723_1523 247
497 iso_pu_bacteria 2643221544 2643743384 247
498 iso_pu_bacteria 2643221585 2643932576 247
499 iso_pu_bacteria 2643221639 2644218147 247
500 iso_pu_bacteria 2643221646 2644260832 247
501 iso_pu_bacteria 2643221656 2644313827 247
502 iso_pu_bacteria 2831864461 2831867623 247
503 3300021361 Ga0213872_10000091 Ga0213872_1000009144 248
504 3300021361 Ga0213872_10175846 Ga0213872_101758462 248
505 3300039447 Ga0436361_0269328 Ga0436361_0269328_2312_3106 248
506 3300039447 Ga0436361_0714431 Ga0436361_0714431_29677_30471 248
507 3300048925 Ga0496122_0034711 Ga0496122_0034711_2073_2819 248
508 3300048926 Ga0496123_0042607 Ga0496123_0042607_732_1478 248
509 3300048928 Ga0496125_0002173 Ga0496125_0002173_14575_15321 248
510 3300048929 Ga0496126_0022448 Ga0496126_0022448_3085_3831 248
511 3300031548 Ga0307408_100000016 Ga0307408_100000016248 249
512 3300042876 Ga0451577_0659585 Ga0451577_0659585_109_921 249
513 3300048928 Ga0496125_0149249 Ga0496125_0149249_650_1480 249
514 iso_pu_bacteria 2932422444 2932423215 250
515 2162886007 SwRhRL2b_contig_1255461 SwRhRL2b_0972.00004140 251
516 3300005289 Ga0065704_10092073 Ga0065704_100920733 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

75

206

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8588 14 230
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.8551 14 231
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7573 14 230
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7516 14 231
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.6566 64 220
ID Description Score Start End Superfamily
af_D4AC45_64_192_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9135 50 174 3.40.50.620
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8989 52 176 3.40.50.2000
af_D4AC45_64_192_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8675 50 174 3.40.50.620
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8618 52 174 3.40.50.2000
af_I6YDI9_312_439_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8588 52 176 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A858ZPI7-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.984 2 235 GO:0003841
GO:0006654
GO:0016020
AF-C3X4D5-F1-model_v4 1-acylglycerol-3-phosphate O-acyltransferase 0.9733 2 235 GO:0003841
GO:0006654
GO:0016020
AF-A0A286C2Y3-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9675 2 231 GO:0003841
GO:0006654
GO:0016020
AF-A0A848JH81-F1-model_v4 deleted 0.9645 2 237
AF-Q606G5-F1-model_v4 Putative 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9637 4 230 GO:0003841
GO:0006654
GO:0016020

Feature Viewer

pLDDT pTM Quality
87.45 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map