F457989

General Info

Members Datasets Scaffolds Average Seq Length
516 326 516 149

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10000656|Ga0105242_1000065627
Length 182
Sequence LLPSLPGACLGRAALSRFLFFSHLGGPIVRRLSMKIDLKILDPRMAEQLPAYATPGSAGLDLRACLDAPITLEPNAWQLVPTGIAIHLRDPGYAAMILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSAWNRSDTAFTLQPMERLAQLVIVPVVQAQFNVVDEFSGASERGQGGYGSTGTN

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
91 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
186 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
187 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
188 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
189 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
190 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
191 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
194 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
195 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
196 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
197 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
198 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
199 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
200 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
201 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
202 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
203 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
204 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
242 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
249 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
263 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
289 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
304 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
307 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
308 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
320 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
321 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
322 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
323 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
324 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
325 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 0
Rhizoplane 3.29
Rhizosphere 68.6
Stem 0
Stem Tuber 0
Unclassified 11.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10049111 3300001989 Bacteria 1369
2 JGI24735J21928_10021797 3300002067 Bacteria 1954
3 JGI25162J39368_1000027 3300002737 Bacteria 223163
4 JGI25163J39215_1004601 3300002771 Bacteria 952
5 JGI25165J46597_1000031 3300003214 Bacteria 296858
6 JGI25160J50197_1000279 3300003354 Bacteria 37135
7 JGI25160J50197_1026696 3300003354 Bacteria 1587
8 Ga0055538_1000018 3300003751 Bacteria 296858
9 Ga0055539_1000023 3300003752 Bacteria 296858
10 Ga0055533_1000031 3300003756 Bacteria 296858
11 Ga0055532_1001850 3300003758 Bacteria 5190
12 Ga0055532_1002401 3300003758 Bacteria 3924
13 Ga0055532_1002405 3300003758 Bacteria 3921
14 Ga0055525_1000038 3300003759 Bacteria 297540
15 Ga0055525_1000039 3300003759 Bacteria 296858
16 Ga0055527_1001077 3300003760 Bacteria 6432
17 Ga0055527_1001080 3300003760 Bacteria 6414
18 Ga0055535_1002463 3300003761 Bacteria 6432
19 Ga0055535_1002468 3300003761 Bacteria 6414
20 Ga0055542_1002359 3300003762 Bacteria 6414
21 Ga0055542_1003231 3300003762 Bacteria 4558
22 Ga0055529_1001317 3300003763 Bacteria 8412
23 Ga0055534_1026131 3300003784 Bacteria 932
24 Ga0055528_1001724 3300003790 Bacteria 12650
25 Ga0055541_1000016 3300003841 Bacteria 296861
26 Ga0058692_1009562 3300003856 Bacteria 2434
27 Ga0055543_1007895 3300004625 Bacteria 2412
28 Ga0065165_1000214 3300005262 Bacteria 100283
29 Ga0065165_1000286 3300005262 Bacteria 85993
30 Ga0065165_1000905 3300005262 Bacteria 38287
31 Ga0065714_10141060 3300005288 Bacteria 1171
32 Ga0065712_10030383 3300005290 Bacteria 1287
33 Ga0070658_10109366 3300005327 Bacteria 2288
34 Ga0070676_10228686 3300005328 Bacteria 1232
35 Ga0070676_10858057 3300005328 Bacteria 674
36 Ga0070670_100003254 3300005331 Bacteria 13419
37 Ga0070670_101189122 3300005331 Bacteria 697
38 Ga0070677_10105109 3300005333 Bacteria 1252
39 Ga0070666_10164922 3300005335 Bacteria 1549
40 Ga0068868_100073946 3300005338 Bacteria 2721
41 Ga0070660_100004289 3300005339 Bacteria 9850
42 Ga0070661_100440097 3300005344 Bacteria 1036
43 Ga0070668_100055793 3300005347 Bacteria 3050
44 Ga0070669_100054000 3300005353 Bacteria 2942
45 Ga0070669_100283211 3300005353 Bacteria 1329
46 Ga0070669_100611605 3300005353 Bacteria 914
47 Ga0070675_100000705 3300005354 Bacteria 23206
48 Ga0070671_100006437 3300005355 Bacteria 9384
49 Ga0070674_100001989 3300005356 Bacteria 11192
50 Ga0070674_100154280 3300005356 Bacteria 1736
51 Ga0070674_102154740 3300005356 Bacteria 509
52 Ga0070673_100014074 3300005364 Bacteria 5557
53 Ga0070659_100000697 3300005366 Bacteria 24441
54 Ga0070667_100152675 3300005367 Bacteria 2029
55 Ga0070667_100581315 3300005367 Bacteria 1031
56 Ga0070701_10172997 3300005438 Bacteria 1259
57 Ga0070663_100000289 3300005455 Bacteria 25666
58 Ga0070663_100595585 3300005455 Bacteria 929
59 Ga0070678_100005858 3300005456 Bacteria 7149
60 Ga0070678_100408116 3300005456 Bacteria 1182
61 Ga0070678_100729463 3300005456 Bacteria 895
62 Ga0070678_101867712 3300005456 Bacteria 567
63 Ga0068867_100003695 3300005459 Bacteria 10764
64 Ga0068867_100572991 3300005459 Bacteria 981
65 Ga0068867_100590354 3300005459 Bacteria 967
66 Ga0070679_100170005 3300005530 Bacteria 2153
67 Ga0070696_100368106 3300005546 Bacteria 1117
68 Ga0070665_100114839 3300005548 Bacteria 2695
69 Ga0070665_100997812 3300005548 Bacteria 849
70 Ga0070704_100221356 3300005549 Bacteria 1539
71 Ga0070664_100067450 3300005564 Bacteria 3058
72 Ga0070664_100561589 3300005564 Bacteria 1056
73 Ga0068864_100190388 3300005618 Bacteria 1880
74 Ga0068866_10370926 3300005718 Bacteria 915
75 Ga0068851_10263009 3300005834 Bacteria 982
76 Ga0068870_10121050 3300005840 Bacteria 1508
77 Ga0075368_10036069 3300006042 Bacteria 1931
78 Ga0075363_100414612 3300006048 Bacteria 792
79 Ga0075364_10260865 3300006051 Bacteria 1178
80 Ga0075364_10444776 3300006051 Bacteria 885
81 Ga0075362_10012577 3300006177 Bacteria 3365
82 Ga0075367_10205983 3300006178 Bacteria 1229
83 Ga0075369_10024462 3300006186 Bacteria 2503
84 Ga0075366_10021910 3300006195 Bacteria 3715
85 Ga0097621_100092319 3300006237 Bacteria 2535
86 Ga0097621_101130468 3300006237 Bacteria 736
87 Ga0075370_10055016 3300006353 Bacteria 2261
88 Ga0075370_10159158 3300006353 Bacteria 1325
89 Ga0068871_100075709 3300006358 Bacteria 2779
90 Ga0075430_100202313 3300006846 Bacteria 1649
91 Ga0075431_100018750 3300006847 Bacteria 7049
92 Ga0075429_100000294 3300006880 Bacteria 35361
93 Ga0075429_100020879 3300006880 Bacteria 5683
94 Ga0068865_101291042 3300006881 Bacteria 649
95 Ga0075436_100569324 3300006914 Bacteria 833
96 Ga0105251_10001210 3300009011 Bacteria 22309
97 Ga0105244_10128297 3300009036 Bacteria 1225
98 Ga0105240_10069966 3300009093 Bacteria 4343
99 Ga0105240_10095788 3300009093 Bacteria 3618
100 Ga0105240_10096638 3300009093 Bacteria 3600
101 Ga0114129_11225266 3300009147 Bacteria 933
102 Ga0105242_10000656 3300009176 Bacteria 27099
103 Ga0105248_10037595 3300009177 Bacteria 5416
104 Ga0105248_11060135 3300009177 Bacteria 916
105 Ga0105237_10079024 3300009545 Bacteria 3279
106 Ga0105238_10169272 3300009551 Bacteria 2161
107 Ga0105238_10283723 3300009551 Bacteria 1638
108 Ga0105239_10008632 3300010375 Bacteria 11551
109 Ga0105239_10418444 3300010375 Bacteria 1518
110 Ga0105246_11177647 3300011119 Bacteria 704
111 Ga0157371_10000001 3300013102 Bacteria 1162285
112 Ga0157370_10455738 3300013104 Bacteria 1176
113 Ga0157369_10218107 3300013105 Bacteria 1998
114 Ga0157369_11572772 3300013105 Bacteria 669
115 Ga0157369_11983714 3300013105 Bacteria 591
116 Ga0163162_11324280 3300013306 Bacteria 818
117 Ga0157375_10061759 3300013308 Bacteria 3722
118 Ga0157375_10315722 3300013308 Bacteria 1727
119 Ga0163163_10069193 3300014325 Bacteria 3514
120 Ga0157380_10419371 3300014326 Bacteria 1276
121 Ga0157380_12131862 3300014326 Bacteria 624
122 Ga0182008_10015292 3300014497 Bacteria 4006
123 Ga0182008_10020248 3300014497 Bacteria 3428
124 Ga0157376_10106764 3300014969 Bacteria 2457
125 Ga0182006_1085684 3300015261 Bacteria 1142
126 Ga0182006_1109467 3300015261 Bacteria 971
127 Ga0182007_10002268 3300015262 Bacteria 9691
128 Ga0182007_10006994 3300015262 Bacteria 4786
129 Ga0182005_1032789 3300015265 Bacteria 1414
130 Ga0183362_10003 3300015683 Bacteria 977584
131 Ga0183361_10009 3300016635 Bacteria 205218
132 Ga0163161_10086155 3300017792 Bacteria 2318
133 Ga0213872_10000147 3300021361 Bacteria 64440
134 Ga0213872_10000232 3300021361 Bacteria 49039
135 Ga0213872_10109261 3300021361 Bacteria 1229
136 Ga0209435_100015 3300025206 Bacteria 321177
137 Ga0209435_100443 3300025206 Bacteria 8417
138 Ga0209435_102903 3300025206 Bacteria 1977
139 Ga0209566_100843 3300025225 Bacteria 15333
140 Ga0209674_101439 3300025226 Bacteria 6306
141 Ga0209674_116364 3300025226 Bacteria 620
142 Ga0209672_100033 3300025228 Bacteria 315326
143 Ga0209672_100034 3300025228 Bacteria 304973
144 Ga0209147_100004 3300025229 Bacteria 1371850
145 Ga0209147_100089 3300025229 Bacteria 178350
146 Ga0209147_100628 3300025229 Bacteria 19033
147 Ga0209563_100005 3300025230 Bacteria 1774893
148 Ga0207427_100718 3300025231 Bacteria 15457
149 Ga0209258_100023 3300025242 Bacteria 547286
150 Ga0209258_100242 3300025242 Bacteria 100588
151 Ga0209258_100523 3300025242 Bacteria 36787
152 Ga0209646_1000020 3300025246 Bacteria 462204
153 Ga0209646_1000040 3300025246 Bacteria 347867
154 Ga0209026_1000034 3300025250 Bacteria 306953
155 Ga0209026_1001823 3300025250 Bacteria 8753
156 Ga0209148_1000029 3300025254 Bacteria 579199
157 Ga0209148_1003502 3300025254 Bacteria 4302
158 Ga0209148_1012762 3300025254 Bacteria 1528
159 Ga0209759_1000049 3300025256 Bacteria 221692
160 Ga0209759_1000656 3300025256 Bacteria 32085
161 Ga0209455_1000123 3300025272 Bacteria 167231
162 Ga0209673_1000075 3300025273 Bacteria 232555
163 Ga0209130_1026653 3300025284 Bacteria 1237
164 Ga0209675_1035364 3300025291 Bacteria 1140
165 Ga0209676_1001036 3300025292 Bacteria 32214
166 Ga0209025_1004201 3300025294 Bacteria 12707
167 Ga0209564_1014545 3300025295 Bacteria 3267
168 Ga0209564_1035084 3300025295 Bacteria 1458
169 Ga0209050_1064264 3300025298 Bacteria 851
170 Ga0207426_1000326 3300025302 Bacteria 91021
171 Ga0207426_1006086 3300025302 Bacteria 5321
172 Ga0209051_1005682 3300025303 Bacteria 7207
173 Ga0209257_1016007 3300025304 Bacteria 3065
174 Ga0209257_1016909 3300025304 Bacteria 2909
175 Ga0207697_10079401 3300025315 Bacteria 1382
176 Ga0207656_10059814 3300025321 Bacteria 1669
177 Ga0207696_1053246 3300025711 Bacteria 1152
178 Ga0207713_1003216 3300025735 Bacteria 11274
179 Ga0207682_10004972 3300025893 Bacteria 5458
180 Ga0207688_10052635 3300025901 Bacteria 2282
181 Ga0207680_10161009 3300025903 Bacteria 1505
182 Ga0207647_10003550 3300025904 Bacteria 11705
183 Ga0207647_10063243 3300025904 Bacteria 2251
184 Ga0207645_10210231 3300025907 Bacteria 1281
185 Ga0207705_10080115 3300025909 Bacteria 2379
186 Ga0207695_10002948 3300025913 Bacteria 24555
187 Ga0207695_10018474 3300025913 Bacteria 8062
188 Ga0207695_10083561 3300025913 Bacteria 3225
189 Ga0207695_10313487 3300025913 Bacteria 1459
190 Ga0207671_10028629 3300025914 Bacteria 4162
191 Ga0207662_10120016 3300025918 Bacteria 1648
192 Ga0207657_10000098 3300025919 Bacteria 83552
193 Ga0207657_10366743 3300025919 Bacteria 1135
194 Ga0207646_10614104 3300025922 Bacteria 975
195 Ga0207681_10384804 3300025923 Bacteria 1130
196 Ga0207694_10386482 3300025924 Bacteria 1162
197 Ga0207650_10002051 3300025925 Bacteria 14094
198 Ga0207650_10073515 3300025925 Bacteria 2575
199 Ga0207659_10005314 3300025926 Bacteria 7806
200 Ga0207659_10735814 3300025926 Bacteria 845
201 Ga0207644_10001988 3300025931 Bacteria 13223
202 Ga0207690_10000055 3300025932 Bacteria 102536
203 Ga0207709_10005490 3300025935 Bacteria 7198
204 Ga0207709_10033765 3300025935 Bacteria 3008
205 Ga0207670_10391012 3300025936 Bacteria 1110
206 Ga0207691_10000361 3300025940 Bacteria 45833
207 Ga0207691_10046489 3300025940 Bacteria 3989
208 Ga0207691_10531794 3300025940 Bacteria 997
209 Ga0207711_10248049 3300025941 Bacteria 1634
210 Ga0207711_10664146 3300025941 Bacteria 972
211 Ga0207711_11145057 3300025941 Bacteria 719
212 Ga0207689_10832452 3300025942 Bacteria 779
213 Ga0207679_10040210 3300025945 Bacteria 3346
214 Ga0207679_10504436 3300025945 Bacteria 1080
215 Ga0207651_10039281 3300025960 Bacteria 3119
216 Ga0207651_10372707 3300025960 Bacteria 1208
217 Ga0207668_10065332 3300025972 Bacteria 2575
218 Ga0207658_10000319 3300025986 Bacteria 48401
219 Ga0207658_10098944 3300025986 Bacteria 2280
220 Ga0207677_10005131 3300026023 Bacteria 7088
221 Ga0207677_10028107 3300026023 Bacteria 3552
222 Ga0207703_10331552 3300026035 Bacteria 1396
223 Ga0207678_10002325 3300026067 Bacteria 17226
224 Ga0207678_10445964 3300026067 Bacteria 1124
225 Ga0207702_10485699 3300026078 Bacteria 1202
226 Ga0207641_10522938 3300026088 Bacteria 1154
227 Ga0207648_10007787 3300026089 Bacteria 10457
228 Ga0207648_11331613 3300026089 Bacteria 675
229 Ga0207674_10138110 3300026116 Bacteria 2398
230 Ga0207683_10253689 3300026121 Bacteria 1605
231 Ga0207683_10585374 3300026121 Bacteria 1032
232 Ga0207683_12046828 3300026121 Bacteria 521
233 Ga0207698_10015048 3300026142 Bacteria 5168
234 Ga0207698_10474589 3300026142 Bacteria 1212
235 Ga0209371_1000676 3300027312 Bacteria 29463
236 Ga0209969_1021074 3300027360 Bacteria 972
237 Ga0209984_1002498 3300027424 Bacteria 2059
238 Ga0209970_1000679 3300027614 Bacteria 5887
239 Ga0209971_1009117 3300027682 Bacteria 2353
240 Ga0307515_10000152 3300028794 Bacteria 167305
241 Ga0265324_10065087 3300029957 Bacteria 1244
242 Ga0268256_1004071 3300030500 Bacteria 6261
243 Ga0265331_10009839 3300031250 Bacteria 5329
244 Ga0265327_10000144 3300031251 Bacteria 156779
245 Ga0265327_10005755 3300031251 Bacteria 10210
246 Ga0265327_10028374 3300031251 Bacteria 3204
247 Ga0265327_10049683 3300031251 Bacteria 2199
248 Ga0307513_10000004 3300031456 Bacteria 558931
249 Ga0307408_100140697 3300031548 Bacteria 1894
250 Ga0307408_100158087 3300031548 Bacteria 1797
251 Ga0307408_100387198 3300031548 Bacteria 1197
252 Ga0316575_10062853 3300031665 Bacteria 1485
253 Ga0307516_10094111 3300031730 Bacteria 2821
254 Ga0307516_10449662 3300031730 Bacteria 945
255 Ga0307405_10012250 3300031731 Bacteria 4531
256 Ga0307405_10234871 3300031731 Bacteria 1354
257 Ga0307413_10653376 3300031824 Bacteria 868
258 Ga0307410_10089256 3300031852 Bacteria 2184
259 Ga0307406_10353794 3300031901 Bacteria 1149
260 Ga0307412_10287940 3300031911 Bacteria 1293
261 Ga0307416_100085777 3300032002 Bacteria 2681
262 Ga0307416_101337452 3300032002 Bacteria 822
263 Ga0307411_10030605 3300032005 Bacteria 3301
264 Ga0307411_10462404 3300032005 Bacteria 1064
265 Ga0307411_10719569 3300032005 Bacteria 871
266 Ga0316574_0339027 3300035398 Bacteria 953
267 Ga0395899_0000054 3300037312 Bacteria 220952
268 Ga0395899_0005159 3300037312 Bacteria 10160
269 Ga0395900_0000220 3300037418 Bacteria 90109
270 Ga0395900_0016002 3300037418 Bacteria 7643
271 Ga0395898_0000510 3300037466 Bacteria 75287
272 Ga0395898_0057480 3300037466 Bacteria 3790
273 Ga0395898_1507936 3300037466 Bacteria 598
274 Ga0395905_0007060 3300037471 Bacteria 11226
275 Ga0395905_0024865 3300037471 Bacteria 5651
276 Ga0395905_0198592 3300037471 Bacteria 1880
277 Ga0395905_0329011 3300037471 Bacteria 1418
278 Ga0395905_0516901 3300037471 Bacteria 1094
279 Ga0395901_0002022 3300038443 Bacteria 20858
280 Ga0395901_0006544 3300038443 Bacteria 11783
281 Ga0395901_0229644 3300038443 Bacteria 1938
282 Ga0436365_1170741 3300039437 Bacteria 1213
283 Ga0436361_0061503 3300039447 Bacteria 127805
284 Ga0436361_0292464 3300039447 Bacteria 1226
285 Ga0436361_0481389 3300039447 Bacteria 1261
286 Ga0436361_0777699 3300039447 Bacteria 723
287 Ga0436361_0848343 3300039447 Bacteria 176869
288 Ga0451793_0387167 3300041452 Bacteria 757
289 Ga0451795_0239490 3300041456 Bacteria 596
290 Ga0451798_0112165 3300041458 Bacteria 714
291 Ga0451837_0266051 3300041494 Bacteria 683
292 Ga0451847_0818075 3300041503 Bacteria 590
293 Ga0439431_0067820 3300041997 Bacteria 947
294 Ga0439432_007117 3300042006 Bacteria 3974
295 Ga0439449_0002109 3300042007 Bacteria 7806
296 Ga0439449_0007819 3300042007 Bacteria 4060
297 Ga0439452_014679 3300042010 Bacteria 2168
298 Ga0439457_008633 3300042014 Bacteria 2395
299 Ga0450911_000542 3300042115 Bacteria 11763
300 Ga0450914_049551 3300042118 Bacteria 550
301 Ga0450921_014837 3300042123 Bacteria 695
302 Ga0450897_000200 3300042128 Bacteria 2984
303 Ga0450894_003837 3300042131 Bacteria 1965
304 Ga0450895_012740 3300042132 Bacteria 734
305 Ga0450899_002285 3300042135 Bacteria 2086
306 Ga0450899_039162 3300042135 Bacteria 590
307 Ga0450908_021483 3300042184 Bacteria 1132
308 Ga0450909_005365 3300042185 Bacteria 1844
309 Ga0439434_0004361 3300042435 Bacteria 4136
310 Ga0439434_0021460 3300042435 Bacteria 1940
311 Ga0439464_0078516 3300042439 Bacteria 983
312 Ga0451577_0000142 3300042876 Bacteria 160598
313 Ga0451577_0000879 3300042876 Bacteria 44584
314 Ga0451577_0003831 3300042876 Bacteria 16362
315 Ga0451577_1033168 3300042876 Bacteria 737
316 Ga0466969_0029637 3300044656 Bacteria 2793
317 Ga0466969_0037105 3300044656 Bacteria 2460
318 Ga0466972_0000111 3300044658 Bacteria 70764
319 Ga0453683_0013236 3300044673 Bacteria 5392
320 Ga0466965_0000099 3300044683 Bacteria 25415
321 Ga0466965_0004051 3300044683 Bacteria 6502
322 Ga0466965_0120408 3300044683 Bacteria 1355
323 Ga0466966_0000087 3300044684 Bacteria 57881
324 Ga0466966_0001623 3300044684 Bacteria 14487
325 Ga0466966_0892031 3300044684 Bacteria 536
326 Ga0466961_0000724 3300044693 Bacteria 20747
327 Ga0466961_0022051 3300044693 Bacteria 4098
328 Ga0466963_0036933 3300044694 Bacteria 3188
329 Ga0466963_0266552 3300044694 Bacteria 1203
330 Ga0466964_0000850 3300044706 Bacteria 10013
331 Ga0466964_0015718 3300044706 Bacteria 2881
332 Ga0453684_0000126 3300044712 Bacteria 336395
333 Ga0466971_0079058 3300044719 Bacteria 1499
334 Ga0466968_0026539 3300044735 Bacteria 2378
335 Ga0466968_0087190 3300044735 Bacteria 1378
336 Ga0466968_0169681 3300044735 Bacteria 1010
337 Ga0466968_0422769 3300044735 Bacteria 656
338 Ga0466970_0035821 3300044765 Bacteria 2628
339 Ga0466957_0025046 3300044842 Bacteria 3534
340 Ga0466959_0006559 3300045049 Bacteria 8075
341 Ga0466959_0017642 3300045049 Bacteria 5234
342 Ga0451576_0023432 3300045051 Bacteria 6683
343 Ga0466958_0006352 3300045836 Bacteria 6426
344 Ga0466958_0021076 3300045836 Bacteria 3804
345 Ga0495592_0042768 3300046454 Bacteria 3392
346 Ga0495592_0438802 3300046454 Bacteria 820
347 Ga0495590_0000630 3300046457 Bacteria 16380
348 Ga0495651_0101433 3300046462 Bacteria 2142
349 Ga0495651_0396110 3300046462 Bacteria 902
350 Ga0495653_0003931 3300046463 Bacteria 12016
351 Ga0495653_0179559 3300046463 Bacteria 1454
352 Ga0495653_0274026 3300046463 Bacteria 1110
353 Ga0495650_0126883 3300046471 Bacteria 934
354 Ga0495580_0911067 3300046472 Bacteria 564
355 Ga0495582_0521925 3300046473 Bacteria 687
356 Ga0495605_0393043 3300046474 Bacteria 577
357 Ga0495664_0060226 3300046477 Bacteria 2260
358 Ga0495584_0037588 3300046491 Bacteria 2447
359 Ga0495585_0007791 3300046492 Bacteria 6525
360 Ga0495596_0112653 3300046500 Bacteria 1056
361 Ga0495583_0003698 3300046506 Bacteria 11378
362 Ga0495616_0049273 3300046513 Bacteria 2112
363 Ga0495618_0182184 3300046514 Bacteria 1334
364 Ga0495620_0018493 3300046515 Bacteria 3450
365 Ga0495620_0264397 3300046515 Bacteria 655
366 Ga0495628_0008227 3300046516 Bacteria 8971
367 Ga0495628_0018646 3300046516 Bacteria 5743
368 Ga0495628_0072664 3300046516 Bacteria 2680
369 Ga0495630_0378752 3300046517 Bacteria 1084
370 Ga0495631_0057978 3300046518 Bacteria 1684
371 Ga0495632_0153200 3300046519 Bacteria 1065
372 Ga0495643_0010464 3300046522 Bacteria 5709
373 Ga0495642_0030532 3300046528 Bacteria 2156
374 Ga0495652_0013479 3300046529 Bacteria 7358
375 Ga0495652_0071319 3300046529 Bacteria 2900
376 Ga0495652_0126467 3300046529 Bacteria 2030
377 Ga0495654_0169692 3300046530 Bacteria 952
378 Ga0495654_0404347 3300046530 Bacteria 542
379 Ga0495586_0100845 3300046535 Bacteria 1602
380 Ga0495609_0005408 3300046538 Bacteria 6719
381 Ga0495597_0005314 3300046542 Bacteria 6829
382 Ga0495597_0007513 3300046542 Bacteria 5527
383 Ga0495645_0017116 3300046543 Bacteria 5192
384 Ga0495633_0006804 3300046558 Bacteria 6702
385 Ga0495667_0135696 3300046559 Bacteria 1586
386 Ga0495634_0152637 3300046642 Bacteria 1460
387 Ga0495611_0206269 3300046648 Bacteria 916
388 Ga0495635_0111045 3300046663 Bacteria 1873
389 Ga0495635_0375383 3300046663 Bacteria 947
390 Ga0495661_0037408 3300046665 Bacteria 3030
391 Ga0495599_0004516 3300046678 Bacteria 8251
392 Ga0495623_0024279 3300046679 Bacteria 3907
393 Ga0495646_0001683 3300046680 Bacteria 13232
394 Ga0495646_0166690 3300046680 Bacteria 1216
395 Ga0495669_0408131 3300046684 Bacteria 658
396 Ga0495624_0094865 3300046690 Bacteria 1839
397 Ga0495624_0121941 3300046690 Bacteria 1600
398 Ga0495649_0021009 3300046694 Bacteria 3660
399 Ga0495589_0031647 3300046794 Bacteria 2662
400 Ga0495589_0451914 3300046794 Bacteria 588
401 Ga0495600_0001160 3300046809 Bacteria 14378
402 Ga0495604_0003928 3300047317 Bacteria 11841
403 Ga0495604_0138900 3300047317 Bacteria 1738
404 Ga0495604_0142882 3300047317 Bacteria 1708
405 Ga0495674_0374312 3300047319 Bacteria 1153
406 Ga0495674_0886187 3300047319 Bacteria 689
407 Ga0495672_0108737 3300047320 Bacteria 1491
408 Ga0495680_0135838 3300047322 Bacteria 1803
409 Ga0495683_0001407 3300047323 Bacteria 15868
410 Ga0495683_0038828 3300047323 Bacteria 2408
411 Ga0495683_0118914 3300047323 Bacteria 1255
412 Ga0495687_000169 3300047443 Bacteria 97243
413 Ga0495687_028428 3300047443 Bacteria 2601
414 Ga0495687_037500 3300047443 Bacteria 2158
415 Ga0495675_0537110 3300047444 Bacteria 668
416 Ga0495686_0000002 3300047472 Bacteria 1050777
417 Ga0495686_0046812 3300047472 Bacteria 2733
418 Ga0495686_0350164 3300047472 Bacteria 803
419 Ga0495593_0124416 3300047673 Bacteria 1311
420 Ga0495602_0016723 3300048088 Bacteria 7368
421 Ga0495602_0064434 3300048088 Bacteria 3168
422 Ga0495602_0234091 3300048088 Bacteria 1378
423 Ga0496100_0043465 3300048903 Bacteria 2873
424 Ga0496101_0014626 3300048904 Bacteria 5277
425 Ga0496102_0001320 3300048905 Bacteria 22249
426 Ga0496103_0007295 3300048906 Bacteria 6589
427 Ga0496104_0900794 3300048907 Bacteria 789
428 Ga0496106_0017418 3300048909 Bacteria 5316
429 Ga0496107_0010544 3300048910 Bacteria 6424
430 Ga0496109_0427176 3300048912 Bacteria 1252
431 Ga0496110_0029250 3300048913 Bacteria 4740
432 Ga0496110_0225286 3300048913 Bacteria 1705
433 Ga0496111_0840342 3300048914 Bacteria 663
434 Ga0496112_0387745 3300048915 Bacteria 1337
435 Ga0496113_0017346 3300048916 Bacteria 4995
436 Ga0496114_0413596 3300048917 Bacteria 1194
437 Ga0496116_0012240 3300048919 Bacteria 7016
438 Ga0496116_0025650 3300048919 Bacteria 4329
439 Ga0496116_0056147 3300048919 Bacteria 2583
440 Ga0496116_0083790 3300048919 Bacteria 1966
441 Ga0496117_0109676 3300048920 Bacteria 1722
442 Ga0496117_0157305 3300048920 Bacteria 1336
443 Ga0496117_0391254 3300048920 Bacteria 705
444 Ga0496118_0041267 3300048921 Bacteria 3656
445 Ga0496118_0085353 3300048921 Bacteria 2199
446 Ga0496118_0107942 3300048921 Bacteria 1857
447 Ga0496119_0150913 3300048922 Bacteria 1245
448 Ga0496119_0202098 3300048922 Bacteria 1028
449 Ga0496121_0026672 3300048924 Bacteria 5432
450 Ga0496121_0055225 3300048924 Bacteria 3311
451 Ga0496121_0095542 3300048924 Bacteria 2309
452 Ga0496121_0149288 3300048924 Bacteria 1722
453 Ga0496121_0155932 3300048924 Bacteria 1675
454 Ga0496121_0376782 3300048924 Bacteria 937
455 Ga0496121_0388081 3300048924 Bacteria 919
456 Ga0496122_0007506 3300048925 Bacteria 12093
457 Ga0496122_0016989 3300048925 Bacteria 6834
458 Ga0496122_0201623 3300048925 Bacteria 1163
459 Ga0496123_0013377 3300048926 Bacteria 6896
460 Ga0496123_0164858 3300048926 Bacteria 1177
461 Ga0496123_0316224 3300048926 Bacteria 739
462 Ga0496124_0016661 3300048927 Bacteria 6973
463 Ga0496124_0147198 3300048927 Bacteria 1852
464 Ga0496124_0151704 3300048927 Bacteria 1817
465 Ga0496124_0216033 3300048927 Bacteria 1446
466 Ga0496124_0220722 3300048927 Bacteria 1426
467 Ga0496125_0001986 3300048928 Bacteria 27786
468 Ga0496125_0005041 3300048928 Bacteria 14902
469 Ga0496125_0009210 3300048928 Bacteria 10201
470 Ga0496125_0017768 3300048928 Bacteria 6769
471 Ga0496125_0034310 3300048928 Bacteria 4475
472 Ga0496125_0041736 3300048928 Bacteria 3918
473 Ga0496125_0291771 3300048928 Bacteria 1004
474 Ga0496126_0053155 3300048929 Bacteria 3677
475 Ga0496126_0096964 3300048929 Bacteria 2585
476 Ga0496126_0474798 3300048929 Bacteria 1003
477 Ga0496126_0503168 3300048929 Bacteria 968
478 Ga0496126_0722132 3300048929 Bacteria 772
479 Ga0496126_0815518 3300048929 Bacteria 715
480 Ga0495678_135378 3300049459 Bacteria 812
481 Ga0501034_0094658 3300049571 Bacteria 2984
482 Ga0501036_1022829 3300049572 Bacteria 676
483 Ga0501075_0224535 3300049591 Bacteria 1433
484 Ga0501076_0130489 3300049592 Bacteria 2038
485 Ga0501235_116457 3300049669 Bacteria 665
486 Ga0501266_005385 3300049763 Bacteria 1592
487 Ga0501035_0025767 3300049822 Bacteria 5390
488 Ga0501044_0012767 3300049823 Bacteria 9097
489 nmdc:mga03683_27162_c1 3300050489 Bacteria 2264
490 nmdc:mga03683_42933_c1 3300050489 Bacteria 1863
491 nmdc:mga03n38_250905_c1 3300050490 Bacteria 935
492 nmdc:mga0yw44_442496_c1 3300050492 Bacteria 881
493 nmdc:mga0yw44_716466_c1 3300050492 Bacteria 680
494 nmdc:mga0k408_46528_c1 3300050493 Bacteria 2506
495 nmdc:mga0k408_5292_c2 3300050493 Bacteria 3995
496 nmdc:mga06z11_526962_c1 3300050494 Bacteria 717
497 nmdc:mga06z11_61447_c1 3300050494 Bacteria 1959
498 nmdc:mga07m45_40490_c1 3300050496 Bacteria 2607
499 nmdc:mga07m45_531332_c1 3300050496 Bacteria 681
500 nmdc:mga07m45_76695_c1 3300050496 Bacteria 1906
501 nmdc:mga05p37_929765_c1 3300050507 Bacteria 933
502 nmdc:mga09592_214556_c1 3300050508 Bacteria 1668
503 nmdc:mga09592_32207_c1 3300050508 Bacteria 4370
504 nmdc:mga0qj67_15201_c1 3300050509 Bacteria 5825
505 nmdc:mga0qj67_194524_c1 3300050509 Bacteria 1648
506 nmdc:mga06r32_26118_c1 3300050510 Bacteria 5441
507 nmdc:mga08x19_112619_c1 3300050514 Bacteria 1816
508 Ga0495601_0005804 3300053077 Bacteria 7197
509 Ga0500578_0044292 3300053086 Bacteria 2857
510 Ga0500643_212325 3300053087 Bacteria 519
511 Ga0500651_0039631 3300053093 Bacteria 2966
512 Ga0500573_0202152 3300053140 Bacteria 1054
513 Ga0500574_000304 3300053141 Bacteria 6049
514 Ga0500619_000795 3300053154 Bacteria 5389
515 Ga0500645_006109 3300053730 Bacteria 4339
516 Ga0466962_0394874 3300061719 Bacteria 692

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005288 Ga0065714_10141060 Ga0065714_101410602 147
2 3300005335 Ga0070666_10164922 Ga0070666_101649222 147
3 3300005353 Ga0070669_100611605 Ga0070669_1006116052 147
4 3300005356 Ga0070674_102154740 Ga0070674_1021547401 147
5 3300005456 Ga0070678_100408116 Ga0070678_1004081162 147
6 3300005459 Ga0068867_100572991 Ga0068867_1005729912 147
7 3300005548 Ga0070665_100114839 Ga0070665_1001148394 147
8 3300005618 Ga0068864_100190388 Ga0068864_1001903882 147
9 3300005718 Ga0068866_10370926 Ga0068866_103709262 147
10 3300006042 Ga0075368_10036069 Ga0075368_100360693 147
11 3300006048 Ga0075363_100414612 Ga0075363_1004146122 147
12 3300006051 Ga0075364_10260865 Ga0075364_102608652 147
13 3300006051 Ga0075364_10444776 Ga0075364_104447762 147
14 3300006177 Ga0075362_10012577 Ga0075362_100125773 147
15 3300006178 Ga0075367_10205983 Ga0075367_102059832 147
16 3300006186 Ga0075369_10024462 Ga0075369_100244623 147
17 3300006195 Ga0075366_10021910 Ga0075366_100219102 147
18 3300006237 Ga0097621_101130468 Ga0097621_1011304682 147
19 3300006881 Ga0068865_101291042 Ga0068865_1012910421 147
20 3300006914 Ga0075436_100569324 Ga0075436_1005693242 147
21 3300009147 Ga0114129_11225266 Ga0114129_112252661 147
22 3300011119 Ga0105246_11177647 Ga0105246_111776472 147
23 3300013104 Ga0157370_10455738 Ga0157370_104557382 147
24 3300013308 Ga0157375_10315722 Ga0157375_103157221 147
25 3300014325 Ga0163163_10069193 Ga0163163_100691932 147
26 3300014326 Ga0157380_10419371 Ga0157380_104193712 147
27 3300014326 Ga0157380_12131862 Ga0157380_121318622 147
28 3300015261 Ga0182006_1085684 Ga0182006_10856841 147
29 3300015683 Ga0183362_10003 Ga0183362_1000374 147
30 3300025292 Ga0209676_1001036 Ga0209676_100103631 147
31 3300025294 Ga0209025_1004201 Ga0209025_100420113 147
32 3300025295 Ga0209564_1035084 Ga0209564_10350842 147
33 3300025298 Ga0209050_1064264 Ga0209050_10642642 147
34 3300025303 Ga0209051_1005682 Ga0209051_10056828 147
35 3300025304 Ga0209257_1016007 Ga0209257_10160073 147
36 3300025304 Ga0209257_1016909 Ga0209257_10169094 147
37 3300025903 Ga0207680_10161009 Ga0207680_101610092 147
38 3300025935 Ga0207709_10005490 Ga0207709_100054904 147
39 3300025941 Ga0207711_10664146 Ga0207711_106641461 147
40 3300026023 Ga0207677_10005131 Ga0207677_100051313 147
41 3300026088 Ga0207641_10522938 Ga0207641_105229382 147
42 3300026121 Ga0207683_10585374 Ga0207683_105853742 147
43 3300027360 Ga0209969_1021074 Ga0209969_10210742 147
44 3300027424 Ga0209984_1002498 Ga0209984_10024983 147
45 3300027614 Ga0209970_1000679 Ga0209970_10006794 147
46 3300027682 Ga0209971_1009117 Ga0209971_10091172 147
47 3300028794 Ga0307515_10000152 Ga0307515_1000015288 147
48 3300031251 Ga0265327_10005755 Ga0265327_100057558 147
49 3300031456 Ga0307513_10000004 Ga0307513_10000004341 147
50 3300031548 Ga0307408_100387198 Ga0307408_1003871982 147
51 3300031730 Ga0307516_10094111 Ga0307516_100941114 147
52 3300031731 Ga0307405_10012250 Ga0307405_100122502 147
53 3300031731 Ga0307405_10234871 Ga0307405_102348712 147
54 3300031901 Ga0307406_10353794 Ga0307406_103537942 147
55 3300032005 Ga0307411_10462404 Ga0307411_104624042 147
56 3300041456 Ga0451795_0239490 Ga0451795_0239490_38_484 147
57 3300041458 Ga0451798_0112165 Ga0451798_0112165_183_629 147
58 3300041494 Ga0451837_0266051 Ga0451837_0266051_204_653 147
59 3300041503 Ga0451847_0818075 Ga0451847_0818075_51_497 147
60 3300041997 Ga0439431_0067820 Ga0439431_0067820_450_896 147
61 3300042006 Ga0439432_007117 Ga0439432_007117_1558_2004 147
62 3300042007 Ga0439449_0002109 Ga0439449_0002109_2558_3004 147
63 3300042007 Ga0439449_0007819 Ga0439449_0007819_2075_2521 147
64 3300042010 Ga0439452_014679 Ga0439452_014679_1154_1600 147
65 3300042014 Ga0439457_008633 Ga0439457_008633_129_575 147
66 3300042115 Ga0450911_000542 Ga0450911_000542_9304_9750 147
67 3300042118 Ga0450914_049551 Ga0450914_049551_44_490 147
68 3300042123 Ga0450921_014837 Ga0450921_014837_218_664 147
69 3300042128 Ga0450897_000200 Ga0450897_000200_1643_2089 147
70 3300042131 Ga0450894_003837 Ga0450894_003837_1363_1809 147
71 3300042132 Ga0450895_012740 Ga0450895_012740_111_557 147
72 3300042135 Ga0450899_002285 Ga0450899_002285_922_1368 147
73 3300042184 Ga0450908_021483 Ga0450908_021483_444_890 147
74 3300042185 Ga0450909_005365 Ga0450909_005365_1107_1553 147
75 3300042435 Ga0439434_0004361 Ga0439434_0004361_1142_1588 147
76 3300042435 Ga0439434_0021460 Ga0439434_0021460_802_1248 147
77 3300042876 Ga0451577_0000142 Ga0451577_0000142_35388_35837 147
78 3300044673 Ga0453683_0013236 Ga0453683_0013236_3076_3522 147
79 3300044712 Ga0453684_0000126 Ga0453684_0000126_211185_211634 147
80 3300045051 Ga0451576_0023432 Ga0451576_0023432_5516_5962 147
81 3300046462 Ga0495651_0101433 Ga0495651_0101433_983_1429 147
82 3300046558 Ga0495633_0006804 Ga0495633_0006804_1935_2384 147
83 3300048088 Ga0495602_0234091 Ga0495602_0234091_25_471 147
84 3300048924 Ga0496121_0026672 Ga0496121_0026672_2951_3397 147
85 3300048926 Ga0496123_0316224 Ga0496123_0316224_233_679 147
86 3300048927 Ga0496124_0216033 Ga0496124_0216033_809_1255 147
87 3300048927 Ga0496124_0220722 Ga0496124_0220722_931_1377 147
88 3300048928 Ga0496125_0017768 Ga0496125_0017768_1405_1851 147
89 3300048928 Ga0496125_0041736 Ga0496125_0041736_1363_1809 147
90 3300048928 Ga0496125_0291771 Ga0496125_0291771_489_935 147
91 3300048929 Ga0496126_0503168 Ga0496126_0503168_450_899 147
92 3300049571 Ga0501034_0094658 Ga0501034_0094658_1860_2306 147
93 3300049572 Ga0501036_1022829 Ga0501036_1022829_72_524 147
94 3300049591 Ga0501075_0224535 Ga0501075_0224535_612_1064 147
95 3300049592 Ga0501076_0130489 Ga0501076_0130489_218_670 147
96 3300049763 Ga0501266_005385 Ga0501266_005385_992_1438 147
97 3300050489 nmdc:mga03683_27162_c1 nmdc:mga03683_27162_c1_382_828 147
98 3300050489 nmdc:mga03683_42933_c1 nmdc:mga03683_42933_c1_206_652 147
99 3300050490 nmdc:mga03n38_250905_c1 nmdc:mga03n38_250905_c1_285_731 147
100 3300050492 nmdc:mga0yw44_442496_c1 nmdc:mga0yw44_442496_c1_120_566 147
101 3300050492 nmdc:mga0yw44_716466_c1 nmdc:mga0yw44_716466_c1_33_479 147
102 3300050494 nmdc:mga06z11_526962_c1 nmdc:mga06z11_526962_c1_114_560 147
103 3300050496 nmdc:mga07m45_40490_c1 nmdc:mga07m45_40490_c1_2091_2537 147
104 3300050507 nmdc:mga05p37_929765_c1 nmdc:mga05p37_929765_c1_190_636 147
105 3300050514 nmdc:mga08x19_112619_c1 nmdc:mga08x19_112619_c1_323_769 147
106 3300053087 Ga0500643_212325 Ga0500643_212325_55_501 147
107 3300053093 Ga0500651_0039631 Ga0500651_0039631_88_534 147
108 3300001989 JGI24739J22299_10049111 JGI24739J22299_100491112 148
109 3300002067 JGI24735J21928_10021797 JGI24735J21928_100217971 148
110 3300002737 JGI25162J39368_1000027 JGI25162J39368_1000027184 148
111 3300002771 JGI25163J39215_1004601 JGI25163J39215_10046012 148
112 3300003214 JGI25165J46597_1000031 JGI25165J46597_1000031102 148
113 3300003354 JGI25160J50197_1000279 JGI25160J50197_100027912 148
114 3300003354 JGI25160J50197_1026696 JGI25160J50197_10266962 148
115 3300003751 Ga0055538_1000018 Ga0055538_1000018102 148
116 3300003752 Ga0055539_1000023 Ga0055539_1000023102 148
117 3300003756 Ga0055533_1000031 Ga0055533_1000031192 148
118 3300003758 Ga0055532_1001850 Ga0055532_10018504 148
119 3300003758 Ga0055532_1002401 Ga0055532_10024013 148
120 3300003758 Ga0055532_1002405 Ga0055532_10024052 148
121 3300003759 Ga0055525_1000038 Ga0055525_1000038215 148
122 3300003759 Ga0055525_1000039 Ga0055525_1000039102 148
123 3300003760 Ga0055527_1001077 Ga0055527_10010774 148
124 3300003760 Ga0055527_1001080 Ga0055527_10010804 148
125 3300003761 Ga0055535_1002463 Ga0055535_10024634 148
126 3300003761 Ga0055535_1002468 Ga0055535_10024684 148
127 3300003762 Ga0055542_1002359 Ga0055542_10023594 148
128 3300003762 Ga0055542_1003231 Ga0055542_10032312 148
129 3300003763 Ga0055529_1001317 Ga0055529_10013174 148
130 3300003784 Ga0055534_1026131 Ga0055534_10261312 148
131 3300003790 Ga0055528_1001724 Ga0055528_100172411 148
132 3300003841 Ga0055541_1000016 Ga0055541_1000016102 148
133 3300003856 Ga0058692_1009562 Ga0058692_10095623 148
134 3300004625 Ga0055543_1007895 Ga0055543_10078953 148
135 3300005262 Ga0065165_1000214 Ga0065165_100021425 148
136 3300005262 Ga0065165_1000286 Ga0065165_100028697 148
137 3300005262 Ga0065165_1000905 Ga0065165_100090521 148
138 3300005290 Ga0065712_10030383 Ga0065712_100303832 148
139 3300005327 Ga0070658_10109366 Ga0070658_101093662 148
140 3300005328 Ga0070676_10228686 Ga0070676_102286862 148
141 3300005328 Ga0070676_10858057 Ga0070676_108580572 148
142 3300005331 Ga0070670_100003254 Ga0070670_1000032546 148
143 3300005331 Ga0070670_101189122 Ga0070670_1011891221 148
144 3300005333 Ga0070677_10105109 Ga0070677_101051092 148
145 3300005338 Ga0068868_100073946 Ga0068868_1000739462 148
146 3300005339 Ga0070660_100004289 Ga0070660_1000042894 148
147 3300005344 Ga0070661_100440097 Ga0070661_1004400972 148
148 3300005347 Ga0070668_100055793 Ga0070668_1000557933 148
149 3300005353 Ga0070669_100054000 Ga0070669_1000540002 148
150 3300005353 Ga0070669_100283211 Ga0070669_1002832112 148
151 3300005354 Ga0070675_100000705 Ga0070675_1000007054 148
152 3300005355 Ga0070671_100006437 Ga0070671_1000064378 148
153 3300005356 Ga0070674_100001989 Ga0070674_1000019894 148
154 3300005356 Ga0070674_100154280 Ga0070674_1001542803 148
155 3300005364 Ga0070673_100014074 Ga0070673_1000140744 148
156 3300005366 Ga0070659_100000697 Ga0070659_10000069720 148
157 3300005367 Ga0070667_100152675 Ga0070667_1001526752 148
158 3300005367 Ga0070667_100581315 Ga0070667_1005813152 148
159 3300005438 Ga0070701_10172997 Ga0070701_101729972 148
160 3300005455 Ga0070663_100000289 Ga0070663_1000002897 148
161 3300005455 Ga0070663_100595585 Ga0070663_1005955852 148
162 3300005456 Ga0070678_100005858 Ga0070678_1000058584 148
163 3300005456 Ga0070678_100729463 Ga0070678_1007294632 148
164 3300005456 Ga0070678_101867712 Ga0070678_1018677121 148
165 3300005459 Ga0068867_100003695 Ga0068867_1000036959 148
166 3300005459 Ga0068867_100590354 Ga0068867_1005903542 148
167 3300005530 Ga0070679_100170005 Ga0070679_1001700052 148
168 3300005546 Ga0070696_100368106 Ga0070696_1003681062 148
169 3300005548 Ga0070665_100997812 Ga0070665_1009978122 148
170 3300005549 Ga0070704_100221356 Ga0070704_1002213562 148
171 3300005564 Ga0070664_100067450 Ga0070664_1000674502 148
172 3300005564 Ga0070664_100561589 Ga0070664_1005615892 148
173 3300005834 Ga0068851_10263009 Ga0068851_102630092 148
174 3300005840 Ga0068870_10121050 Ga0068870_101210502 148
175 3300006237 Ga0097621_100092319 Ga0097621_1000923192 148
176 3300006353 Ga0075370_10055016 Ga0075370_100550163 148
177 3300006353 Ga0075370_10159158 Ga0075370_101591582 148
178 3300006358 Ga0068871_100075709 Ga0068871_1000757093 148
179 3300006846 Ga0075430_100202313 Ga0075430_1002023132 148
180 3300006847 Ga0075431_100018750 Ga0075431_1000187506 148
181 3300006880 Ga0075429_100000294 Ga0075429_1000002944 148
182 3300006880 Ga0075429_100020879 Ga0075429_1000208792 148
183 3300009011 Ga0105251_10001210 Ga0105251_100012101 148
184 3300009036 Ga0105244_10128297 Ga0105244_101282971 148
185 3300009093 Ga0105240_10069966 Ga0105240_100699662 148
186 3300009093 Ga0105240_10095788 Ga0105240_100957884 148
187 3300009093 Ga0105240_10096638 Ga0105240_100966382 148
188 3300009176 Ga0105242_10000656 Ga0105242_1000065627 148
189 3300009177 Ga0105248_10037595 Ga0105248_100375953 148
190 3300009177 Ga0105248_11060135 Ga0105248_110601352 148
191 3300009545 Ga0105237_10079024 Ga0105237_100790242 148
192 3300009551 Ga0105238_10169272 Ga0105238_101692724 148
193 3300009551 Ga0105238_10283723 Ga0105238_102837232 148
194 3300010375 Ga0105239_10008632 Ga0105239_100086324 148
195 3300010375 Ga0105239_10418444 Ga0105239_104184443 148
196 3300013102 Ga0157371_10000001 Ga0157371_10000001601 148
197 3300013105 Ga0157369_10218107 Ga0157369_102181073 148
198 3300013105 Ga0157369_11572772 Ga0157369_115727721 148
199 3300013105 Ga0157369_11983714 Ga0157369_119837141 148
200 3300013306 Ga0163162_11324280 Ga0163162_113242802 148
201 3300013308 Ga0157375_10061759 Ga0157375_100617592 148
202 3300014497 Ga0182008_10015292 Ga0182008_100152924 148
203 3300014497 Ga0182008_10020248 Ga0182008_100202483 148
204 3300014969 Ga0157376_10106764 Ga0157376_101067643 148
205 3300015261 Ga0182006_1109467 Ga0182006_11094672 148
206 3300015262 Ga0182007_10002268 Ga0182007_100022684 148
207 3300015262 Ga0182007_10006994 Ga0182007_100069942 148
208 3300015265 Ga0182005_1032789 Ga0182005_10327892 148
209 3300016635 Ga0183361_10009 Ga0183361_10009117 148
210 3300017792 Ga0163161_10086155 Ga0163161_100861552 148
211 3300021361 Ga0213872_10000147 Ga0213872_1000014719 148
212 3300021361 Ga0213872_10000232 Ga0213872_100002326 148
213 3300021361 Ga0213872_10109261 Ga0213872_101092612 148
214 3300025206 Ga0209435_100015 Ga0209435_100015113 148
215 3300025206 Ga0209435_100443 Ga0209435_1004433 148
216 3300025206 Ga0209435_102903 Ga0209435_1029032 148
217 3300025225 Ga0209566_100843 Ga0209566_1008439 148
218 3300025226 Ga0209674_101439 Ga0209674_1014394 148
219 3300025226 Ga0209674_116364 Ga0209674_1163642 148
220 3300025228 Ga0209672_100033 Ga0209672_100033290 148
221 3300025228 Ga0209672_100034 Ga0209672_100034154 148
222 3300025229 Ga0209147_100004 Ga0209147_1000041113 148
223 3300025229 Ga0209147_100089 Ga0209147_100089159 148
224 3300025229 Ga0209147_100628 Ga0209147_1006284 148
225 3300025230 Ga0209563_100005 Ga0209563_1000051056 148
226 3300025231 Ga0207427_100718 Ga0207427_1007187 148
227 3300025242 Ga0209258_100023 Ga0209258_10002389 148
228 3300025242 Ga0209258_100242 Ga0209258_10024283 148
229 3300025242 Ga0209258_100523 Ga0209258_10052326 148
230 3300025246 Ga0209646_1000020 Ga0209646_100002094 148
231 3300025246 Ga0209646_1000040 Ga0209646_1000040143 148
232 3300025250 Ga0209026_1000034 Ga0209026_1000034176 148
233 3300025250 Ga0209026_1001823 Ga0209026_10018235 148
234 3300025254 Ga0209148_1000029 Ga0209148_1000029154 148
235 3300025254 Ga0209148_1003502 Ga0209148_10035024 148
236 3300025254 Ga0209148_1012762 Ga0209148_10127622 148
237 3300025256 Ga0209759_1000049 Ga0209759_100004927 148
238 3300025256 Ga0209759_1000656 Ga0209759_100065625 148
239 3300025272 Ga0209455_1000123 Ga0209455_1000123154 148
240 3300025273 Ga0209673_1000075 Ga0209673_100007519 148
241 3300025284 Ga0209130_1026653 Ga0209130_10266532 148
242 3300025291 Ga0209675_1035364 Ga0209675_10353642 148
243 3300025295 Ga0209564_1014545 Ga0209564_10145452 148
244 3300025302 Ga0207426_1000326 Ga0207426_10003262 148
245 3300025302 Ga0207426_1006086 Ga0207426_10060862 148
246 3300025315 Ga0207697_10079401 Ga0207697_100794012 148
247 3300025321 Ga0207656_10059814 Ga0207656_100598142 148
248 3300025711 Ga0207696_1053246 Ga0207696_10532462 148
249 3300025735 Ga0207713_1003216 Ga0207713_10032169 148
250 3300025893 Ga0207682_10004972 Ga0207682_100049724 148
251 3300025901 Ga0207688_10052635 Ga0207688_100526352 148
252 3300025904 Ga0207647_10003550 Ga0207647_100035508 148
253 3300025904 Ga0207647_10063243 Ga0207647_100632432 148
254 3300025907 Ga0207645_10210231 Ga0207645_102102312 148
255 3300025909 Ga0207705_10080115 Ga0207705_100801152 148
256 3300025913 Ga0207695_10002948 Ga0207695_100029485 148
257 3300025913 Ga0207695_10018474 Ga0207695_100184747 148
258 3300025913 Ga0207695_10083561 Ga0207695_100835612 148
259 3300025913 Ga0207695_10313487 Ga0207695_103134872 148
260 3300025914 Ga0207671_10028629 Ga0207671_100286291 148
261 3300025918 Ga0207662_10120016 Ga0207662_101200162 148
262 3300025919 Ga0207657_10000098 Ga0207657_1000009882 148
263 3300025919 Ga0207657_10366743 Ga0207657_103667432 148
264 3300025922 Ga0207646_10614104 Ga0207646_106141042 148
265 3300025923 Ga0207681_10384804 Ga0207681_103848042 148
266 3300025924 Ga0207694_10386482 Ga0207694_103864822 148
267 3300025925 Ga0207650_10002051 Ga0207650_100020513 148
268 3300025925 Ga0207650_10073515 Ga0207650_100735152 148
269 3300025926 Ga0207659_10005314 Ga0207659_100053143 148
270 3300025926 Ga0207659_10735814 Ga0207659_107358141 148
271 3300025931 Ga0207644_10001988 Ga0207644_1000198813 148
272 3300025932 Ga0207690_10000055 Ga0207690_1000005583 148
273 3300025935 Ga0207709_10033765 Ga0207709_100337651 148
274 3300025936 Ga0207670_10391012 Ga0207670_103910122 148
275 3300025940 Ga0207691_10000361 Ga0207691_1000036110 148
276 3300025940 Ga0207691_10046489 Ga0207691_100464892 148
277 3300025940 Ga0207691_10531794 Ga0207691_105317942 148
278 3300025941 Ga0207711_10248049 Ga0207711_102480492 148
279 3300025941 Ga0207711_11145057 Ga0207711_111450571 148
280 3300025942 Ga0207689_10832452 Ga0207689_108324522 148
281 3300025945 Ga0207679_10040210 Ga0207679_100402103 148
282 3300025945 Ga0207679_10504436 Ga0207679_105044362 148
283 3300025960 Ga0207651_10039281 Ga0207651_100392812 148
284 3300025960 Ga0207651_10372707 Ga0207651_103727072 148
285 3300025972 Ga0207668_10065332 Ga0207668_100653324 148
286 3300025986 Ga0207658_10000319 Ga0207658_1000031922 148
287 3300025986 Ga0207658_10098944 Ga0207658_100989442 148
288 3300026023 Ga0207677_10028107 Ga0207677_100281072 148
289 3300026035 Ga0207703_10331552 Ga0207703_103315522 148
290 3300026067 Ga0207678_10002325 Ga0207678_100023257 148
291 3300026067 Ga0207678_10445964 Ga0207678_104459642 148
292 3300026078 Ga0207702_10485699 Ga0207702_104856992 148
293 3300026089 Ga0207648_10007787 Ga0207648_100077878 148
294 3300026089 Ga0207648_11331613 Ga0207648_113316131 148
295 3300026116 Ga0207674_10138110 Ga0207674_101381102 148
296 3300026121 Ga0207683_10253689 Ga0207683_102536891 148
297 3300026121 Ga0207683_12046828 Ga0207683_120468281 148
298 3300026142 Ga0207698_10015048 Ga0207698_100150482 148
299 3300026142 Ga0207698_10474589 Ga0207698_104745892 148
300 3300027312 Ga0209371_1000676 Ga0209371_10006762 148
301 3300029957 Ga0265324_10065087 Ga0265324_100650871 148
302 3300030500 Ga0268256_1004071 Ga0268256_10040712 148
303 3300031250 Ga0265331_10009839 Ga0265331_100098394 148
304 3300031251 Ga0265327_10000144 Ga0265327_10000144113 148
305 3300031251 Ga0265327_10028374 Ga0265327_100283742 148
306 3300031251 Ga0265327_10049683 Ga0265327_100496832 148
307 3300031548 Ga0307408_100140697 Ga0307408_1001406972 148
308 3300031548 Ga0307408_100158087 Ga0307408_1001580871 148
309 3300031665 Ga0316575_10062853 Ga0316575_100628532 148
310 3300031730 Ga0307516_10449662 Ga0307516_104496621 148
311 3300031824 Ga0307413_10653376 Ga0307413_106533762 148
312 3300031852 Ga0307410_10089256 Ga0307410_100892562 148
313 3300031911 Ga0307412_10287940 Ga0307412_102879402 148
314 3300032002 Ga0307416_100085777 Ga0307416_1000857772 148
315 3300032002 Ga0307416_101337452 Ga0307416_1013374522 148
316 3300032005 Ga0307411_10030605 Ga0307411_100306053 148
317 3300032005 Ga0307411_10719569 Ga0307411_107195692 148
318 3300035398 Ga0316574_0339027 Ga0316574_0339027_136_591 148
319 3300037312 Ga0395899_0000054 Ga0395899_0000054_72221_72667 148
320 3300037312 Ga0395899_0005159 Ga0395899_0005159_7234_7680 148
321 3300037418 Ga0395900_0000220 Ga0395900_0000220_17451_17897 148
322 3300037418 Ga0395900_0016002 Ga0395900_0016002_6275_6721 148
323 3300037466 Ga0395898_0000510 Ga0395898_0000510_72213_72659 148
324 3300037466 Ga0395898_0057480 Ga0395898_0057480_1393_1839 148
325 3300037466 Ga0395898_1507936 Ga0395898_1507936_111_560 148
326 3300037471 Ga0395905_0007060 Ga0395905_0007060_10520_10966 148
327 3300037471 Ga0395905_0024865 Ga0395905_0024865_4975_5424 148
328 3300037471 Ga0395905_0198592 Ga0395905_0198592_261_710 148
329 3300037471 Ga0395905_0329011 Ga0395905_0329011_477_926 148
330 3300037471 Ga0395905_0516901 Ga0395905_0516901_152_601 148
331 3300038443 Ga0395901_0002022 Ga0395901_0002022_16567_17013 148
332 3300038443 Ga0395901_0006544 Ga0395901_0006544_9534_9983 148
333 3300038443 Ga0395901_0229644 Ga0395901_0229644_1099_1548 148
334 3300039437 Ga0436365_1170741 Ga0436365_1170741_508_954 148
335 3300039447 Ga0436361_0061503 Ga0436361_0061503_117307_117756 148
336 3300039447 Ga0436361_0292464 Ga0436361_0292464_220_669 148
337 3300039447 Ga0436361_0481389 Ga0436361_0481389_528_977 148
338 3300039447 Ga0436361_0777699 Ga0436361_0777699_40_489 148
339 3300039447 Ga0436361_0848343 Ga0436361_0848343_129342_129794 148
340 3300041452 Ga0451793_0387167 Ga0451793_0387167_84_533 148
341 3300042135 Ga0450899_039162 Ga0450899_039162_98_547 148
342 3300042439 Ga0439464_0078516 Ga0439464_0078516_113_562 148
343 3300042876 Ga0451577_0000879 Ga0451577_0000879_2302_2751 148
344 3300042876 Ga0451577_0003831 Ga0451577_0003831_7460_7909 148
345 3300042876 Ga0451577_1033168 Ga0451577_1033168_109_555 148
346 3300044656 Ga0466969_0029637 Ga0466969_0029637_522_968 148
347 3300044656 Ga0466969_0037105 Ga0466969_0037105_1692_2138 148
348 3300044658 Ga0466972_0000111 Ga0466972_0000111_37886_38335 148
349 3300044683 Ga0466965_0000099 Ga0466965_0000099_11251_11700 148
350 3300044683 Ga0466965_0004051 Ga0466965_0004051_4681_5127 148
351 3300044683 Ga0466965_0120408 Ga0466965_0120408_583_1032 148
352 3300044684 Ga0466966_0000087 Ga0466966_0000087_17472_17918 148
353 3300044684 Ga0466966_0001623 Ga0466966_0001623_9740_10186 148
354 3300044684 Ga0466966_0892031 Ga0466966_0892031_74_520 148
355 3300044693 Ga0466961_0000724 Ga0466961_0000724_15474_15920 148
356 3300044693 Ga0466961_0022051 Ga0466961_0022051_2003_2449 148
357 3300044694 Ga0466963_0036933 Ga0466963_0036933_468_914 148
358 3300044694 Ga0466963_0266552 Ga0466963_0266552_393_839 148
359 3300044706 Ga0466964_0000850 Ga0466964_0000850_7950_8396 148
360 3300044706 Ga0466964_0015718 Ga0466964_0015718_995_1444 148
361 3300044719 Ga0466971_0079058 Ga0466971_0079058_332_778 148
362 3300044735 Ga0466968_0026539 Ga0466968_0026539_497_943 148
363 3300044735 Ga0466968_0087190 Ga0466968_0087190_60_509 148
364 3300044735 Ga0466968_0169681 Ga0466968_0169681_291_740 148
365 3300044735 Ga0466968_0422769 Ga0466968_0422769_152_598 148
366 3300044765 Ga0466970_0035821 Ga0466970_0035821_2152_2598 148
367 3300044842 Ga0466957_0025046 Ga0466957_0025046_159_605 148
368 3300045049 Ga0466959_0006559 Ga0466959_0006559_5177_5623 148
369 3300045049 Ga0466959_0017642 Ga0466959_0017642_820_1266 148
370 3300045836 Ga0466958_0006352 Ga0466958_0006352_1148_1594 148
371 3300045836 Ga0466958_0021076 Ga0466958_0021076_2823_3269 148
372 3300046454 Ga0495592_0042768 Ga0495592_0042768_1233_1682 148
373 3300046454 Ga0495592_0438802 Ga0495592_0438802_90_539 148
374 3300046457 Ga0495590_0000630 Ga0495590_0000630_453_899 148
375 3300046462 Ga0495651_0396110 Ga0495651_0396110_364_813 148
376 3300046463 Ga0495653_0003931 Ga0495653_0003931_10514_10963 148
377 3300046463 Ga0495653_0179559 Ga0495653_0179559_351_797 148
378 3300046463 Ga0495653_0274026 Ga0495653_0274026_361_807 148
379 3300046471 Ga0495650_0126883 Ga0495650_0126883_177_623 148
380 3300046472 Ga0495580_0911067 Ga0495580_0911067_65_511 148
381 3300046473 Ga0495582_0521925 Ga0495582_0521925_124_570 148
382 3300046474 Ga0495605_0393043 Ga0495605_0393043_118_564 148
383 3300046477 Ga0495664_0060226 Ga0495664_0060226_834_1280 148
384 3300046491 Ga0495584_0037588 Ga0495584_0037588_904_1353 148
385 3300046492 Ga0495585_0007791 Ga0495585_0007791_4524_4973 148
386 3300046500 Ga0495596_0112653 Ga0495596_0112653_335_784 148
387 3300046506 Ga0495583_0003698 Ga0495583_0003698_10736_11185 148
388 3300046513 Ga0495616_0049273 Ga0495616_0049273_1523_1972 148
389 3300046514 Ga0495618_0182184 Ga0495618_0182184_285_734 148
390 3300046515 Ga0495620_0018493 Ga0495620_0018493_1711_2157 148
391 3300046515 Ga0495620_0264397 Ga0495620_0264397_185_634 148
392 3300046516 Ga0495628_0008227 Ga0495628_0008227_738_1184 148
393 3300046516 Ga0495628_0018646 Ga0495628_0018646_1151_1600 148
394 3300046516 Ga0495628_0072664 Ga0495628_0072664_68_514 148
395 3300046517 Ga0495630_0378752 Ga0495630_0378752_240_686 148
396 3300046518 Ga0495631_0057978 Ga0495631_0057978_1223_1672 148
397 3300046519 Ga0495632_0153200 Ga0495632_0153200_128_577 148
398 3300046522 Ga0495643_0010464 Ga0495643_0010464_3650_4099 148
399 3300046528 Ga0495642_0030532 Ga0495642_0030532_1526_1975 148
400 3300046529 Ga0495652_0013479 Ga0495652_0013479_3865_4314 148
401 3300046529 Ga0495652_0071319 Ga0495652_0071319_2059_2505 148
402 3300046529 Ga0495652_0126467 Ga0495652_0126467_110_556 148
403 3300046530 Ga0495654_0169692 Ga0495654_0169692_433_879 148
404 3300046530 Ga0495654_0404347 Ga0495654_0404347_20_466 148
405 3300046535 Ga0495586_0100845 Ga0495586_0100845_751_1197 148
406 3300046538 Ga0495609_0005408 Ga0495609_0005408_141_590 148
407 3300046542 Ga0495597_0005314 Ga0495597_0005314_3488_3937 148
408 3300046542 Ga0495597_0007513 Ga0495597_0007513_609_1055 148
409 3300046543 Ga0495645_0017116 Ga0495645_0017116_1991_2440 148
410 3300046559 Ga0495667_0135696 Ga0495667_0135696_922_1368 148
411 3300046642 Ga0495634_0152637 Ga0495634_0152637_649_1098 148
412 3300046648 Ga0495611_0206269 Ga0495611_0206269_65_514 148
413 3300046663 Ga0495635_0111045 Ga0495635_0111045_10_459 148
414 3300046663 Ga0495635_0375383 Ga0495635_0375383_298_744 148
415 3300046665 Ga0495661_0037408 Ga0495661_0037408_2218_2667 148
416 3300046678 Ga0495599_0004516 Ga0495599_0004516_5043_5492 148
417 3300046679 Ga0495623_0024279 Ga0495623_0024279_3250_3696 148
418 3300046680 Ga0495646_0001683 Ga0495646_0001683_1715_2164 148
419 3300046680 Ga0495646_0166690 Ga0495646_0166690_467_913 148
420 3300046684 Ga0495669_0408131 Ga0495669_0408131_30_476 148
421 3300046690 Ga0495624_0094865 Ga0495624_0094865_46_495 148
422 3300046690 Ga0495624_0121941 Ga0495624_0121941_363_812 148
423 3300046694 Ga0495649_0021009 Ga0495649_0021009_2767_3213 148
424 3300046794 Ga0495589_0031647 Ga0495589_0031647_1615_2064 148
425 3300046794 Ga0495589_0451914 Ga0495589_0451914_44_490 148
426 3300046809 Ga0495600_0001160 Ga0495600_0001160_11623_12072 148
427 3300047317 Ga0495604_0003928 Ga0495604_0003928_2852_3301 148
428 3300047317 Ga0495604_0138900 Ga0495604_0138900_33_479 148
429 3300047317 Ga0495604_0142882 Ga0495604_0142882_658_1104 148
430 3300047319 Ga0495674_0374312 Ga0495674_0374312_640_1086 148
431 3300047319 Ga0495674_0886187 Ga0495674_0886187_96_542 148
432 3300047320 Ga0495672_0108737 Ga0495672_0108737_811_1257 148
433 3300047322 Ga0495680_0135838 Ga0495680_0135838_1051_1497 148
434 3300047323 Ga0495683_0001407 Ga0495683_0001407_12101_12547 148
435 3300047323 Ga0495683_0038828 Ga0495683_0038828_273_722 148
436 3300047323 Ga0495683_0118914 Ga0495683_0118914_768_1214 148
437 3300047443 Ga0495687_000169 Ga0495687_000169_61872_62318 148
438 3300047443 Ga0495687_028428 Ga0495687_028428_676_1122 148
439 3300047443 Ga0495687_037500 Ga0495687_037500_364_813 148
440 3300047444 Ga0495675_0537110 Ga0495675_0537110_159_605 148
441 3300047472 Ga0495686_0000002 Ga0495686_0000002_83189_83635 148
442 3300047472 Ga0495686_0046812 Ga0495686_0046812_228_674 148
443 3300047472 Ga0495686_0350164 Ga0495686_0350164_40_486 148
444 3300047673 Ga0495593_0124416 Ga0495593_0124416_101_547 148
445 3300048088 Ga0495602_0016723 Ga0495602_0016723_4326_4772 148
446 3300048088 Ga0495602_0064434 Ga0495602_0064434_1211_1660 148
447 3300048903 Ga0496100_0043465 Ga0496100_0043465_133_579 148
448 3300048904 Ga0496101_0014626 Ga0496101_0014626_4107_4553 148
449 3300048905 Ga0496102_0001320 Ga0496102_0001320_1605_2051 148
450 3300048906 Ga0496103_0007295 Ga0496103_0007295_472_918 148
451 3300048907 Ga0496104_0900794 Ga0496104_0900794_131_577 148
452 3300048909 Ga0496106_0017418 Ga0496106_0017418_4488_4934 148
453 3300048910 Ga0496107_0010544 Ga0496107_0010544_3092_3538 148
454 3300048912 Ga0496109_0427176 Ga0496109_0427176_101_547 148
455 3300048913 Ga0496110_0029250 Ga0496110_0029250_4038_4484 148
456 3300048913 Ga0496110_0225286 Ga0496110_0225286_396_845 148
457 3300048914 Ga0496111_0840342 Ga0496111_0840342_45_494 148
458 3300048915 Ga0496112_0387745 Ga0496112_0387745_635_1081 148
459 3300048916 Ga0496113_0017346 Ga0496113_0017346_619_1065 148
460 3300048917 Ga0496114_0413596 Ga0496114_0413596_529_978 148
461 3300048919 Ga0496116_0012240 Ga0496116_0012240_406_852 148
462 3300048919 Ga0496116_0025650 Ga0496116_0025650_2776_3222 148
463 3300048919 Ga0496116_0056147 Ga0496116_0056147_269_715 148
464 3300048919 Ga0496116_0083790 Ga0496116_0083790_818_1267 148
465 3300048920 Ga0496117_0109676 Ga0496117_0109676_441_935 148
466 3300048920 Ga0496117_0157305 Ga0496117_0157305_485_931 148
467 3300048920 Ga0496117_0391254 Ga0496117_0391254_228_677 148
468 3300048921 Ga0496118_0041267 Ga0496118_0041267_1651_2100 148
469 3300048921 Ga0496118_0085353 Ga0496118_0085353_418_864 148
470 3300048921 Ga0496118_0107942 Ga0496118_0107942_636_1082 148
471 3300048922 Ga0496119_0150913 Ga0496119_0150913_197_727 148
472 3300048922 Ga0496119_0202098 Ga0496119_0202098_280_726 148
473 3300048924 Ga0496121_0055225 Ga0496121_0055225_2458_2904 148
474 3300048924 Ga0496121_0095542 Ga0496121_0095542_1269_1718 148
475 3300048924 Ga0496121_0149288 Ga0496121_0149288_606_1052 148
476 3300048924 Ga0496121_0155932 Ga0496121_0155932_735_1232 148
477 3300048924 Ga0496121_0376782 Ga0496121_0376782_121_570 148
478 3300048924 Ga0496121_0388081 Ga0496121_0388081_135_581 148
479 3300048925 Ga0496122_0007506 Ga0496122_0007506_3540_3986 148
480 3300048925 Ga0496122_0016989 Ga0496122_0016989_3624_4073 148
481 3300048925 Ga0496122_0201623 Ga0496122_0201623_614_1063 148
482 3300048926 Ga0496123_0013377 Ga0496123_0013377_2820_3269 148
483 3300048926 Ga0496123_0164858 Ga0496123_0164858_652_1098 148
484 3300048927 Ga0496124_0016661 Ga0496124_0016661_4794_5240 148
485 3300048927 Ga0496124_0147198 Ga0496124_0147198_956_1405 148
486 3300048927 Ga0496124_0151704 Ga0496124_0151704_81_530 148
487 3300048928 Ga0496125_0001986 Ga0496125_0001986_23127_23576 148
488 3300048928 Ga0496125_0005041 Ga0496125_0005041_3755_4204 148
489 3300048928 Ga0496125_0009210 Ga0496125_0009210_6596_7042 148
490 3300048928 Ga0496125_0034310 Ga0496125_0034310_1580_2029 148
491 3300048929 Ga0496126_0053155 Ga0496126_0053155_1825_2274 148
492 3300048929 Ga0496126_0096964 Ga0496126_0096964_345_791 148
493 3300048929 Ga0496126_0474798 Ga0496126_0474798_479_925 148
494 3300048929 Ga0496126_0722132 Ga0496126_0722132_302_751 148
495 3300048929 Ga0496126_0815518 Ga0496126_0815518_258_704 148
496 3300049459 Ga0495678_135378 Ga0495678_135378_302_748 148
497 3300049669 Ga0501235_116457 Ga0501235_116457_183_632 148
498 3300049822 Ga0501035_0025767 Ga0501035_0025767_516_965 148
499 3300049823 Ga0501044_0012767 Ga0501044_0012767_7184_7633 148
500 3300050493 nmdc:mga0k408_46528_c1 nmdc:mga0k408_46528_c1_958_1407 148
501 3300050493 nmdc:mga0k408_5292_c2 nmdc:mga0k408_5292_c2_2331_2789 148
502 3300050494 nmdc:mga06z11_61447_c1 nmdc:mga06z11_61447_c1_1336_1785 148
503 3300050496 nmdc:mga07m45_531332_c1 nmdc:mga07m45_531332_c1_175_624 148
504 3300050496 nmdc:mga07m45_76695_c1 nmdc:mga07m45_76695_c1_1399_1848 148
505 3300050508 nmdc:mga09592_214556_c1 nmdc:mga09592_214556_c1_826_1314 148
506 3300050508 nmdc:mga09592_32207_c1 nmdc:mga09592_32207_c1_2088_2537 148
507 3300050509 nmdc:mga0qj67_15201_c1 nmdc:mga0qj67_15201_c1_2349_2837 148
508 3300050509 nmdc:mga0qj67_194524_c1 nmdc:mga0qj67_194524_c1_802_1251 148
509 3300050510 nmdc:mga06r32_26118_c1 nmdc:mga06r32_26118_c1_281_730 148
510 3300053077 Ga0495601_0005804 Ga0495601_0005804_4551_5000 148
511 3300053086 Ga0500578_0044292 Ga0500578_0044292_1604_2053 148
512 3300053140 Ga0500573_0202152 Ga0500573_0202152_521_970 148
513 3300053141 Ga0500574_000304 Ga0500574_000304_2705_3154 148
514 3300053154 Ga0500619_000795 Ga0500619_000795_2985_3434 148
515 3300053730 Ga0500645_006109 Ga0500645_006109_3351_3800 148
516 3300061719 Ga0466962_0394874 Ga0466962_0394874_206_652 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00692

dUTPase

dUTPase

46

180

0.95

PF22769

DCD

dCTP deaminase-like

54

154

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3km3-assembly1.cif.gz_A crystal structure of eoxycytidine triphosphate deaminase from anaplasma phagocytophilum at 2.1a resolution 0.9006 35 118
3km3-assembly1.cif.gz_B crystal structure of eoxycytidine triphosphate deaminase from anaplasma phagocytophilum at 2.1a resolution 0.8776 35 118
2v9x-assembly2.cif.gz_G e138d variant of escherichia coli dctp deaminase in complex with dutp 0.8608 34 123
4lhr-assembly1.cif.gz_A crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis 0.8607 1 132
2okb-assembly1.cif.gz_A high resolution crystal structures of vaccinia virus dutpase 0.8603 4 124
ID Description Score Start End Superfamily
3km3A00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.9006 35 118 2.70.40.10
2d4lA01 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8432 20 121 2.70.40.10
1snfC00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8309 1 132 2.70.40.10
3tqzA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8282 2 134 2.70.40.10
1ducA00 Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) 0.8254 19 132 2.70.40.10
ID Description Score Start End GO Terms
AF-A0A447TSH8-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.9232 26 126 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A661CKF5-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.8987 2 123 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A447QL67-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.8987 2 119 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A259EVG0-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.8973 1 115 GO:0000287
GO:0004170
GO:0006226
GO:0046081
AF-A0A259EVG0-F1-model_v4 dUTP diphosphatase (EC 3.6.1.23) 0.89 1 115 GO:0000287
GO:0004170
GO:0006226
GO:0046081

Feature Viewer

pLDDT pTM Quality
83.81 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map