F457989
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 516 | 326 | 516 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10000656|Ga0105242_1000065627 |
| Length | 182 |
| Sequence | LLPSLPGACLGRAALSRFLFFSHLGGPIVRRLSMKIDLKILDPRMAEQLPAYATPGSAGLDLRACLDAPITLEPNAWQLVPTGIAIHLRDPGYAAMILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSAWNRSDTAFTLQPMERLAQLVIVPVVQAQFNVVDEFSGASERGQGGYGSTGTN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 91 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 169 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 177 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 185 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 189 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 190 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 191 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 192 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 193 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 194 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 195 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 196 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 197 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 198 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 199 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 200 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 201 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 202 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 203 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 204 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 205 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 206 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 207 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 208 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 209 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 210 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 211 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 212 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 215 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 216 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 219 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 289 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 290 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 291 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 305 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 309 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 311 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 320 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 321 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 322 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 323 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 324 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 325 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 326 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.67 |
| Nodule | 0 |
| Rhizoplane | 3.29 |
| Rhizosphere | 68.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10049111 | 3300001989 | Bacteria | 1369 |
| 2 | JGI24735J21928_10021797 | 3300002067 | Bacteria | 1954 |
| 3 | JGI25162J39368_1000027 | 3300002737 | Bacteria | 223163 |
| 4 | JGI25163J39215_1004601 | 3300002771 | Bacteria | 952 |
| 5 | JGI25165J46597_1000031 | 3300003214 | Bacteria | 296858 |
| 6 | JGI25160J50197_1000279 | 3300003354 | Bacteria | 37135 |
| 7 | JGI25160J50197_1026696 | 3300003354 | Bacteria | 1587 |
| 8 | Ga0055538_1000018 | 3300003751 | Bacteria | 296858 |
| 9 | Ga0055539_1000023 | 3300003752 | Bacteria | 296858 |
| 10 | Ga0055533_1000031 | 3300003756 | Bacteria | 296858 |
| 11 | Ga0055532_1001850 | 3300003758 | Bacteria | 5190 |
| 12 | Ga0055532_1002401 | 3300003758 | Bacteria | 3924 |
| 13 | Ga0055532_1002405 | 3300003758 | Bacteria | 3921 |
| 14 | Ga0055525_1000038 | 3300003759 | Bacteria | 297540 |
| 15 | Ga0055525_1000039 | 3300003759 | Bacteria | 296858 |
| 16 | Ga0055527_1001077 | 3300003760 | Bacteria | 6432 |
| 17 | Ga0055527_1001080 | 3300003760 | Bacteria | 6414 |
| 18 | Ga0055535_1002463 | 3300003761 | Bacteria | 6432 |
| 19 | Ga0055535_1002468 | 3300003761 | Bacteria | 6414 |
| 20 | Ga0055542_1002359 | 3300003762 | Bacteria | 6414 |
| 21 | Ga0055542_1003231 | 3300003762 | Bacteria | 4558 |
| 22 | Ga0055529_1001317 | 3300003763 | Bacteria | 8412 |
| 23 | Ga0055534_1026131 | 3300003784 | Bacteria | 932 |
| 24 | Ga0055528_1001724 | 3300003790 | Bacteria | 12650 |
| 25 | Ga0055541_1000016 | 3300003841 | Bacteria | 296861 |
| 26 | Ga0058692_1009562 | 3300003856 | Bacteria | 2434 |
| 27 | Ga0055543_1007895 | 3300004625 | Bacteria | 2412 |
| 28 | Ga0065165_1000214 | 3300005262 | Bacteria | 100283 |
| 29 | Ga0065165_1000286 | 3300005262 | Bacteria | 85993 |
| 30 | Ga0065165_1000905 | 3300005262 | Bacteria | 38287 |
| 31 | Ga0065714_10141060 | 3300005288 | Bacteria | 1171 |
| 32 | Ga0065712_10030383 | 3300005290 | Bacteria | 1287 |
| 33 | Ga0070658_10109366 | 3300005327 | Bacteria | 2288 |
| 34 | Ga0070676_10228686 | 3300005328 | Bacteria | 1232 |
| 35 | Ga0070676_10858057 | 3300005328 | Bacteria | 674 |
| 36 | Ga0070670_100003254 | 3300005331 | Bacteria | 13419 |
| 37 | Ga0070670_101189122 | 3300005331 | Bacteria | 697 |
| 38 | Ga0070677_10105109 | 3300005333 | Bacteria | 1252 |
| 39 | Ga0070666_10164922 | 3300005335 | Bacteria | 1549 |
| 40 | Ga0068868_100073946 | 3300005338 | Bacteria | 2721 |
| 41 | Ga0070660_100004289 | 3300005339 | Bacteria | 9850 |
| 42 | Ga0070661_100440097 | 3300005344 | Bacteria | 1036 |
| 43 | Ga0070668_100055793 | 3300005347 | Bacteria | 3050 |
| 44 | Ga0070669_100054000 | 3300005353 | Bacteria | 2942 |
| 45 | Ga0070669_100283211 | 3300005353 | Bacteria | 1329 |
| 46 | Ga0070669_100611605 | 3300005353 | Bacteria | 914 |
| 47 | Ga0070675_100000705 | 3300005354 | Bacteria | 23206 |
| 48 | Ga0070671_100006437 | 3300005355 | Bacteria | 9384 |
| 49 | Ga0070674_100001989 | 3300005356 | Bacteria | 11192 |
| 50 | Ga0070674_100154280 | 3300005356 | Bacteria | 1736 |
| 51 | Ga0070674_102154740 | 3300005356 | Bacteria | 509 |
| 52 | Ga0070673_100014074 | 3300005364 | Bacteria | 5557 |
| 53 | Ga0070659_100000697 | 3300005366 | Bacteria | 24441 |
| 54 | Ga0070667_100152675 | 3300005367 | Bacteria | 2029 |
| 55 | Ga0070667_100581315 | 3300005367 | Bacteria | 1031 |
| 56 | Ga0070701_10172997 | 3300005438 | Bacteria | 1259 |
| 57 | Ga0070663_100000289 | 3300005455 | Bacteria | 25666 |
| 58 | Ga0070663_100595585 | 3300005455 | Bacteria | 929 |
| 59 | Ga0070678_100005858 | 3300005456 | Bacteria | 7149 |
| 60 | Ga0070678_100408116 | 3300005456 | Bacteria | 1182 |
| 61 | Ga0070678_100729463 | 3300005456 | Bacteria | 895 |
| 62 | Ga0070678_101867712 | 3300005456 | Bacteria | 567 |
| 63 | Ga0068867_100003695 | 3300005459 | Bacteria | 10764 |
| 64 | Ga0068867_100572991 | 3300005459 | Bacteria | 981 |
| 65 | Ga0068867_100590354 | 3300005459 | Bacteria | 967 |
| 66 | Ga0070679_100170005 | 3300005530 | Bacteria | 2153 |
| 67 | Ga0070696_100368106 | 3300005546 | Bacteria | 1117 |
| 68 | Ga0070665_100114839 | 3300005548 | Bacteria | 2695 |
| 69 | Ga0070665_100997812 | 3300005548 | Bacteria | 849 |
| 70 | Ga0070704_100221356 | 3300005549 | Bacteria | 1539 |
| 71 | Ga0070664_100067450 | 3300005564 | Bacteria | 3058 |
| 72 | Ga0070664_100561589 | 3300005564 | Bacteria | 1056 |
| 73 | Ga0068864_100190388 | 3300005618 | Bacteria | 1880 |
| 74 | Ga0068866_10370926 | 3300005718 | Bacteria | 915 |
| 75 | Ga0068851_10263009 | 3300005834 | Bacteria | 982 |
| 76 | Ga0068870_10121050 | 3300005840 | Bacteria | 1508 |
| 77 | Ga0075368_10036069 | 3300006042 | Bacteria | 1931 |
| 78 | Ga0075363_100414612 | 3300006048 | Bacteria | 792 |
| 79 | Ga0075364_10260865 | 3300006051 | Bacteria | 1178 |
| 80 | Ga0075364_10444776 | 3300006051 | Bacteria | 885 |
| 81 | Ga0075362_10012577 | 3300006177 | Bacteria | 3365 |
| 82 | Ga0075367_10205983 | 3300006178 | Bacteria | 1229 |
| 83 | Ga0075369_10024462 | 3300006186 | Bacteria | 2503 |
| 84 | Ga0075366_10021910 | 3300006195 | Bacteria | 3715 |
| 85 | Ga0097621_100092319 | 3300006237 | Bacteria | 2535 |
| 86 | Ga0097621_101130468 | 3300006237 | Bacteria | 736 |
| 87 | Ga0075370_10055016 | 3300006353 | Bacteria | 2261 |
| 88 | Ga0075370_10159158 | 3300006353 | Bacteria | 1325 |
| 89 | Ga0068871_100075709 | 3300006358 | Bacteria | 2779 |
| 90 | Ga0075430_100202313 | 3300006846 | Bacteria | 1649 |
| 91 | Ga0075431_100018750 | 3300006847 | Bacteria | 7049 |
| 92 | Ga0075429_100000294 | 3300006880 | Bacteria | 35361 |
| 93 | Ga0075429_100020879 | 3300006880 | Bacteria | 5683 |
| 94 | Ga0068865_101291042 | 3300006881 | Bacteria | 649 |
| 95 | Ga0075436_100569324 | 3300006914 | Bacteria | 833 |
| 96 | Ga0105251_10001210 | 3300009011 | Bacteria | 22309 |
| 97 | Ga0105244_10128297 | 3300009036 | Bacteria | 1225 |
| 98 | Ga0105240_10069966 | 3300009093 | Bacteria | 4343 |
| 99 | Ga0105240_10095788 | 3300009093 | Bacteria | 3618 |
| 100 | Ga0105240_10096638 | 3300009093 | Bacteria | 3600 |
| 101 | Ga0114129_11225266 | 3300009147 | Bacteria | 933 |
| 102 | Ga0105242_10000656 | 3300009176 | Bacteria | 27099 |
| 103 | Ga0105248_10037595 | 3300009177 | Bacteria | 5416 |
| 104 | Ga0105248_11060135 | 3300009177 | Bacteria | 916 |
| 105 | Ga0105237_10079024 | 3300009545 | Bacteria | 3279 |
| 106 | Ga0105238_10169272 | 3300009551 | Bacteria | 2161 |
| 107 | Ga0105238_10283723 | 3300009551 | Bacteria | 1638 |
| 108 | Ga0105239_10008632 | 3300010375 | Bacteria | 11551 |
| 109 | Ga0105239_10418444 | 3300010375 | Bacteria | 1518 |
| 110 | Ga0105246_11177647 | 3300011119 | Bacteria | 704 |
| 111 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 112 | Ga0157370_10455738 | 3300013104 | Bacteria | 1176 |
| 113 | Ga0157369_10218107 | 3300013105 | Bacteria | 1998 |
| 114 | Ga0157369_11572772 | 3300013105 | Bacteria | 669 |
| 115 | Ga0157369_11983714 | 3300013105 | Bacteria | 591 |
| 116 | Ga0163162_11324280 | 3300013306 | Bacteria | 818 |
| 117 | Ga0157375_10061759 | 3300013308 | Bacteria | 3722 |
| 118 | Ga0157375_10315722 | 3300013308 | Bacteria | 1727 |
| 119 | Ga0163163_10069193 | 3300014325 | Bacteria | 3514 |
| 120 | Ga0157380_10419371 | 3300014326 | Bacteria | 1276 |
| 121 | Ga0157380_12131862 | 3300014326 | Bacteria | 624 |
| 122 | Ga0182008_10015292 | 3300014497 | Bacteria | 4006 |
| 123 | Ga0182008_10020248 | 3300014497 | Bacteria | 3428 |
| 124 | Ga0157376_10106764 | 3300014969 | Bacteria | 2457 |
| 125 | Ga0182006_1085684 | 3300015261 | Bacteria | 1142 |
| 126 | Ga0182006_1109467 | 3300015261 | Bacteria | 971 |
| 127 | Ga0182007_10002268 | 3300015262 | Bacteria | 9691 |
| 128 | Ga0182007_10006994 | 3300015262 | Bacteria | 4786 |
| 129 | Ga0182005_1032789 | 3300015265 | Bacteria | 1414 |
| 130 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 131 | Ga0183361_10009 | 3300016635 | Bacteria | 205218 |
| 132 | Ga0163161_10086155 | 3300017792 | Bacteria | 2318 |
| 133 | Ga0213872_10000147 | 3300021361 | Bacteria | 64440 |
| 134 | Ga0213872_10000232 | 3300021361 | Bacteria | 49039 |
| 135 | Ga0213872_10109261 | 3300021361 | Bacteria | 1229 |
| 136 | Ga0209435_100015 | 3300025206 | Bacteria | 321177 |
| 137 | Ga0209435_100443 | 3300025206 | Bacteria | 8417 |
| 138 | Ga0209435_102903 | 3300025206 | Bacteria | 1977 |
| 139 | Ga0209566_100843 | 3300025225 | Bacteria | 15333 |
| 140 | Ga0209674_101439 | 3300025226 | Bacteria | 6306 |
| 141 | Ga0209674_116364 | 3300025226 | Bacteria | 620 |
| 142 | Ga0209672_100033 | 3300025228 | Bacteria | 315326 |
| 143 | Ga0209672_100034 | 3300025228 | Bacteria | 304973 |
| 144 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 145 | Ga0209147_100089 | 3300025229 | Bacteria | 178350 |
| 146 | Ga0209147_100628 | 3300025229 | Bacteria | 19033 |
| 147 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 148 | Ga0207427_100718 | 3300025231 | Bacteria | 15457 |
| 149 | Ga0209258_100023 | 3300025242 | Bacteria | 547286 |
| 150 | Ga0209258_100242 | 3300025242 | Bacteria | 100588 |
| 151 | Ga0209258_100523 | 3300025242 | Bacteria | 36787 |
| 152 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 153 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 154 | Ga0209026_1000034 | 3300025250 | Bacteria | 306953 |
| 155 | Ga0209026_1001823 | 3300025250 | Bacteria | 8753 |
| 156 | Ga0209148_1000029 | 3300025254 | Bacteria | 579199 |
| 157 | Ga0209148_1003502 | 3300025254 | Bacteria | 4302 |
| 158 | Ga0209148_1012762 | 3300025254 | Bacteria | 1528 |
| 159 | Ga0209759_1000049 | 3300025256 | Bacteria | 221692 |
| 160 | Ga0209759_1000656 | 3300025256 | Bacteria | 32085 |
| 161 | Ga0209455_1000123 | 3300025272 | Bacteria | 167231 |
| 162 | Ga0209673_1000075 | 3300025273 | Bacteria | 232555 |
| 163 | Ga0209130_1026653 | 3300025284 | Bacteria | 1237 |
| 164 | Ga0209675_1035364 | 3300025291 | Bacteria | 1140 |
| 165 | Ga0209676_1001036 | 3300025292 | Bacteria | 32214 |
| 166 | Ga0209025_1004201 | 3300025294 | Bacteria | 12707 |
| 167 | Ga0209564_1014545 | 3300025295 | Bacteria | 3267 |
| 168 | Ga0209564_1035084 | 3300025295 | Bacteria | 1458 |
| 169 | Ga0209050_1064264 | 3300025298 | Bacteria | 851 |
| 170 | Ga0207426_1000326 | 3300025302 | Bacteria | 91021 |
| 171 | Ga0207426_1006086 | 3300025302 | Bacteria | 5321 |
| 172 | Ga0209051_1005682 | 3300025303 | Bacteria | 7207 |
| 173 | Ga0209257_1016007 | 3300025304 | Bacteria | 3065 |
| 174 | Ga0209257_1016909 | 3300025304 | Bacteria | 2909 |
| 175 | Ga0207697_10079401 | 3300025315 | Bacteria | 1382 |
| 176 | Ga0207656_10059814 | 3300025321 | Bacteria | 1669 |
| 177 | Ga0207696_1053246 | 3300025711 | Bacteria | 1152 |
| 178 | Ga0207713_1003216 | 3300025735 | Bacteria | 11274 |
| 179 | Ga0207682_10004972 | 3300025893 | Bacteria | 5458 |
| 180 | Ga0207688_10052635 | 3300025901 | Bacteria | 2282 |
| 181 | Ga0207680_10161009 | 3300025903 | Bacteria | 1505 |
| 182 | Ga0207647_10003550 | 3300025904 | Bacteria | 11705 |
| 183 | Ga0207647_10063243 | 3300025904 | Bacteria | 2251 |
| 184 | Ga0207645_10210231 | 3300025907 | Bacteria | 1281 |
| 185 | Ga0207705_10080115 | 3300025909 | Bacteria | 2379 |
| 186 | Ga0207695_10002948 | 3300025913 | Bacteria | 24555 |
| 187 | Ga0207695_10018474 | 3300025913 | Bacteria | 8062 |
| 188 | Ga0207695_10083561 | 3300025913 | Bacteria | 3225 |
| 189 | Ga0207695_10313487 | 3300025913 | Bacteria | 1459 |
| 190 | Ga0207671_10028629 | 3300025914 | Bacteria | 4162 |
| 191 | Ga0207662_10120016 | 3300025918 | Bacteria | 1648 |
| 192 | Ga0207657_10000098 | 3300025919 | Bacteria | 83552 |
| 193 | Ga0207657_10366743 | 3300025919 | Bacteria | 1135 |
| 194 | Ga0207646_10614104 | 3300025922 | Bacteria | 975 |
| 195 | Ga0207681_10384804 | 3300025923 | Bacteria | 1130 |
| 196 | Ga0207694_10386482 | 3300025924 | Bacteria | 1162 |
| 197 | Ga0207650_10002051 | 3300025925 | Bacteria | 14094 |
| 198 | Ga0207650_10073515 | 3300025925 | Bacteria | 2575 |
| 199 | Ga0207659_10005314 | 3300025926 | Bacteria | 7806 |
| 200 | Ga0207659_10735814 | 3300025926 | Bacteria | 845 |
| 201 | Ga0207644_10001988 | 3300025931 | Bacteria | 13223 |
| 202 | Ga0207690_10000055 | 3300025932 | Bacteria | 102536 |
| 203 | Ga0207709_10005490 | 3300025935 | Bacteria | 7198 |
| 204 | Ga0207709_10033765 | 3300025935 | Bacteria | 3008 |
| 205 | Ga0207670_10391012 | 3300025936 | Bacteria | 1110 |
| 206 | Ga0207691_10000361 | 3300025940 | Bacteria | 45833 |
| 207 | Ga0207691_10046489 | 3300025940 | Bacteria | 3989 |
| 208 | Ga0207691_10531794 | 3300025940 | Bacteria | 997 |
| 209 | Ga0207711_10248049 | 3300025941 | Bacteria | 1634 |
| 210 | Ga0207711_10664146 | 3300025941 | Bacteria | 972 |
| 211 | Ga0207711_11145057 | 3300025941 | Bacteria | 719 |
| 212 | Ga0207689_10832452 | 3300025942 | Bacteria | 779 |
| 213 | Ga0207679_10040210 | 3300025945 | Bacteria | 3346 |
| 214 | Ga0207679_10504436 | 3300025945 | Bacteria | 1080 |
| 215 | Ga0207651_10039281 | 3300025960 | Bacteria | 3119 |
| 216 | Ga0207651_10372707 | 3300025960 | Bacteria | 1208 |
| 217 | Ga0207668_10065332 | 3300025972 | Bacteria | 2575 |
| 218 | Ga0207658_10000319 | 3300025986 | Bacteria | 48401 |
| 219 | Ga0207658_10098944 | 3300025986 | Bacteria | 2280 |
| 220 | Ga0207677_10005131 | 3300026023 | Bacteria | 7088 |
| 221 | Ga0207677_10028107 | 3300026023 | Bacteria | 3552 |
| 222 | Ga0207703_10331552 | 3300026035 | Bacteria | 1396 |
| 223 | Ga0207678_10002325 | 3300026067 | Bacteria | 17226 |
| 224 | Ga0207678_10445964 | 3300026067 | Bacteria | 1124 |
| 225 | Ga0207702_10485699 | 3300026078 | Bacteria | 1202 |
| 226 | Ga0207641_10522938 | 3300026088 | Bacteria | 1154 |
| 227 | Ga0207648_10007787 | 3300026089 | Bacteria | 10457 |
| 228 | Ga0207648_11331613 | 3300026089 | Bacteria | 675 |
| 229 | Ga0207674_10138110 | 3300026116 | Bacteria | 2398 |
| 230 | Ga0207683_10253689 | 3300026121 | Bacteria | 1605 |
| 231 | Ga0207683_10585374 | 3300026121 | Bacteria | 1032 |
| 232 | Ga0207683_12046828 | 3300026121 | Bacteria | 521 |
| 233 | Ga0207698_10015048 | 3300026142 | Bacteria | 5168 |
| 234 | Ga0207698_10474589 | 3300026142 | Bacteria | 1212 |
| 235 | Ga0209371_1000676 | 3300027312 | Bacteria | 29463 |
| 236 | Ga0209969_1021074 | 3300027360 | Bacteria | 972 |
| 237 | Ga0209984_1002498 | 3300027424 | Bacteria | 2059 |
| 238 | Ga0209970_1000679 | 3300027614 | Bacteria | 5887 |
| 239 | Ga0209971_1009117 | 3300027682 | Bacteria | 2353 |
| 240 | Ga0307515_10000152 | 3300028794 | Bacteria | 167305 |
| 241 | Ga0265324_10065087 | 3300029957 | Bacteria | 1244 |
| 242 | Ga0268256_1004071 | 3300030500 | Bacteria | 6261 |
| 243 | Ga0265331_10009839 | 3300031250 | Bacteria | 5329 |
| 244 | Ga0265327_10000144 | 3300031251 | Bacteria | 156779 |
| 245 | Ga0265327_10005755 | 3300031251 | Bacteria | 10210 |
| 246 | Ga0265327_10028374 | 3300031251 | Bacteria | 3204 |
| 247 | Ga0265327_10049683 | 3300031251 | Bacteria | 2199 |
| 248 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 249 | Ga0307408_100140697 | 3300031548 | Bacteria | 1894 |
| 250 | Ga0307408_100158087 | 3300031548 | Bacteria | 1797 |
| 251 | Ga0307408_100387198 | 3300031548 | Bacteria | 1197 |
| 252 | Ga0316575_10062853 | 3300031665 | Bacteria | 1485 |
| 253 | Ga0307516_10094111 | 3300031730 | Bacteria | 2821 |
| 254 | Ga0307516_10449662 | 3300031730 | Bacteria | 945 |
| 255 | Ga0307405_10012250 | 3300031731 | Bacteria | 4531 |
| 256 | Ga0307405_10234871 | 3300031731 | Bacteria | 1354 |
| 257 | Ga0307413_10653376 | 3300031824 | Bacteria | 868 |
| 258 | Ga0307410_10089256 | 3300031852 | Bacteria | 2184 |
| 259 | Ga0307406_10353794 | 3300031901 | Bacteria | 1149 |
| 260 | Ga0307412_10287940 | 3300031911 | Bacteria | 1293 |
| 261 | Ga0307416_100085777 | 3300032002 | Bacteria | 2681 |
| 262 | Ga0307416_101337452 | 3300032002 | Bacteria | 822 |
| 263 | Ga0307411_10030605 | 3300032005 | Bacteria | 3301 |
| 264 | Ga0307411_10462404 | 3300032005 | Bacteria | 1064 |
| 265 | Ga0307411_10719569 | 3300032005 | Bacteria | 871 |
| 266 | Ga0316574_0339027 | 3300035398 | Bacteria | 953 |
| 267 | Ga0395899_0000054 | 3300037312 | Bacteria | 220952 |
| 268 | Ga0395899_0005159 | 3300037312 | Bacteria | 10160 |
| 269 | Ga0395900_0000220 | 3300037418 | Bacteria | 90109 |
| 270 | Ga0395900_0016002 | 3300037418 | Bacteria | 7643 |
| 271 | Ga0395898_0000510 | 3300037466 | Bacteria | 75287 |
| 272 | Ga0395898_0057480 | 3300037466 | Bacteria | 3790 |
| 273 | Ga0395898_1507936 | 3300037466 | Bacteria | 598 |
| 274 | Ga0395905_0007060 | 3300037471 | Bacteria | 11226 |
| 275 | Ga0395905_0024865 | 3300037471 | Bacteria | 5651 |
| 276 | Ga0395905_0198592 | 3300037471 | Bacteria | 1880 |
| 277 | Ga0395905_0329011 | 3300037471 | Bacteria | 1418 |
| 278 | Ga0395905_0516901 | 3300037471 | Bacteria | 1094 |
| 279 | Ga0395901_0002022 | 3300038443 | Bacteria | 20858 |
| 280 | Ga0395901_0006544 | 3300038443 | Bacteria | 11783 |
| 281 | Ga0395901_0229644 | 3300038443 | Bacteria | 1938 |
| 282 | Ga0436365_1170741 | 3300039437 | Bacteria | 1213 |
| 283 | Ga0436361_0061503 | 3300039447 | Bacteria | 127805 |
| 284 | Ga0436361_0292464 | 3300039447 | Bacteria | 1226 |
| 285 | Ga0436361_0481389 | 3300039447 | Bacteria | 1261 |
| 286 | Ga0436361_0777699 | 3300039447 | Bacteria | 723 |
| 287 | Ga0436361_0848343 | 3300039447 | Bacteria | 176869 |
| 288 | Ga0451793_0387167 | 3300041452 | Bacteria | 757 |
| 289 | Ga0451795_0239490 | 3300041456 | Bacteria | 596 |
| 290 | Ga0451798_0112165 | 3300041458 | Bacteria | 714 |
| 291 | Ga0451837_0266051 | 3300041494 | Bacteria | 683 |
| 292 | Ga0451847_0818075 | 3300041503 | Bacteria | 590 |
| 293 | Ga0439431_0067820 | 3300041997 | Bacteria | 947 |
| 294 | Ga0439432_007117 | 3300042006 | Bacteria | 3974 |
| 295 | Ga0439449_0002109 | 3300042007 | Bacteria | 7806 |
| 296 | Ga0439449_0007819 | 3300042007 | Bacteria | 4060 |
| 297 | Ga0439452_014679 | 3300042010 | Bacteria | 2168 |
| 298 | Ga0439457_008633 | 3300042014 | Bacteria | 2395 |
| 299 | Ga0450911_000542 | 3300042115 | Bacteria | 11763 |
| 300 | Ga0450914_049551 | 3300042118 | Bacteria | 550 |
| 301 | Ga0450921_014837 | 3300042123 | Bacteria | 695 |
| 302 | Ga0450897_000200 | 3300042128 | Bacteria | 2984 |
| 303 | Ga0450894_003837 | 3300042131 | Bacteria | 1965 |
| 304 | Ga0450895_012740 | 3300042132 | Bacteria | 734 |
| 305 | Ga0450899_002285 | 3300042135 | Bacteria | 2086 |
| 306 | Ga0450899_039162 | 3300042135 | Bacteria | 590 |
| 307 | Ga0450908_021483 | 3300042184 | Bacteria | 1132 |
| 308 | Ga0450909_005365 | 3300042185 | Bacteria | 1844 |
| 309 | Ga0439434_0004361 | 3300042435 | Bacteria | 4136 |
| 310 | Ga0439434_0021460 | 3300042435 | Bacteria | 1940 |
| 311 | Ga0439464_0078516 | 3300042439 | Bacteria | 983 |
| 312 | Ga0451577_0000142 | 3300042876 | Bacteria | 160598 |
| 313 | Ga0451577_0000879 | 3300042876 | Bacteria | 44584 |
| 314 | Ga0451577_0003831 | 3300042876 | Bacteria | 16362 |
| 315 | Ga0451577_1033168 | 3300042876 | Bacteria | 737 |
| 316 | Ga0466969_0029637 | 3300044656 | Bacteria | 2793 |
| 317 | Ga0466969_0037105 | 3300044656 | Bacteria | 2460 |
| 318 | Ga0466972_0000111 | 3300044658 | Bacteria | 70764 |
| 319 | Ga0453683_0013236 | 3300044673 | Bacteria | 5392 |
| 320 | Ga0466965_0000099 | 3300044683 | Bacteria | 25415 |
| 321 | Ga0466965_0004051 | 3300044683 | Bacteria | 6502 |
| 322 | Ga0466965_0120408 | 3300044683 | Bacteria | 1355 |
| 323 | Ga0466966_0000087 | 3300044684 | Bacteria | 57881 |
| 324 | Ga0466966_0001623 | 3300044684 | Bacteria | 14487 |
| 325 | Ga0466966_0892031 | 3300044684 | Bacteria | 536 |
| 326 | Ga0466961_0000724 | 3300044693 | Bacteria | 20747 |
| 327 | Ga0466961_0022051 | 3300044693 | Bacteria | 4098 |
| 328 | Ga0466963_0036933 | 3300044694 | Bacteria | 3188 |
| 329 | Ga0466963_0266552 | 3300044694 | Bacteria | 1203 |
| 330 | Ga0466964_0000850 | 3300044706 | Bacteria | 10013 |
| 331 | Ga0466964_0015718 | 3300044706 | Bacteria | 2881 |
| 332 | Ga0453684_0000126 | 3300044712 | Bacteria | 336395 |
| 333 | Ga0466971_0079058 | 3300044719 | Bacteria | 1499 |
| 334 | Ga0466968_0026539 | 3300044735 | Bacteria | 2378 |
| 335 | Ga0466968_0087190 | 3300044735 | Bacteria | 1378 |
| 336 | Ga0466968_0169681 | 3300044735 | Bacteria | 1010 |
| 337 | Ga0466968_0422769 | 3300044735 | Bacteria | 656 |
| 338 | Ga0466970_0035821 | 3300044765 | Bacteria | 2628 |
| 339 | Ga0466957_0025046 | 3300044842 | Bacteria | 3534 |
| 340 | Ga0466959_0006559 | 3300045049 | Bacteria | 8075 |
| 341 | Ga0466959_0017642 | 3300045049 | Bacteria | 5234 |
| 342 | Ga0451576_0023432 | 3300045051 | Bacteria | 6683 |
| 343 | Ga0466958_0006352 | 3300045836 | Bacteria | 6426 |
| 344 | Ga0466958_0021076 | 3300045836 | Bacteria | 3804 |
| 345 | Ga0495592_0042768 | 3300046454 | Bacteria | 3392 |
| 346 | Ga0495592_0438802 | 3300046454 | Bacteria | 820 |
| 347 | Ga0495590_0000630 | 3300046457 | Bacteria | 16380 |
| 348 | Ga0495651_0101433 | 3300046462 | Bacteria | 2142 |
| 349 | Ga0495651_0396110 | 3300046462 | Bacteria | 902 |
| 350 | Ga0495653_0003931 | 3300046463 | Bacteria | 12016 |
| 351 | Ga0495653_0179559 | 3300046463 | Bacteria | 1454 |
| 352 | Ga0495653_0274026 | 3300046463 | Bacteria | 1110 |
| 353 | Ga0495650_0126883 | 3300046471 | Bacteria | 934 |
| 354 | Ga0495580_0911067 | 3300046472 | Bacteria | 564 |
| 355 | Ga0495582_0521925 | 3300046473 | Bacteria | 687 |
| 356 | Ga0495605_0393043 | 3300046474 | Bacteria | 577 |
| 357 | Ga0495664_0060226 | 3300046477 | Bacteria | 2260 |
| 358 | Ga0495584_0037588 | 3300046491 | Bacteria | 2447 |
| 359 | Ga0495585_0007791 | 3300046492 | Bacteria | 6525 |
| 360 | Ga0495596_0112653 | 3300046500 | Bacteria | 1056 |
| 361 | Ga0495583_0003698 | 3300046506 | Bacteria | 11378 |
| 362 | Ga0495616_0049273 | 3300046513 | Bacteria | 2112 |
| 363 | Ga0495618_0182184 | 3300046514 | Bacteria | 1334 |
| 364 | Ga0495620_0018493 | 3300046515 | Bacteria | 3450 |
| 365 | Ga0495620_0264397 | 3300046515 | Bacteria | 655 |
| 366 | Ga0495628_0008227 | 3300046516 | Bacteria | 8971 |
| 367 | Ga0495628_0018646 | 3300046516 | Bacteria | 5743 |
| 368 | Ga0495628_0072664 | 3300046516 | Bacteria | 2680 |
| 369 | Ga0495630_0378752 | 3300046517 | Bacteria | 1084 |
| 370 | Ga0495631_0057978 | 3300046518 | Bacteria | 1684 |
| 371 | Ga0495632_0153200 | 3300046519 | Bacteria | 1065 |
| 372 | Ga0495643_0010464 | 3300046522 | Bacteria | 5709 |
| 373 | Ga0495642_0030532 | 3300046528 | Bacteria | 2156 |
| 374 | Ga0495652_0013479 | 3300046529 | Bacteria | 7358 |
| 375 | Ga0495652_0071319 | 3300046529 | Bacteria | 2900 |
| 376 | Ga0495652_0126467 | 3300046529 | Bacteria | 2030 |
| 377 | Ga0495654_0169692 | 3300046530 | Bacteria | 952 |
| 378 | Ga0495654_0404347 | 3300046530 | Bacteria | 542 |
| 379 | Ga0495586_0100845 | 3300046535 | Bacteria | 1602 |
| 380 | Ga0495609_0005408 | 3300046538 | Bacteria | 6719 |
| 381 | Ga0495597_0005314 | 3300046542 | Bacteria | 6829 |
| 382 | Ga0495597_0007513 | 3300046542 | Bacteria | 5527 |
| 383 | Ga0495645_0017116 | 3300046543 | Bacteria | 5192 |
| 384 | Ga0495633_0006804 | 3300046558 | Bacteria | 6702 |
| 385 | Ga0495667_0135696 | 3300046559 | Bacteria | 1586 |
| 386 | Ga0495634_0152637 | 3300046642 | Bacteria | 1460 |
| 387 | Ga0495611_0206269 | 3300046648 | Bacteria | 916 |
| 388 | Ga0495635_0111045 | 3300046663 | Bacteria | 1873 |
| 389 | Ga0495635_0375383 | 3300046663 | Bacteria | 947 |
| 390 | Ga0495661_0037408 | 3300046665 | Bacteria | 3030 |
| 391 | Ga0495599_0004516 | 3300046678 | Bacteria | 8251 |
| 392 | Ga0495623_0024279 | 3300046679 | Bacteria | 3907 |
| 393 | Ga0495646_0001683 | 3300046680 | Bacteria | 13232 |
| 394 | Ga0495646_0166690 | 3300046680 | Bacteria | 1216 |
| 395 | Ga0495669_0408131 | 3300046684 | Bacteria | 658 |
| 396 | Ga0495624_0094865 | 3300046690 | Bacteria | 1839 |
| 397 | Ga0495624_0121941 | 3300046690 | Bacteria | 1600 |
| 398 | Ga0495649_0021009 | 3300046694 | Bacteria | 3660 |
| 399 | Ga0495589_0031647 | 3300046794 | Bacteria | 2662 |
| 400 | Ga0495589_0451914 | 3300046794 | Bacteria | 588 |
| 401 | Ga0495600_0001160 | 3300046809 | Bacteria | 14378 |
| 402 | Ga0495604_0003928 | 3300047317 | Bacteria | 11841 |
| 403 | Ga0495604_0138900 | 3300047317 | Bacteria | 1738 |
| 404 | Ga0495604_0142882 | 3300047317 | Bacteria | 1708 |
| 405 | Ga0495674_0374312 | 3300047319 | Bacteria | 1153 |
| 406 | Ga0495674_0886187 | 3300047319 | Bacteria | 689 |
| 407 | Ga0495672_0108737 | 3300047320 | Bacteria | 1491 |
| 408 | Ga0495680_0135838 | 3300047322 | Bacteria | 1803 |
| 409 | Ga0495683_0001407 | 3300047323 | Bacteria | 15868 |
| 410 | Ga0495683_0038828 | 3300047323 | Bacteria | 2408 |
| 411 | Ga0495683_0118914 | 3300047323 | Bacteria | 1255 |
| 412 | Ga0495687_000169 | 3300047443 | Bacteria | 97243 |
| 413 | Ga0495687_028428 | 3300047443 | Bacteria | 2601 |
| 414 | Ga0495687_037500 | 3300047443 | Bacteria | 2158 |
| 415 | Ga0495675_0537110 | 3300047444 | Bacteria | 668 |
| 416 | Ga0495686_0000002 | 3300047472 | Bacteria | 1050777 |
| 417 | Ga0495686_0046812 | 3300047472 | Bacteria | 2733 |
| 418 | Ga0495686_0350164 | 3300047472 | Bacteria | 803 |
| 419 | Ga0495593_0124416 | 3300047673 | Bacteria | 1311 |
| 420 | Ga0495602_0016723 | 3300048088 | Bacteria | 7368 |
| 421 | Ga0495602_0064434 | 3300048088 | Bacteria | 3168 |
| 422 | Ga0495602_0234091 | 3300048088 | Bacteria | 1378 |
| 423 | Ga0496100_0043465 | 3300048903 | Bacteria | 2873 |
| 424 | Ga0496101_0014626 | 3300048904 | Bacteria | 5277 |
| 425 | Ga0496102_0001320 | 3300048905 | Bacteria | 22249 |
| 426 | Ga0496103_0007295 | 3300048906 | Bacteria | 6589 |
| 427 | Ga0496104_0900794 | 3300048907 | Bacteria | 789 |
| 428 | Ga0496106_0017418 | 3300048909 | Bacteria | 5316 |
| 429 | Ga0496107_0010544 | 3300048910 | Bacteria | 6424 |
| 430 | Ga0496109_0427176 | 3300048912 | Bacteria | 1252 |
| 431 | Ga0496110_0029250 | 3300048913 | Bacteria | 4740 |
| 432 | Ga0496110_0225286 | 3300048913 | Bacteria | 1705 |
| 433 | Ga0496111_0840342 | 3300048914 | Bacteria | 663 |
| 434 | Ga0496112_0387745 | 3300048915 | Bacteria | 1337 |
| 435 | Ga0496113_0017346 | 3300048916 | Bacteria | 4995 |
| 436 | Ga0496114_0413596 | 3300048917 | Bacteria | 1194 |
| 437 | Ga0496116_0012240 | 3300048919 | Bacteria | 7016 |
| 438 | Ga0496116_0025650 | 3300048919 | Bacteria | 4329 |
| 439 | Ga0496116_0056147 | 3300048919 | Bacteria | 2583 |
| 440 | Ga0496116_0083790 | 3300048919 | Bacteria | 1966 |
| 441 | Ga0496117_0109676 | 3300048920 | Bacteria | 1722 |
| 442 | Ga0496117_0157305 | 3300048920 | Bacteria | 1336 |
| 443 | Ga0496117_0391254 | 3300048920 | Bacteria | 705 |
| 444 | Ga0496118_0041267 | 3300048921 | Bacteria | 3656 |
| 445 | Ga0496118_0085353 | 3300048921 | Bacteria | 2199 |
| 446 | Ga0496118_0107942 | 3300048921 | Bacteria | 1857 |
| 447 | Ga0496119_0150913 | 3300048922 | Bacteria | 1245 |
| 448 | Ga0496119_0202098 | 3300048922 | Bacteria | 1028 |
| 449 | Ga0496121_0026672 | 3300048924 | Bacteria | 5432 |
| 450 | Ga0496121_0055225 | 3300048924 | Bacteria | 3311 |
| 451 | Ga0496121_0095542 | 3300048924 | Bacteria | 2309 |
| 452 | Ga0496121_0149288 | 3300048924 | Bacteria | 1722 |
| 453 | Ga0496121_0155932 | 3300048924 | Bacteria | 1675 |
| 454 | Ga0496121_0376782 | 3300048924 | Bacteria | 937 |
| 455 | Ga0496121_0388081 | 3300048924 | Bacteria | 919 |
| 456 | Ga0496122_0007506 | 3300048925 | Bacteria | 12093 |
| 457 | Ga0496122_0016989 | 3300048925 | Bacteria | 6834 |
| 458 | Ga0496122_0201623 | 3300048925 | Bacteria | 1163 |
| 459 | Ga0496123_0013377 | 3300048926 | Bacteria | 6896 |
| 460 | Ga0496123_0164858 | 3300048926 | Bacteria | 1177 |
| 461 | Ga0496123_0316224 | 3300048926 | Bacteria | 739 |
| 462 | Ga0496124_0016661 | 3300048927 | Bacteria | 6973 |
| 463 | Ga0496124_0147198 | 3300048927 | Bacteria | 1852 |
| 464 | Ga0496124_0151704 | 3300048927 | Bacteria | 1817 |
| 465 | Ga0496124_0216033 | 3300048927 | Bacteria | 1446 |
| 466 | Ga0496124_0220722 | 3300048927 | Bacteria | 1426 |
| 467 | Ga0496125_0001986 | 3300048928 | Bacteria | 27786 |
| 468 | Ga0496125_0005041 | 3300048928 | Bacteria | 14902 |
| 469 | Ga0496125_0009210 | 3300048928 | Bacteria | 10201 |
| 470 | Ga0496125_0017768 | 3300048928 | Bacteria | 6769 |
| 471 | Ga0496125_0034310 | 3300048928 | Bacteria | 4475 |
| 472 | Ga0496125_0041736 | 3300048928 | Bacteria | 3918 |
| 473 | Ga0496125_0291771 | 3300048928 | Bacteria | 1004 |
| 474 | Ga0496126_0053155 | 3300048929 | Bacteria | 3677 |
| 475 | Ga0496126_0096964 | 3300048929 | Bacteria | 2585 |
| 476 | Ga0496126_0474798 | 3300048929 | Bacteria | 1003 |
| 477 | Ga0496126_0503168 | 3300048929 | Bacteria | 968 |
| 478 | Ga0496126_0722132 | 3300048929 | Bacteria | 772 |
| 479 | Ga0496126_0815518 | 3300048929 | Bacteria | 715 |
| 480 | Ga0495678_135378 | 3300049459 | Bacteria | 812 |
| 481 | Ga0501034_0094658 | 3300049571 | Bacteria | 2984 |
| 482 | Ga0501036_1022829 | 3300049572 | Bacteria | 676 |
| 483 | Ga0501075_0224535 | 3300049591 | Bacteria | 1433 |
| 484 | Ga0501076_0130489 | 3300049592 | Bacteria | 2038 |
| 485 | Ga0501235_116457 | 3300049669 | Bacteria | 665 |
| 486 | Ga0501266_005385 | 3300049763 | Bacteria | 1592 |
| 487 | Ga0501035_0025767 | 3300049822 | Bacteria | 5390 |
| 488 | Ga0501044_0012767 | 3300049823 | Bacteria | 9097 |
| 489 | nmdc:mga03683_27162_c1 | 3300050489 | Bacteria | 2264 |
| 490 | nmdc:mga03683_42933_c1 | 3300050489 | Bacteria | 1863 |
| 491 | nmdc:mga03n38_250905_c1 | 3300050490 | Bacteria | 935 |
| 492 | nmdc:mga0yw44_442496_c1 | 3300050492 | Bacteria | 881 |
| 493 | nmdc:mga0yw44_716466_c1 | 3300050492 | Bacteria | 680 |
| 494 | nmdc:mga0k408_46528_c1 | 3300050493 | Bacteria | 2506 |
| 495 | nmdc:mga0k408_5292_c2 | 3300050493 | Bacteria | 3995 |
| 496 | nmdc:mga06z11_526962_c1 | 3300050494 | Bacteria | 717 |
| 497 | nmdc:mga06z11_61447_c1 | 3300050494 | Bacteria | 1959 |
| 498 | nmdc:mga07m45_40490_c1 | 3300050496 | Bacteria | 2607 |
| 499 | nmdc:mga07m45_531332_c1 | 3300050496 | Bacteria | 681 |
| 500 | nmdc:mga07m45_76695_c1 | 3300050496 | Bacteria | 1906 |
| 501 | nmdc:mga05p37_929765_c1 | 3300050507 | Bacteria | 933 |
| 502 | nmdc:mga09592_214556_c1 | 3300050508 | Bacteria | 1668 |
| 503 | nmdc:mga09592_32207_c1 | 3300050508 | Bacteria | 4370 |
| 504 | nmdc:mga0qj67_15201_c1 | 3300050509 | Bacteria | 5825 |
| 505 | nmdc:mga0qj67_194524_c1 | 3300050509 | Bacteria | 1648 |
| 506 | nmdc:mga06r32_26118_c1 | 3300050510 | Bacteria | 5441 |
| 507 | nmdc:mga08x19_112619_c1 | 3300050514 | Bacteria | 1816 |
| 508 | Ga0495601_0005804 | 3300053077 | Bacteria | 7197 |
| 509 | Ga0500578_0044292 | 3300053086 | Bacteria | 2857 |
| 510 | Ga0500643_212325 | 3300053087 | Bacteria | 519 |
| 511 | Ga0500651_0039631 | 3300053093 | Bacteria | 2966 |
| 512 | Ga0500573_0202152 | 3300053140 | Bacteria | 1054 |
| 513 | Ga0500574_000304 | 3300053141 | Bacteria | 6049 |
| 514 | Ga0500619_000795 | 3300053154 | Bacteria | 5389 |
| 515 | Ga0500645_006109 | 3300053730 | Bacteria | 4339 |
| 516 | Ga0466962_0394874 | 3300061719 | Bacteria | 692 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005288 | Ga0065714_10141060 | Ga0065714_101410602 | 147 |
| 2 | 3300005335 | Ga0070666_10164922 | Ga0070666_101649222 | 147 |
| 3 | 3300005353 | Ga0070669_100611605 | Ga0070669_1006116052 | 147 |
| 4 | 3300005356 | Ga0070674_102154740 | Ga0070674_1021547401 | 147 |
| 5 | 3300005456 | Ga0070678_100408116 | Ga0070678_1004081162 | 147 |
| 6 | 3300005459 | Ga0068867_100572991 | Ga0068867_1005729912 | 147 |
| 7 | 3300005548 | Ga0070665_100114839 | Ga0070665_1001148394 | 147 |
| 8 | 3300005618 | Ga0068864_100190388 | Ga0068864_1001903882 | 147 |
| 9 | 3300005718 | Ga0068866_10370926 | Ga0068866_103709262 | 147 |
| 10 | 3300006042 | Ga0075368_10036069 | Ga0075368_100360693 | 147 |
| 11 | 3300006048 | Ga0075363_100414612 | Ga0075363_1004146122 | 147 |
| 12 | 3300006051 | Ga0075364_10260865 | Ga0075364_102608652 | 147 |
| 13 | 3300006051 | Ga0075364_10444776 | Ga0075364_104447762 | 147 |
| 14 | 3300006177 | Ga0075362_10012577 | Ga0075362_100125773 | 147 |
| 15 | 3300006178 | Ga0075367_10205983 | Ga0075367_102059832 | 147 |
| 16 | 3300006186 | Ga0075369_10024462 | Ga0075369_100244623 | 147 |
| 17 | 3300006195 | Ga0075366_10021910 | Ga0075366_100219102 | 147 |
| 18 | 3300006237 | Ga0097621_101130468 | Ga0097621_1011304682 | 147 |
| 19 | 3300006881 | Ga0068865_101291042 | Ga0068865_1012910421 | 147 |
| 20 | 3300006914 | Ga0075436_100569324 | Ga0075436_1005693242 | 147 |
| 21 | 3300009147 | Ga0114129_11225266 | Ga0114129_112252661 | 147 |
| 22 | 3300011119 | Ga0105246_11177647 | Ga0105246_111776472 | 147 |
| 23 | 3300013104 | Ga0157370_10455738 | Ga0157370_104557382 | 147 |
| 24 | 3300013308 | Ga0157375_10315722 | Ga0157375_103157221 | 147 |
| 25 | 3300014325 | Ga0163163_10069193 | Ga0163163_100691932 | 147 |
| 26 | 3300014326 | Ga0157380_10419371 | Ga0157380_104193712 | 147 |
| 27 | 3300014326 | Ga0157380_12131862 | Ga0157380_121318622 | 147 |
| 28 | 3300015261 | Ga0182006_1085684 | Ga0182006_10856841 | 147 |
| 29 | 3300015683 | Ga0183362_10003 | Ga0183362_1000374 | 147 |
| 30 | 3300025292 | Ga0209676_1001036 | Ga0209676_100103631 | 147 |
| 31 | 3300025294 | Ga0209025_1004201 | Ga0209025_100420113 | 147 |
| 32 | 3300025295 | Ga0209564_1035084 | Ga0209564_10350842 | 147 |
| 33 | 3300025298 | Ga0209050_1064264 | Ga0209050_10642642 | 147 |
| 34 | 3300025303 | Ga0209051_1005682 | Ga0209051_10056828 | 147 |
| 35 | 3300025304 | Ga0209257_1016007 | Ga0209257_10160073 | 147 |
| 36 | 3300025304 | Ga0209257_1016909 | Ga0209257_10169094 | 147 |
| 37 | 3300025903 | Ga0207680_10161009 | Ga0207680_101610092 | 147 |
| 38 | 3300025935 | Ga0207709_10005490 | Ga0207709_100054904 | 147 |
| 39 | 3300025941 | Ga0207711_10664146 | Ga0207711_106641461 | 147 |
| 40 | 3300026023 | Ga0207677_10005131 | Ga0207677_100051313 | 147 |
| 41 | 3300026088 | Ga0207641_10522938 | Ga0207641_105229382 | 147 |
| 42 | 3300026121 | Ga0207683_10585374 | Ga0207683_105853742 | 147 |
| 43 | 3300027360 | Ga0209969_1021074 | Ga0209969_10210742 | 147 |
| 44 | 3300027424 | Ga0209984_1002498 | Ga0209984_10024983 | 147 |
| 45 | 3300027614 | Ga0209970_1000679 | Ga0209970_10006794 | 147 |
| 46 | 3300027682 | Ga0209971_1009117 | Ga0209971_10091172 | 147 |
| 47 | 3300028794 | Ga0307515_10000152 | Ga0307515_1000015288 | 147 |
| 48 | 3300031251 | Ga0265327_10005755 | Ga0265327_100057558 | 147 |
| 49 | 3300031456 | Ga0307513_10000004 | Ga0307513_10000004341 | 147 |
| 50 | 3300031548 | Ga0307408_100387198 | Ga0307408_1003871982 | 147 |
| 51 | 3300031730 | Ga0307516_10094111 | Ga0307516_100941114 | 147 |
| 52 | 3300031731 | Ga0307405_10012250 | Ga0307405_100122502 | 147 |
| 53 | 3300031731 | Ga0307405_10234871 | Ga0307405_102348712 | 147 |
| 54 | 3300031901 | Ga0307406_10353794 | Ga0307406_103537942 | 147 |
| 55 | 3300032005 | Ga0307411_10462404 | Ga0307411_104624042 | 147 |
| 56 | 3300041456 | Ga0451795_0239490 | Ga0451795_0239490_38_484 | 147 |
| 57 | 3300041458 | Ga0451798_0112165 | Ga0451798_0112165_183_629 | 147 |
| 58 | 3300041494 | Ga0451837_0266051 | Ga0451837_0266051_204_653 | 147 |
| 59 | 3300041503 | Ga0451847_0818075 | Ga0451847_0818075_51_497 | 147 |
| 60 | 3300041997 | Ga0439431_0067820 | Ga0439431_0067820_450_896 | 147 |
| 61 | 3300042006 | Ga0439432_007117 | Ga0439432_007117_1558_2004 | 147 |
| 62 | 3300042007 | Ga0439449_0002109 | Ga0439449_0002109_2558_3004 | 147 |
| 63 | 3300042007 | Ga0439449_0007819 | Ga0439449_0007819_2075_2521 | 147 |
| 64 | 3300042010 | Ga0439452_014679 | Ga0439452_014679_1154_1600 | 147 |
| 65 | 3300042014 | Ga0439457_008633 | Ga0439457_008633_129_575 | 147 |
| 66 | 3300042115 | Ga0450911_000542 | Ga0450911_000542_9304_9750 | 147 |
| 67 | 3300042118 | Ga0450914_049551 | Ga0450914_049551_44_490 | 147 |
| 68 | 3300042123 | Ga0450921_014837 | Ga0450921_014837_218_664 | 147 |
| 69 | 3300042128 | Ga0450897_000200 | Ga0450897_000200_1643_2089 | 147 |
| 70 | 3300042131 | Ga0450894_003837 | Ga0450894_003837_1363_1809 | 147 |
| 71 | 3300042132 | Ga0450895_012740 | Ga0450895_012740_111_557 | 147 |
| 72 | 3300042135 | Ga0450899_002285 | Ga0450899_002285_922_1368 | 147 |
| 73 | 3300042184 | Ga0450908_021483 | Ga0450908_021483_444_890 | 147 |
| 74 | 3300042185 | Ga0450909_005365 | Ga0450909_005365_1107_1553 | 147 |
| 75 | 3300042435 | Ga0439434_0004361 | Ga0439434_0004361_1142_1588 | 147 |
| 76 | 3300042435 | Ga0439434_0021460 | Ga0439434_0021460_802_1248 | 147 |
| 77 | 3300042876 | Ga0451577_0000142 | Ga0451577_0000142_35388_35837 | 147 |
| 78 | 3300044673 | Ga0453683_0013236 | Ga0453683_0013236_3076_3522 | 147 |
| 79 | 3300044712 | Ga0453684_0000126 | Ga0453684_0000126_211185_211634 | 147 |
| 80 | 3300045051 | Ga0451576_0023432 | Ga0451576_0023432_5516_5962 | 147 |
| 81 | 3300046462 | Ga0495651_0101433 | Ga0495651_0101433_983_1429 | 147 |
| 82 | 3300046558 | Ga0495633_0006804 | Ga0495633_0006804_1935_2384 | 147 |
| 83 | 3300048088 | Ga0495602_0234091 | Ga0495602_0234091_25_471 | 147 |
| 84 | 3300048924 | Ga0496121_0026672 | Ga0496121_0026672_2951_3397 | 147 |
| 85 | 3300048926 | Ga0496123_0316224 | Ga0496123_0316224_233_679 | 147 |
| 86 | 3300048927 | Ga0496124_0216033 | Ga0496124_0216033_809_1255 | 147 |
| 87 | 3300048927 | Ga0496124_0220722 | Ga0496124_0220722_931_1377 | 147 |
| 88 | 3300048928 | Ga0496125_0017768 | Ga0496125_0017768_1405_1851 | 147 |
| 89 | 3300048928 | Ga0496125_0041736 | Ga0496125_0041736_1363_1809 | 147 |
| 90 | 3300048928 | Ga0496125_0291771 | Ga0496125_0291771_489_935 | 147 |
| 91 | 3300048929 | Ga0496126_0503168 | Ga0496126_0503168_450_899 | 147 |
| 92 | 3300049571 | Ga0501034_0094658 | Ga0501034_0094658_1860_2306 | 147 |
| 93 | 3300049572 | Ga0501036_1022829 | Ga0501036_1022829_72_524 | 147 |
| 94 | 3300049591 | Ga0501075_0224535 | Ga0501075_0224535_612_1064 | 147 |
| 95 | 3300049592 | Ga0501076_0130489 | Ga0501076_0130489_218_670 | 147 |
| 96 | 3300049763 | Ga0501266_005385 | Ga0501266_005385_992_1438 | 147 |
| 97 | 3300050489 | nmdc:mga03683_27162_c1 | nmdc:mga03683_27162_c1_382_828 | 147 |
| 98 | 3300050489 | nmdc:mga03683_42933_c1 | nmdc:mga03683_42933_c1_206_652 | 147 |
| 99 | 3300050490 | nmdc:mga03n38_250905_c1 | nmdc:mga03n38_250905_c1_285_731 | 147 |
| 100 | 3300050492 | nmdc:mga0yw44_442496_c1 | nmdc:mga0yw44_442496_c1_120_566 | 147 |
| 101 | 3300050492 | nmdc:mga0yw44_716466_c1 | nmdc:mga0yw44_716466_c1_33_479 | 147 |
| 102 | 3300050494 | nmdc:mga06z11_526962_c1 | nmdc:mga06z11_526962_c1_114_560 | 147 |
| 103 | 3300050496 | nmdc:mga07m45_40490_c1 | nmdc:mga07m45_40490_c1_2091_2537 | 147 |
| 104 | 3300050507 | nmdc:mga05p37_929765_c1 | nmdc:mga05p37_929765_c1_190_636 | 147 |
| 105 | 3300050514 | nmdc:mga08x19_112619_c1 | nmdc:mga08x19_112619_c1_323_769 | 147 |
| 106 | 3300053087 | Ga0500643_212325 | Ga0500643_212325_55_501 | 147 |
| 107 | 3300053093 | Ga0500651_0039631 | Ga0500651_0039631_88_534 | 147 |
| 108 | 3300001989 | JGI24739J22299_10049111 | JGI24739J22299_100491112 | 148 |
| 109 | 3300002067 | JGI24735J21928_10021797 | JGI24735J21928_100217971 | 148 |
| 110 | 3300002737 | JGI25162J39368_1000027 | JGI25162J39368_1000027184 | 148 |
| 111 | 3300002771 | JGI25163J39215_1004601 | JGI25163J39215_10046012 | 148 |
| 112 | 3300003214 | JGI25165J46597_1000031 | JGI25165J46597_1000031102 | 148 |
| 113 | 3300003354 | JGI25160J50197_1000279 | JGI25160J50197_100027912 | 148 |
| 114 | 3300003354 | JGI25160J50197_1026696 | JGI25160J50197_10266962 | 148 |
| 115 | 3300003751 | Ga0055538_1000018 | Ga0055538_1000018102 | 148 |
| 116 | 3300003752 | Ga0055539_1000023 | Ga0055539_1000023102 | 148 |
| 117 | 3300003756 | Ga0055533_1000031 | Ga0055533_1000031192 | 148 |
| 118 | 3300003758 | Ga0055532_1001850 | Ga0055532_10018504 | 148 |
| 119 | 3300003758 | Ga0055532_1002401 | Ga0055532_10024013 | 148 |
| 120 | 3300003758 | Ga0055532_1002405 | Ga0055532_10024052 | 148 |
| 121 | 3300003759 | Ga0055525_1000038 | Ga0055525_1000038215 | 148 |
| 122 | 3300003759 | Ga0055525_1000039 | Ga0055525_1000039102 | 148 |
| 123 | 3300003760 | Ga0055527_1001077 | Ga0055527_10010774 | 148 |
| 124 | 3300003760 | Ga0055527_1001080 | Ga0055527_10010804 | 148 |
| 125 | 3300003761 | Ga0055535_1002463 | Ga0055535_10024634 | 148 |
| 126 | 3300003761 | Ga0055535_1002468 | Ga0055535_10024684 | 148 |
| 127 | 3300003762 | Ga0055542_1002359 | Ga0055542_10023594 | 148 |
| 128 | 3300003762 | Ga0055542_1003231 | Ga0055542_10032312 | 148 |
| 129 | 3300003763 | Ga0055529_1001317 | Ga0055529_10013174 | 148 |
| 130 | 3300003784 | Ga0055534_1026131 | Ga0055534_10261312 | 148 |
| 131 | 3300003790 | Ga0055528_1001724 | Ga0055528_100172411 | 148 |
| 132 | 3300003841 | Ga0055541_1000016 | Ga0055541_1000016102 | 148 |
| 133 | 3300003856 | Ga0058692_1009562 | Ga0058692_10095623 | 148 |
| 134 | 3300004625 | Ga0055543_1007895 | Ga0055543_10078953 | 148 |
| 135 | 3300005262 | Ga0065165_1000214 | Ga0065165_100021425 | 148 |
| 136 | 3300005262 | Ga0065165_1000286 | Ga0065165_100028697 | 148 |
| 137 | 3300005262 | Ga0065165_1000905 | Ga0065165_100090521 | 148 |
| 138 | 3300005290 | Ga0065712_10030383 | Ga0065712_100303832 | 148 |
| 139 | 3300005327 | Ga0070658_10109366 | Ga0070658_101093662 | 148 |
| 140 | 3300005328 | Ga0070676_10228686 | Ga0070676_102286862 | 148 |
| 141 | 3300005328 | Ga0070676_10858057 | Ga0070676_108580572 | 148 |
| 142 | 3300005331 | Ga0070670_100003254 | Ga0070670_1000032546 | 148 |
| 143 | 3300005331 | Ga0070670_101189122 | Ga0070670_1011891221 | 148 |
| 144 | 3300005333 | Ga0070677_10105109 | Ga0070677_101051092 | 148 |
| 145 | 3300005338 | Ga0068868_100073946 | Ga0068868_1000739462 | 148 |
| 146 | 3300005339 | Ga0070660_100004289 | Ga0070660_1000042894 | 148 |
| 147 | 3300005344 | Ga0070661_100440097 | Ga0070661_1004400972 | 148 |
| 148 | 3300005347 | Ga0070668_100055793 | Ga0070668_1000557933 | 148 |
| 149 | 3300005353 | Ga0070669_100054000 | Ga0070669_1000540002 | 148 |
| 150 | 3300005353 | Ga0070669_100283211 | Ga0070669_1002832112 | 148 |
| 151 | 3300005354 | Ga0070675_100000705 | Ga0070675_1000007054 | 148 |
| 152 | 3300005355 | Ga0070671_100006437 | Ga0070671_1000064378 | 148 |
| 153 | 3300005356 | Ga0070674_100001989 | Ga0070674_1000019894 | 148 |
| 154 | 3300005356 | Ga0070674_100154280 | Ga0070674_1001542803 | 148 |
| 155 | 3300005364 | Ga0070673_100014074 | Ga0070673_1000140744 | 148 |
| 156 | 3300005366 | Ga0070659_100000697 | Ga0070659_10000069720 | 148 |
| 157 | 3300005367 | Ga0070667_100152675 | Ga0070667_1001526752 | 148 |
| 158 | 3300005367 | Ga0070667_100581315 | Ga0070667_1005813152 | 148 |
| 159 | 3300005438 | Ga0070701_10172997 | Ga0070701_101729972 | 148 |
| 160 | 3300005455 | Ga0070663_100000289 | Ga0070663_1000002897 | 148 |
| 161 | 3300005455 | Ga0070663_100595585 | Ga0070663_1005955852 | 148 |
| 162 | 3300005456 | Ga0070678_100005858 | Ga0070678_1000058584 | 148 |
| 163 | 3300005456 | Ga0070678_100729463 | Ga0070678_1007294632 | 148 |
| 164 | 3300005456 | Ga0070678_101867712 | Ga0070678_1018677121 | 148 |
| 165 | 3300005459 | Ga0068867_100003695 | Ga0068867_1000036959 | 148 |
| 166 | 3300005459 | Ga0068867_100590354 | Ga0068867_1005903542 | 148 |
| 167 | 3300005530 | Ga0070679_100170005 | Ga0070679_1001700052 | 148 |
| 168 | 3300005546 | Ga0070696_100368106 | Ga0070696_1003681062 | 148 |
| 169 | 3300005548 | Ga0070665_100997812 | Ga0070665_1009978122 | 148 |
| 170 | 3300005549 | Ga0070704_100221356 | Ga0070704_1002213562 | 148 |
| 171 | 3300005564 | Ga0070664_100067450 | Ga0070664_1000674502 | 148 |
| 172 | 3300005564 | Ga0070664_100561589 | Ga0070664_1005615892 | 148 |
| 173 | 3300005834 | Ga0068851_10263009 | Ga0068851_102630092 | 148 |
| 174 | 3300005840 | Ga0068870_10121050 | Ga0068870_101210502 | 148 |
| 175 | 3300006237 | Ga0097621_100092319 | Ga0097621_1000923192 | 148 |
| 176 | 3300006353 | Ga0075370_10055016 | Ga0075370_100550163 | 148 |
| 177 | 3300006353 | Ga0075370_10159158 | Ga0075370_101591582 | 148 |
| 178 | 3300006358 | Ga0068871_100075709 | Ga0068871_1000757093 | 148 |
| 179 | 3300006846 | Ga0075430_100202313 | Ga0075430_1002023132 | 148 |
| 180 | 3300006847 | Ga0075431_100018750 | Ga0075431_1000187506 | 148 |
| 181 | 3300006880 | Ga0075429_100000294 | Ga0075429_1000002944 | 148 |
| 182 | 3300006880 | Ga0075429_100020879 | Ga0075429_1000208792 | 148 |
| 183 | 3300009011 | Ga0105251_10001210 | Ga0105251_100012101 | 148 |
| 184 | 3300009036 | Ga0105244_10128297 | Ga0105244_101282971 | 148 |
| 185 | 3300009093 | Ga0105240_10069966 | Ga0105240_100699662 | 148 |
| 186 | 3300009093 | Ga0105240_10095788 | Ga0105240_100957884 | 148 |
| 187 | 3300009093 | Ga0105240_10096638 | Ga0105240_100966382 | 148 |
| 188 | 3300009176 | Ga0105242_10000656 | Ga0105242_1000065627 | 148 |
| 189 | 3300009177 | Ga0105248_10037595 | Ga0105248_100375953 | 148 |
| 190 | 3300009177 | Ga0105248_11060135 | Ga0105248_110601352 | 148 |
| 191 | 3300009545 | Ga0105237_10079024 | Ga0105237_100790242 | 148 |
| 192 | 3300009551 | Ga0105238_10169272 | Ga0105238_101692724 | 148 |
| 193 | 3300009551 | Ga0105238_10283723 | Ga0105238_102837232 | 148 |
| 194 | 3300010375 | Ga0105239_10008632 | Ga0105239_100086324 | 148 |
| 195 | 3300010375 | Ga0105239_10418444 | Ga0105239_104184443 | 148 |
| 196 | 3300013102 | Ga0157371_10000001 | Ga0157371_10000001601 | 148 |
| 197 | 3300013105 | Ga0157369_10218107 | Ga0157369_102181073 | 148 |
| 198 | 3300013105 | Ga0157369_11572772 | Ga0157369_115727721 | 148 |
| 199 | 3300013105 | Ga0157369_11983714 | Ga0157369_119837141 | 148 |
| 200 | 3300013306 | Ga0163162_11324280 | Ga0163162_113242802 | 148 |
| 201 | 3300013308 | Ga0157375_10061759 | Ga0157375_100617592 | 148 |
| 202 | 3300014497 | Ga0182008_10015292 | Ga0182008_100152924 | 148 |
| 203 | 3300014497 | Ga0182008_10020248 | Ga0182008_100202483 | 148 |
| 204 | 3300014969 | Ga0157376_10106764 | Ga0157376_101067643 | 148 |
| 205 | 3300015261 | Ga0182006_1109467 | Ga0182006_11094672 | 148 |
| 206 | 3300015262 | Ga0182007_10002268 | Ga0182007_100022684 | 148 |
| 207 | 3300015262 | Ga0182007_10006994 | Ga0182007_100069942 | 148 |
| 208 | 3300015265 | Ga0182005_1032789 | Ga0182005_10327892 | 148 |
| 209 | 3300016635 | Ga0183361_10009 | Ga0183361_10009117 | 148 |
| 210 | 3300017792 | Ga0163161_10086155 | Ga0163161_100861552 | 148 |
| 211 | 3300021361 | Ga0213872_10000147 | Ga0213872_1000014719 | 148 |
| 212 | 3300021361 | Ga0213872_10000232 | Ga0213872_100002326 | 148 |
| 213 | 3300021361 | Ga0213872_10109261 | Ga0213872_101092612 | 148 |
| 214 | 3300025206 | Ga0209435_100015 | Ga0209435_100015113 | 148 |
| 215 | 3300025206 | Ga0209435_100443 | Ga0209435_1004433 | 148 |
| 216 | 3300025206 | Ga0209435_102903 | Ga0209435_1029032 | 148 |
| 217 | 3300025225 | Ga0209566_100843 | Ga0209566_1008439 | 148 |
| 218 | 3300025226 | Ga0209674_101439 | Ga0209674_1014394 | 148 |
| 219 | 3300025226 | Ga0209674_116364 | Ga0209674_1163642 | 148 |
| 220 | 3300025228 | Ga0209672_100033 | Ga0209672_100033290 | 148 |
| 221 | 3300025228 | Ga0209672_100034 | Ga0209672_100034154 | 148 |
| 222 | 3300025229 | Ga0209147_100004 | Ga0209147_1000041113 | 148 |
| 223 | 3300025229 | Ga0209147_100089 | Ga0209147_100089159 | 148 |
| 224 | 3300025229 | Ga0209147_100628 | Ga0209147_1006284 | 148 |
| 225 | 3300025230 | Ga0209563_100005 | Ga0209563_1000051056 | 148 |
| 226 | 3300025231 | Ga0207427_100718 | Ga0207427_1007187 | 148 |
| 227 | 3300025242 | Ga0209258_100023 | Ga0209258_10002389 | 148 |
| 228 | 3300025242 | Ga0209258_100242 | Ga0209258_10024283 | 148 |
| 229 | 3300025242 | Ga0209258_100523 | Ga0209258_10052326 | 148 |
| 230 | 3300025246 | Ga0209646_1000020 | Ga0209646_100002094 | 148 |
| 231 | 3300025246 | Ga0209646_1000040 | Ga0209646_1000040143 | 148 |
| 232 | 3300025250 | Ga0209026_1000034 | Ga0209026_1000034176 | 148 |
| 233 | 3300025250 | Ga0209026_1001823 | Ga0209026_10018235 | 148 |
| 234 | 3300025254 | Ga0209148_1000029 | Ga0209148_1000029154 | 148 |
| 235 | 3300025254 | Ga0209148_1003502 | Ga0209148_10035024 | 148 |
| 236 | 3300025254 | Ga0209148_1012762 | Ga0209148_10127622 | 148 |
| 237 | 3300025256 | Ga0209759_1000049 | Ga0209759_100004927 | 148 |
| 238 | 3300025256 | Ga0209759_1000656 | Ga0209759_100065625 | 148 |
| 239 | 3300025272 | Ga0209455_1000123 | Ga0209455_1000123154 | 148 |
| 240 | 3300025273 | Ga0209673_1000075 | Ga0209673_100007519 | 148 |
| 241 | 3300025284 | Ga0209130_1026653 | Ga0209130_10266532 | 148 |
| 242 | 3300025291 | Ga0209675_1035364 | Ga0209675_10353642 | 148 |
| 243 | 3300025295 | Ga0209564_1014545 | Ga0209564_10145452 | 148 |
| 244 | 3300025302 | Ga0207426_1000326 | Ga0207426_10003262 | 148 |
| 245 | 3300025302 | Ga0207426_1006086 | Ga0207426_10060862 | 148 |
| 246 | 3300025315 | Ga0207697_10079401 | Ga0207697_100794012 | 148 |
| 247 | 3300025321 | Ga0207656_10059814 | Ga0207656_100598142 | 148 |
| 248 | 3300025711 | Ga0207696_1053246 | Ga0207696_10532462 | 148 |
| 249 | 3300025735 | Ga0207713_1003216 | Ga0207713_10032169 | 148 |
| 250 | 3300025893 | Ga0207682_10004972 | Ga0207682_100049724 | 148 |
| 251 | 3300025901 | Ga0207688_10052635 | Ga0207688_100526352 | 148 |
| 252 | 3300025904 | Ga0207647_10003550 | Ga0207647_100035508 | 148 |
| 253 | 3300025904 | Ga0207647_10063243 | Ga0207647_100632432 | 148 |
| 254 | 3300025907 | Ga0207645_10210231 | Ga0207645_102102312 | 148 |
| 255 | 3300025909 | Ga0207705_10080115 | Ga0207705_100801152 | 148 |
| 256 | 3300025913 | Ga0207695_10002948 | Ga0207695_100029485 | 148 |
| 257 | 3300025913 | Ga0207695_10018474 | Ga0207695_100184747 | 148 |
| 258 | 3300025913 | Ga0207695_10083561 | Ga0207695_100835612 | 148 |
| 259 | 3300025913 | Ga0207695_10313487 | Ga0207695_103134872 | 148 |
| 260 | 3300025914 | Ga0207671_10028629 | Ga0207671_100286291 | 148 |
| 261 | 3300025918 | Ga0207662_10120016 | Ga0207662_101200162 | 148 |
| 262 | 3300025919 | Ga0207657_10000098 | Ga0207657_1000009882 | 148 |
| 263 | 3300025919 | Ga0207657_10366743 | Ga0207657_103667432 | 148 |
| 264 | 3300025922 | Ga0207646_10614104 | Ga0207646_106141042 | 148 |
| 265 | 3300025923 | Ga0207681_10384804 | Ga0207681_103848042 | 148 |
| 266 | 3300025924 | Ga0207694_10386482 | Ga0207694_103864822 | 148 |
| 267 | 3300025925 | Ga0207650_10002051 | Ga0207650_100020513 | 148 |
| 268 | 3300025925 | Ga0207650_10073515 | Ga0207650_100735152 | 148 |
| 269 | 3300025926 | Ga0207659_10005314 | Ga0207659_100053143 | 148 |
| 270 | 3300025926 | Ga0207659_10735814 | Ga0207659_107358141 | 148 |
| 271 | 3300025931 | Ga0207644_10001988 | Ga0207644_1000198813 | 148 |
| 272 | 3300025932 | Ga0207690_10000055 | Ga0207690_1000005583 | 148 |
| 273 | 3300025935 | Ga0207709_10033765 | Ga0207709_100337651 | 148 |
| 274 | 3300025936 | Ga0207670_10391012 | Ga0207670_103910122 | 148 |
| 275 | 3300025940 | Ga0207691_10000361 | Ga0207691_1000036110 | 148 |
| 276 | 3300025940 | Ga0207691_10046489 | Ga0207691_100464892 | 148 |
| 277 | 3300025940 | Ga0207691_10531794 | Ga0207691_105317942 | 148 |
| 278 | 3300025941 | Ga0207711_10248049 | Ga0207711_102480492 | 148 |
| 279 | 3300025941 | Ga0207711_11145057 | Ga0207711_111450571 | 148 |
| 280 | 3300025942 | Ga0207689_10832452 | Ga0207689_108324522 | 148 |
| 281 | 3300025945 | Ga0207679_10040210 | Ga0207679_100402103 | 148 |
| 282 | 3300025945 | Ga0207679_10504436 | Ga0207679_105044362 | 148 |
| 283 | 3300025960 | Ga0207651_10039281 | Ga0207651_100392812 | 148 |
| 284 | 3300025960 | Ga0207651_10372707 | Ga0207651_103727072 | 148 |
| 285 | 3300025972 | Ga0207668_10065332 | Ga0207668_100653324 | 148 |
| 286 | 3300025986 | Ga0207658_10000319 | Ga0207658_1000031922 | 148 |
| 287 | 3300025986 | Ga0207658_10098944 | Ga0207658_100989442 | 148 |
| 288 | 3300026023 | Ga0207677_10028107 | Ga0207677_100281072 | 148 |
| 289 | 3300026035 | Ga0207703_10331552 | Ga0207703_103315522 | 148 |
| 290 | 3300026067 | Ga0207678_10002325 | Ga0207678_100023257 | 148 |
| 291 | 3300026067 | Ga0207678_10445964 | Ga0207678_104459642 | 148 |
| 292 | 3300026078 | Ga0207702_10485699 | Ga0207702_104856992 | 148 |
| 293 | 3300026089 | Ga0207648_10007787 | Ga0207648_100077878 | 148 |
| 294 | 3300026089 | Ga0207648_11331613 | Ga0207648_113316131 | 148 |
| 295 | 3300026116 | Ga0207674_10138110 | Ga0207674_101381102 | 148 |
| 296 | 3300026121 | Ga0207683_10253689 | Ga0207683_102536891 | 148 |
| 297 | 3300026121 | Ga0207683_12046828 | Ga0207683_120468281 | 148 |
| 298 | 3300026142 | Ga0207698_10015048 | Ga0207698_100150482 | 148 |
| 299 | 3300026142 | Ga0207698_10474589 | Ga0207698_104745892 | 148 |
| 300 | 3300027312 | Ga0209371_1000676 | Ga0209371_10006762 | 148 |
| 301 | 3300029957 | Ga0265324_10065087 | Ga0265324_100650871 | 148 |
| 302 | 3300030500 | Ga0268256_1004071 | Ga0268256_10040712 | 148 |
| 303 | 3300031250 | Ga0265331_10009839 | Ga0265331_100098394 | 148 |
| 304 | 3300031251 | Ga0265327_10000144 | Ga0265327_10000144113 | 148 |
| 305 | 3300031251 | Ga0265327_10028374 | Ga0265327_100283742 | 148 |
| 306 | 3300031251 | Ga0265327_10049683 | Ga0265327_100496832 | 148 |
| 307 | 3300031548 | Ga0307408_100140697 | Ga0307408_1001406972 | 148 |
| 308 | 3300031548 | Ga0307408_100158087 | Ga0307408_1001580871 | 148 |
| 309 | 3300031665 | Ga0316575_10062853 | Ga0316575_100628532 | 148 |
| 310 | 3300031730 | Ga0307516_10449662 | Ga0307516_104496621 | 148 |
| 311 | 3300031824 | Ga0307413_10653376 | Ga0307413_106533762 | 148 |
| 312 | 3300031852 | Ga0307410_10089256 | Ga0307410_100892562 | 148 |
| 313 | 3300031911 | Ga0307412_10287940 | Ga0307412_102879402 | 148 |
| 314 | 3300032002 | Ga0307416_100085777 | Ga0307416_1000857772 | 148 |
| 315 | 3300032002 | Ga0307416_101337452 | Ga0307416_1013374522 | 148 |
| 316 | 3300032005 | Ga0307411_10030605 | Ga0307411_100306053 | 148 |
| 317 | 3300032005 | Ga0307411_10719569 | Ga0307411_107195692 | 148 |
| 318 | 3300035398 | Ga0316574_0339027 | Ga0316574_0339027_136_591 | 148 |
| 319 | 3300037312 | Ga0395899_0000054 | Ga0395899_0000054_72221_72667 | 148 |
| 320 | 3300037312 | Ga0395899_0005159 | Ga0395899_0005159_7234_7680 | 148 |
| 321 | 3300037418 | Ga0395900_0000220 | Ga0395900_0000220_17451_17897 | 148 |
| 322 | 3300037418 | Ga0395900_0016002 | Ga0395900_0016002_6275_6721 | 148 |
| 323 | 3300037466 | Ga0395898_0000510 | Ga0395898_0000510_72213_72659 | 148 |
| 324 | 3300037466 | Ga0395898_0057480 | Ga0395898_0057480_1393_1839 | 148 |
| 325 | 3300037466 | Ga0395898_1507936 | Ga0395898_1507936_111_560 | 148 |
| 326 | 3300037471 | Ga0395905_0007060 | Ga0395905_0007060_10520_10966 | 148 |
| 327 | 3300037471 | Ga0395905_0024865 | Ga0395905_0024865_4975_5424 | 148 |
| 328 | 3300037471 | Ga0395905_0198592 | Ga0395905_0198592_261_710 | 148 |
| 329 | 3300037471 | Ga0395905_0329011 | Ga0395905_0329011_477_926 | 148 |
| 330 | 3300037471 | Ga0395905_0516901 | Ga0395905_0516901_152_601 | 148 |
| 331 | 3300038443 | Ga0395901_0002022 | Ga0395901_0002022_16567_17013 | 148 |
| 332 | 3300038443 | Ga0395901_0006544 | Ga0395901_0006544_9534_9983 | 148 |
| 333 | 3300038443 | Ga0395901_0229644 | Ga0395901_0229644_1099_1548 | 148 |
| 334 | 3300039437 | Ga0436365_1170741 | Ga0436365_1170741_508_954 | 148 |
| 335 | 3300039447 | Ga0436361_0061503 | Ga0436361_0061503_117307_117756 | 148 |
| 336 | 3300039447 | Ga0436361_0292464 | Ga0436361_0292464_220_669 | 148 |
| 337 | 3300039447 | Ga0436361_0481389 | Ga0436361_0481389_528_977 | 148 |
| 338 | 3300039447 | Ga0436361_0777699 | Ga0436361_0777699_40_489 | 148 |
| 339 | 3300039447 | Ga0436361_0848343 | Ga0436361_0848343_129342_129794 | 148 |
| 340 | 3300041452 | Ga0451793_0387167 | Ga0451793_0387167_84_533 | 148 |
| 341 | 3300042135 | Ga0450899_039162 | Ga0450899_039162_98_547 | 148 |
| 342 | 3300042439 | Ga0439464_0078516 | Ga0439464_0078516_113_562 | 148 |
| 343 | 3300042876 | Ga0451577_0000879 | Ga0451577_0000879_2302_2751 | 148 |
| 344 | 3300042876 | Ga0451577_0003831 | Ga0451577_0003831_7460_7909 | 148 |
| 345 | 3300042876 | Ga0451577_1033168 | Ga0451577_1033168_109_555 | 148 |
| 346 | 3300044656 | Ga0466969_0029637 | Ga0466969_0029637_522_968 | 148 |
| 347 | 3300044656 | Ga0466969_0037105 | Ga0466969_0037105_1692_2138 | 148 |
| 348 | 3300044658 | Ga0466972_0000111 | Ga0466972_0000111_37886_38335 | 148 |
| 349 | 3300044683 | Ga0466965_0000099 | Ga0466965_0000099_11251_11700 | 148 |
| 350 | 3300044683 | Ga0466965_0004051 | Ga0466965_0004051_4681_5127 | 148 |
| 351 | 3300044683 | Ga0466965_0120408 | Ga0466965_0120408_583_1032 | 148 |
| 352 | 3300044684 | Ga0466966_0000087 | Ga0466966_0000087_17472_17918 | 148 |
| 353 | 3300044684 | Ga0466966_0001623 | Ga0466966_0001623_9740_10186 | 148 |
| 354 | 3300044684 | Ga0466966_0892031 | Ga0466966_0892031_74_520 | 148 |
| 355 | 3300044693 | Ga0466961_0000724 | Ga0466961_0000724_15474_15920 | 148 |
| 356 | 3300044693 | Ga0466961_0022051 | Ga0466961_0022051_2003_2449 | 148 |
| 357 | 3300044694 | Ga0466963_0036933 | Ga0466963_0036933_468_914 | 148 |
| 358 | 3300044694 | Ga0466963_0266552 | Ga0466963_0266552_393_839 | 148 |
| 359 | 3300044706 | Ga0466964_0000850 | Ga0466964_0000850_7950_8396 | 148 |
| 360 | 3300044706 | Ga0466964_0015718 | Ga0466964_0015718_995_1444 | 148 |
| 361 | 3300044719 | Ga0466971_0079058 | Ga0466971_0079058_332_778 | 148 |
| 362 | 3300044735 | Ga0466968_0026539 | Ga0466968_0026539_497_943 | 148 |
| 363 | 3300044735 | Ga0466968_0087190 | Ga0466968_0087190_60_509 | 148 |
| 364 | 3300044735 | Ga0466968_0169681 | Ga0466968_0169681_291_740 | 148 |
| 365 | 3300044735 | Ga0466968_0422769 | Ga0466968_0422769_152_598 | 148 |
| 366 | 3300044765 | Ga0466970_0035821 | Ga0466970_0035821_2152_2598 | 148 |
| 367 | 3300044842 | Ga0466957_0025046 | Ga0466957_0025046_159_605 | 148 |
| 368 | 3300045049 | Ga0466959_0006559 | Ga0466959_0006559_5177_5623 | 148 |
| 369 | 3300045049 | Ga0466959_0017642 | Ga0466959_0017642_820_1266 | 148 |
| 370 | 3300045836 | Ga0466958_0006352 | Ga0466958_0006352_1148_1594 | 148 |
| 371 | 3300045836 | Ga0466958_0021076 | Ga0466958_0021076_2823_3269 | 148 |
| 372 | 3300046454 | Ga0495592_0042768 | Ga0495592_0042768_1233_1682 | 148 |
| 373 | 3300046454 | Ga0495592_0438802 | Ga0495592_0438802_90_539 | 148 |
| 374 | 3300046457 | Ga0495590_0000630 | Ga0495590_0000630_453_899 | 148 |
| 375 | 3300046462 | Ga0495651_0396110 | Ga0495651_0396110_364_813 | 148 |
| 376 | 3300046463 | Ga0495653_0003931 | Ga0495653_0003931_10514_10963 | 148 |
| 377 | 3300046463 | Ga0495653_0179559 | Ga0495653_0179559_351_797 | 148 |
| 378 | 3300046463 | Ga0495653_0274026 | Ga0495653_0274026_361_807 | 148 |
| 379 | 3300046471 | Ga0495650_0126883 | Ga0495650_0126883_177_623 | 148 |
| 380 | 3300046472 | Ga0495580_0911067 | Ga0495580_0911067_65_511 | 148 |
| 381 | 3300046473 | Ga0495582_0521925 | Ga0495582_0521925_124_570 | 148 |
| 382 | 3300046474 | Ga0495605_0393043 | Ga0495605_0393043_118_564 | 148 |
| 383 | 3300046477 | Ga0495664_0060226 | Ga0495664_0060226_834_1280 | 148 |
| 384 | 3300046491 | Ga0495584_0037588 | Ga0495584_0037588_904_1353 | 148 |
| 385 | 3300046492 | Ga0495585_0007791 | Ga0495585_0007791_4524_4973 | 148 |
| 386 | 3300046500 | Ga0495596_0112653 | Ga0495596_0112653_335_784 | 148 |
| 387 | 3300046506 | Ga0495583_0003698 | Ga0495583_0003698_10736_11185 | 148 |
| 388 | 3300046513 | Ga0495616_0049273 | Ga0495616_0049273_1523_1972 | 148 |
| 389 | 3300046514 | Ga0495618_0182184 | Ga0495618_0182184_285_734 | 148 |
| 390 | 3300046515 | Ga0495620_0018493 | Ga0495620_0018493_1711_2157 | 148 |
| 391 | 3300046515 | Ga0495620_0264397 | Ga0495620_0264397_185_634 | 148 |
| 392 | 3300046516 | Ga0495628_0008227 | Ga0495628_0008227_738_1184 | 148 |
| 393 | 3300046516 | Ga0495628_0018646 | Ga0495628_0018646_1151_1600 | 148 |
| 394 | 3300046516 | Ga0495628_0072664 | Ga0495628_0072664_68_514 | 148 |
| 395 | 3300046517 | Ga0495630_0378752 | Ga0495630_0378752_240_686 | 148 |
| 396 | 3300046518 | Ga0495631_0057978 | Ga0495631_0057978_1223_1672 | 148 |
| 397 | 3300046519 | Ga0495632_0153200 | Ga0495632_0153200_128_577 | 148 |
| 398 | 3300046522 | Ga0495643_0010464 | Ga0495643_0010464_3650_4099 | 148 |
| 399 | 3300046528 | Ga0495642_0030532 | Ga0495642_0030532_1526_1975 | 148 |
| 400 | 3300046529 | Ga0495652_0013479 | Ga0495652_0013479_3865_4314 | 148 |
| 401 | 3300046529 | Ga0495652_0071319 | Ga0495652_0071319_2059_2505 | 148 |
| 402 | 3300046529 | Ga0495652_0126467 | Ga0495652_0126467_110_556 | 148 |
| 403 | 3300046530 | Ga0495654_0169692 | Ga0495654_0169692_433_879 | 148 |
| 404 | 3300046530 | Ga0495654_0404347 | Ga0495654_0404347_20_466 | 148 |
| 405 | 3300046535 | Ga0495586_0100845 | Ga0495586_0100845_751_1197 | 148 |
| 406 | 3300046538 | Ga0495609_0005408 | Ga0495609_0005408_141_590 | 148 |
| 407 | 3300046542 | Ga0495597_0005314 | Ga0495597_0005314_3488_3937 | 148 |
| 408 | 3300046542 | Ga0495597_0007513 | Ga0495597_0007513_609_1055 | 148 |
| 409 | 3300046543 | Ga0495645_0017116 | Ga0495645_0017116_1991_2440 | 148 |
| 410 | 3300046559 | Ga0495667_0135696 | Ga0495667_0135696_922_1368 | 148 |
| 411 | 3300046642 | Ga0495634_0152637 | Ga0495634_0152637_649_1098 | 148 |
| 412 | 3300046648 | Ga0495611_0206269 | Ga0495611_0206269_65_514 | 148 |
| 413 | 3300046663 | Ga0495635_0111045 | Ga0495635_0111045_10_459 | 148 |
| 414 | 3300046663 | Ga0495635_0375383 | Ga0495635_0375383_298_744 | 148 |
| 415 | 3300046665 | Ga0495661_0037408 | Ga0495661_0037408_2218_2667 | 148 |
| 416 | 3300046678 | Ga0495599_0004516 | Ga0495599_0004516_5043_5492 | 148 |
| 417 | 3300046679 | Ga0495623_0024279 | Ga0495623_0024279_3250_3696 | 148 |
| 418 | 3300046680 | Ga0495646_0001683 | Ga0495646_0001683_1715_2164 | 148 |
| 419 | 3300046680 | Ga0495646_0166690 | Ga0495646_0166690_467_913 | 148 |
| 420 | 3300046684 | Ga0495669_0408131 | Ga0495669_0408131_30_476 | 148 |
| 421 | 3300046690 | Ga0495624_0094865 | Ga0495624_0094865_46_495 | 148 |
| 422 | 3300046690 | Ga0495624_0121941 | Ga0495624_0121941_363_812 | 148 |
| 423 | 3300046694 | Ga0495649_0021009 | Ga0495649_0021009_2767_3213 | 148 |
| 424 | 3300046794 | Ga0495589_0031647 | Ga0495589_0031647_1615_2064 | 148 |
| 425 | 3300046794 | Ga0495589_0451914 | Ga0495589_0451914_44_490 | 148 |
| 426 | 3300046809 | Ga0495600_0001160 | Ga0495600_0001160_11623_12072 | 148 |
| 427 | 3300047317 | Ga0495604_0003928 | Ga0495604_0003928_2852_3301 | 148 |
| 428 | 3300047317 | Ga0495604_0138900 | Ga0495604_0138900_33_479 | 148 |
| 429 | 3300047317 | Ga0495604_0142882 | Ga0495604_0142882_658_1104 | 148 |
| 430 | 3300047319 | Ga0495674_0374312 | Ga0495674_0374312_640_1086 | 148 |
| 431 | 3300047319 | Ga0495674_0886187 | Ga0495674_0886187_96_542 | 148 |
| 432 | 3300047320 | Ga0495672_0108737 | Ga0495672_0108737_811_1257 | 148 |
| 433 | 3300047322 | Ga0495680_0135838 | Ga0495680_0135838_1051_1497 | 148 |
| 434 | 3300047323 | Ga0495683_0001407 | Ga0495683_0001407_12101_12547 | 148 |
| 435 | 3300047323 | Ga0495683_0038828 | Ga0495683_0038828_273_722 | 148 |
| 436 | 3300047323 | Ga0495683_0118914 | Ga0495683_0118914_768_1214 | 148 |
| 437 | 3300047443 | Ga0495687_000169 | Ga0495687_000169_61872_62318 | 148 |
| 438 | 3300047443 | Ga0495687_028428 | Ga0495687_028428_676_1122 | 148 |
| 439 | 3300047443 | Ga0495687_037500 | Ga0495687_037500_364_813 | 148 |
| 440 | 3300047444 | Ga0495675_0537110 | Ga0495675_0537110_159_605 | 148 |
| 441 | 3300047472 | Ga0495686_0000002 | Ga0495686_0000002_83189_83635 | 148 |
| 442 | 3300047472 | Ga0495686_0046812 | Ga0495686_0046812_228_674 | 148 |
| 443 | 3300047472 | Ga0495686_0350164 | Ga0495686_0350164_40_486 | 148 |
| 444 | 3300047673 | Ga0495593_0124416 | Ga0495593_0124416_101_547 | 148 |
| 445 | 3300048088 | Ga0495602_0016723 | Ga0495602_0016723_4326_4772 | 148 |
| 446 | 3300048088 | Ga0495602_0064434 | Ga0495602_0064434_1211_1660 | 148 |
| 447 | 3300048903 | Ga0496100_0043465 | Ga0496100_0043465_133_579 | 148 |
| 448 | 3300048904 | Ga0496101_0014626 | Ga0496101_0014626_4107_4553 | 148 |
| 449 | 3300048905 | Ga0496102_0001320 | Ga0496102_0001320_1605_2051 | 148 |
| 450 | 3300048906 | Ga0496103_0007295 | Ga0496103_0007295_472_918 | 148 |
| 451 | 3300048907 | Ga0496104_0900794 | Ga0496104_0900794_131_577 | 148 |
| 452 | 3300048909 | Ga0496106_0017418 | Ga0496106_0017418_4488_4934 | 148 |
| 453 | 3300048910 | Ga0496107_0010544 | Ga0496107_0010544_3092_3538 | 148 |
| 454 | 3300048912 | Ga0496109_0427176 | Ga0496109_0427176_101_547 | 148 |
| 455 | 3300048913 | Ga0496110_0029250 | Ga0496110_0029250_4038_4484 | 148 |
| 456 | 3300048913 | Ga0496110_0225286 | Ga0496110_0225286_396_845 | 148 |
| 457 | 3300048914 | Ga0496111_0840342 | Ga0496111_0840342_45_494 | 148 |
| 458 | 3300048915 | Ga0496112_0387745 | Ga0496112_0387745_635_1081 | 148 |
| 459 | 3300048916 | Ga0496113_0017346 | Ga0496113_0017346_619_1065 | 148 |
| 460 | 3300048917 | Ga0496114_0413596 | Ga0496114_0413596_529_978 | 148 |
| 461 | 3300048919 | Ga0496116_0012240 | Ga0496116_0012240_406_852 | 148 |
| 462 | 3300048919 | Ga0496116_0025650 | Ga0496116_0025650_2776_3222 | 148 |
| 463 | 3300048919 | Ga0496116_0056147 | Ga0496116_0056147_269_715 | 148 |
| 464 | 3300048919 | Ga0496116_0083790 | Ga0496116_0083790_818_1267 | 148 |
| 465 | 3300048920 | Ga0496117_0109676 | Ga0496117_0109676_441_935 | 148 |
| 466 | 3300048920 | Ga0496117_0157305 | Ga0496117_0157305_485_931 | 148 |
| 467 | 3300048920 | Ga0496117_0391254 | Ga0496117_0391254_228_677 | 148 |
| 468 | 3300048921 | Ga0496118_0041267 | Ga0496118_0041267_1651_2100 | 148 |
| 469 | 3300048921 | Ga0496118_0085353 | Ga0496118_0085353_418_864 | 148 |
| 470 | 3300048921 | Ga0496118_0107942 | Ga0496118_0107942_636_1082 | 148 |
| 471 | 3300048922 | Ga0496119_0150913 | Ga0496119_0150913_197_727 | 148 |
| 472 | 3300048922 | Ga0496119_0202098 | Ga0496119_0202098_280_726 | 148 |
| 473 | 3300048924 | Ga0496121_0055225 | Ga0496121_0055225_2458_2904 | 148 |
| 474 | 3300048924 | Ga0496121_0095542 | Ga0496121_0095542_1269_1718 | 148 |
| 475 | 3300048924 | Ga0496121_0149288 | Ga0496121_0149288_606_1052 | 148 |
| 476 | 3300048924 | Ga0496121_0155932 | Ga0496121_0155932_735_1232 | 148 |
| 477 | 3300048924 | Ga0496121_0376782 | Ga0496121_0376782_121_570 | 148 |
| 478 | 3300048924 | Ga0496121_0388081 | Ga0496121_0388081_135_581 | 148 |
| 479 | 3300048925 | Ga0496122_0007506 | Ga0496122_0007506_3540_3986 | 148 |
| 480 | 3300048925 | Ga0496122_0016989 | Ga0496122_0016989_3624_4073 | 148 |
| 481 | 3300048925 | Ga0496122_0201623 | Ga0496122_0201623_614_1063 | 148 |
| 482 | 3300048926 | Ga0496123_0013377 | Ga0496123_0013377_2820_3269 | 148 |
| 483 | 3300048926 | Ga0496123_0164858 | Ga0496123_0164858_652_1098 | 148 |
| 484 | 3300048927 | Ga0496124_0016661 | Ga0496124_0016661_4794_5240 | 148 |
| 485 | 3300048927 | Ga0496124_0147198 | Ga0496124_0147198_956_1405 | 148 |
| 486 | 3300048927 | Ga0496124_0151704 | Ga0496124_0151704_81_530 | 148 |
| 487 | 3300048928 | Ga0496125_0001986 | Ga0496125_0001986_23127_23576 | 148 |
| 488 | 3300048928 | Ga0496125_0005041 | Ga0496125_0005041_3755_4204 | 148 |
| 489 | 3300048928 | Ga0496125_0009210 | Ga0496125_0009210_6596_7042 | 148 |
| 490 | 3300048928 | Ga0496125_0034310 | Ga0496125_0034310_1580_2029 | 148 |
| 491 | 3300048929 | Ga0496126_0053155 | Ga0496126_0053155_1825_2274 | 148 |
| 492 | 3300048929 | Ga0496126_0096964 | Ga0496126_0096964_345_791 | 148 |
| 493 | 3300048929 | Ga0496126_0474798 | Ga0496126_0474798_479_925 | 148 |
| 494 | 3300048929 | Ga0496126_0722132 | Ga0496126_0722132_302_751 | 148 |
| 495 | 3300048929 | Ga0496126_0815518 | Ga0496126_0815518_258_704 | 148 |
| 496 | 3300049459 | Ga0495678_135378 | Ga0495678_135378_302_748 | 148 |
| 497 | 3300049669 | Ga0501235_116457 | Ga0501235_116457_183_632 | 148 |
| 498 | 3300049822 | Ga0501035_0025767 | Ga0501035_0025767_516_965 | 148 |
| 499 | 3300049823 | Ga0501044_0012767 | Ga0501044_0012767_7184_7633 | 148 |
| 500 | 3300050493 | nmdc:mga0k408_46528_c1 | nmdc:mga0k408_46528_c1_958_1407 | 148 |
| 501 | 3300050493 | nmdc:mga0k408_5292_c2 | nmdc:mga0k408_5292_c2_2331_2789 | 148 |
| 502 | 3300050494 | nmdc:mga06z11_61447_c1 | nmdc:mga06z11_61447_c1_1336_1785 | 148 |
| 503 | 3300050496 | nmdc:mga07m45_531332_c1 | nmdc:mga07m45_531332_c1_175_624 | 148 |
| 504 | 3300050496 | nmdc:mga07m45_76695_c1 | nmdc:mga07m45_76695_c1_1399_1848 | 148 |
| 505 | 3300050508 | nmdc:mga09592_214556_c1 | nmdc:mga09592_214556_c1_826_1314 | 148 |
| 506 | 3300050508 | nmdc:mga09592_32207_c1 | nmdc:mga09592_32207_c1_2088_2537 | 148 |
| 507 | 3300050509 | nmdc:mga0qj67_15201_c1 | nmdc:mga0qj67_15201_c1_2349_2837 | 148 |
| 508 | 3300050509 | nmdc:mga0qj67_194524_c1 | nmdc:mga0qj67_194524_c1_802_1251 | 148 |
| 509 | 3300050510 | nmdc:mga06r32_26118_c1 | nmdc:mga06r32_26118_c1_281_730 | 148 |
| 510 | 3300053077 | Ga0495601_0005804 | Ga0495601_0005804_4551_5000 | 148 |
| 511 | 3300053086 | Ga0500578_0044292 | Ga0500578_0044292_1604_2053 | 148 |
| 512 | 3300053140 | Ga0500573_0202152 | Ga0500573_0202152_521_970 | 148 |
| 513 | 3300053141 | Ga0500574_000304 | Ga0500574_000304_2705_3154 | 148 |
| 514 | 3300053154 | Ga0500619_000795 | Ga0500619_000795_2985_3434 | 148 |
| 515 | 3300053730 | Ga0500645_006109 | Ga0500645_006109_3351_3800 | 148 |
| 516 | 3300061719 | Ga0466962_0394874 | Ga0466962_0394874_206_652 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3km3-assembly1.cif.gz_A | crystal structure of eoxycytidine triphosphate deaminase from anaplasma phagocytophilum at 2.1a resolution | 0.9006 | 35 | 118 |
| 3km3-assembly1.cif.gz_B | crystal structure of eoxycytidine triphosphate deaminase from anaplasma phagocytophilum at 2.1a resolution | 0.8776 | 35 | 118 |
| 2v9x-assembly2.cif.gz_G | e138d variant of escherichia coli dctp deaminase in complex with dutp | 0.8608 | 34 | 123 |
| 4lhr-assembly1.cif.gz_A | crystal structure of a deoxyuridine 5'-triphosphate nucleotidohydrolase from burkholderia thailandensis | 0.8607 | 1 | 132 |
| 2okb-assembly1.cif.gz_A | high resolution crystal structures of vaccinia virus dutpase | 0.8603 | 4 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3km3A00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.9006 | 35 | 118 | 2.70.40.10 |
| 2d4lA01 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.8432 | 20 | 121 | 2.70.40.10 |
| 1snfC00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.8309 | 1 | 132 | 2.70.40.10 |
| 3tqzA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.8282 | 2 | 134 | 2.70.40.10 |
| 1ducA00 | Mainly Beta;Distorted Sandwich;Deoxyuridine 5'-Triphosphate Nucleotidohydrolase; Chain A;Deoxyuridine triphosphatase (dUTPase) | 0.8254 | 19 | 132 | 2.70.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A447TSH8-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.9232 | 26 | 126 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A661CKF5-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.8987 | 2 | 123 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A447QL67-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.8987 | 2 | 119 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A259EVG0-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.8973 | 1 | 115 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
| AF-A0A259EVG0-F1-model_v4 | dUTP diphosphatase (EC 3.6.1.23) | 0.89 | 1 | 115 |
GO:0000287
GO:0004170 GO:0006226 GO:0046081 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar