F457985

General Info

Members Datasets Scaffolds Average Seq Length
516 239 1032 109

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10649458|Ga0111539_106494582
Length 129
Sequence VRRGDLFLVQHPSSRDPKRQRVFVVVSRQLVIDSSFSTVVCAPVYSRRDGLHTQVDIGVDEGLKHDRSVHCDELLSLAKSSLTHFVGQLSPTKIAALDRALAFALGLTADVAGWGERRAGHFLVVQEAR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
89 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
90 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
127 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
132 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
135 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
176 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.52
Rhizosphere 96.71
Stem 0
Stem Tuber 0
Unclassified 42.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10649458 3300009094 Unclassified 1228
2 LJNas_1001234 3300000546 Bacteria 3848
3 LJQas_1000015 3300000549 Bacteria 25844
4 Ga0065715_10379454 3300005293 Unclassified 909
5 Ga0065707_10398514 3300005295 Bacteria 855
6 Ga0070690_100108777 3300005330 Bacteria 1847
7 Ga0070690_101204305 3300005330 Unclassified 604
8 Ga0068869_100298956 3300005334 Bacteria 1299
9 Ga0070666_10002609 3300005335 Bacteria 10882
10 Ga0070666_10996474 3300005335 Unclassified 621
11 Ga0070680_100316172 3300005336 Bacteria 1325
12 Ga0070680_100668046 3300005336 Unclassified 893
13 Ga0068868_100013851 3300005338 Bacteria 5927
14 Ga0068868_100109086 3300005338 Unclassified 2247
15 Ga0068868_100456411 3300005338 Bacteria 1112
16 Ga0068868_100487443 3300005338 Bacteria 1078
17 Ga0070689_100053983 3300005340 Bacteria 3111
18 Ga0070689_100846438 3300005340 Bacteria 807
19 Ga0070689_101646747 3300005340 Unclassified 583
20 Ga0070674_100226086 3300005356 Unclassified 1458
21 Ga0070673_101822716 3300005364 Unclassified 576
22 Ga0070673_102126054 3300005364 Unclassified 533
23 Ga0070659_101419848 3300005366 Unclassified 617
24 Ga0070667_100151848 3300005367 Unclassified 2035
25 Ga0070667_100445439 3300005367 Bacteria 1183
26 Ga0070667_101282199 3300005367 Unclassified 686
27 Ga0070709_10000025 3300005434 Bacteria 129264
28 Ga0070709_10236284 3300005434 Unclassified 1310
29 Ga0070709_10441279 3300005434 Unclassified 979
30 Ga0070709_11365043 3300005434 Unclassified 573
31 Ga0070714_100071366 3300005435 Bacteria 3002
32 Ga0070714_100080156 3300005435 Bacteria 2840
33 Ga0070714_101236978 3300005435 Bacteria 728
34 Ga0070713_100599502 3300005436 Bacteria 1046
35 Ga0070713_100707320 3300005436 Unclassified 962
36 Ga0070713_100732884 3300005436 Unclassified 945
37 Ga0070710_10003108 3300005437 Bacteria 7870
38 Ga0070711_100097305 3300005439 Bacteria 2134
39 Ga0070711_100203876 3300005439 Bacteria 1528
40 Ga0070711_100610362 3300005439 Bacteria 911
41 Ga0070711_101813570 3300005439 Unclassified 535
42 Ga0070705_100542767 3300005440 Unclassified 890
43 Ga0070694_100264121 3300005444 Unclassified 1307
44 Ga0070708_100001818 3300005445 Bacteria 16392
45 Ga0070708_100010435 3300005445 Bacteria 7530
46 Ga0070708_100036273 3300005445 Plasmid 4300
47 Ga0070708_100085787 3300005445 Unclassified 2858
48 Ga0070708_100086917 3300005445 Bacteria 2840
49 Ga0070708_100139649 3300005445 Bacteria 2246
50 Ga0070708_100474256 3300005445 Bacteria 1180
51 Ga0070708_100574290 3300005445 Bacteria 1063
52 Ga0070708_101327250 3300005445 Unclassified 672
53 Ga0070678_100522904 3300005456 Unclassified 1050
54 Ga0070681_10109184 3300005458 Bacteria 2707
55 Ga0068867_100337967 3300005459 Unclassified 1253
56 Ga0070706_100001531 3300005467 Bacteria 24148
57 Ga0070706_100137922 3300005467 Bacteria 2276
58 Ga0070706_100178861 3300005467 Unclassified 1980
59 Ga0070706_100184991 3300005467 Unclassified 1946
60 Ga0070706_100220583 3300005467 Bacteria 1770
61 Ga0070706_100284200 3300005467 Bacteria 1544
62 Ga0070706_100306583 3300005467 Unclassified 1481
63 Ga0070706_100420330 3300005467 Unclassified 1244
64 Ga0070707_100001339 3300005468 Bacteria 24240
65 Ga0070707_100044544 3300005468 Bacteria 4248
66 Ga0070707_100045055 3300005468 Unclassified 4222
67 Ga0070707_100091567 3300005468 Bacteria 2943
68 Ga0070707_100097405 3300005468 Unclassified 2849
69 Ga0070707_100178009 3300005468 Unclassified 2073
70 Ga0070707_101068022 3300005468 Unclassified 773
71 Ga0070707_101410222 3300005468 Unclassified 663
72 Ga0070698_100000131 3300005471 Bacteria 65450
73 Ga0070698_100014129 3300005471 Bacteria 8442
74 Ga0070698_100072972 3300005471 Bacteria 3439
75 Ga0070698_100131088 3300005471 Unclassified 2462
76 Ga0070698_100402855 3300005471 Bacteria 1301
77 Ga0070698_100579715 3300005471 Bacteria 1062
78 Ga0070699_100010852 3300005518 Bacteria 7883
79 Ga0070699_100022526 3300005518 Bacteria 5430
80 Ga0070699_100054844 3300005518 Bacteria 3451
81 Ga0070699_100756036 3300005518 Bacteria 889
82 Ga0070699_101254049 3300005518 Unclassified 680
83 Ga0070697_100000106 3300005536 Bacteria 65504
84 Ga0070697_100009226 3300005536 Bacteria 7709
85 Ga0070697_100018388 3300005536 Bacteria 5509
86 Ga0070697_100033186 3300005536 Bacteria 4157
87 Ga0070697_100130009 3300005536 Bacteria 2111
88 Ga0070697_100451173 3300005536 Bacteria 1120
89 Ga0070697_100705821 3300005536 Unclassified 890
90 Ga0070697_100964705 3300005536 Unclassified 757
91 Ga0070697_101118245 3300005536 Unclassified 701
92 Ga0070695_100022346 3300005545 Unclassified 3880
93 Ga0070695_100085023 3300005545 Bacteria 2100
94 Ga0070695_100286929 3300005545 Unclassified 1212
95 Ga0070696_100324694 3300005546 Unclassified 1185
96 Ga0070693_100161773 3300005547 Bacteria 1426
97 Ga0070693_100697139 3300005547 Unclassified 743
98 Ga0070665_100105329 3300005548 Bacteria 2822
99 Ga0070665_100340205 3300005548 Bacteria 1505
100 Ga0070704_100192093 3300005549 Unclassified 1642
101 Ga0070704_101692375 3300005549 Unclassified 584
102 Ga0068855_102584978 3300005563 Bacteria 504
103 Ga0070664_100352991 3300005564 Bacteria 1338
104 Ga0068854_100159975 3300005578 Bacteria 1743
105 Ga0068856_100015225 3300005614 Bacteria 7432
106 Ga0068856_100074099 3300005614 Unclassified 3370
107 Ga0068856_100245939 3300005614 Unclassified 1804
108 Ga0068856_101089933 3300005614 Bacteria 816
109 Ga0068852_100340192 3300005616 Unclassified 1462
110 Ga0068859_100967460 3300005617 Bacteria 934
111 Ga0068864_100267796 3300005618 Bacteria 1591
112 Ga0068864_100745954 3300005618 Bacteria 959
113 Ga0068866_10045362 3300005718 Unclassified 2204
114 Ga0068851_10013799 3300005834 Bacteria 3826
115 Ga0068863_100295527 3300005841 Bacteria 1570
116 Ga0068858_100019749 3300005842 Bacteria 6299
117 Ga0068858_100026672 3300005842 Bacteria 5366
118 Ga0068860_100001188 3300005843 Bacteria 28462
119 Ga0068860_100006115 3300005843 Bacteria 12108
120 Ga0068860_100143828 3300005843 Unclassified 2294
121 Ga0068860_101842416 3300005843 Bacteria 627
122 Ga0068860_102460812 3300005843 Unclassified 540
123 Ga0070717_10006540 3300006028 Bacteria 8579
124 Ga0070717_10017247 3300006028 Bacteria 5614
125 Ga0070717_10246694 3300006028 Bacteria 1576
126 Ga0070717_10391656 3300006028 Bacteria 1247
127 Ga0070717_10437142 3300006028 Bacteria 1178
128 Ga0070717_10479288 3300006028 Unclassified 1123
129 Ga0070716_100035583 3300006173 Bacteria 2738
130 Ga0070716_100127178 3300006173 Bacteria 1605
131 Ga0097621_100032504 3300006237 Unclassified 4148
132 Ga0097621_100283269 3300006237 Bacteria 1459
133 Ga0097621_101776498 3300006237 Unclassified 588
134 Ga0068871_100035026 3300006358 Bacteria 3987
135 Ga0068871_100070055 3300006358 Bacteria 2882
136 Ga0068871_100104951 3300006358 Bacteria 2371
137 Ga0075428_100107491 3300006844 Bacteria 3041
138 Ga0075428_100244612 3300006844 Bacteria 1935
139 Ga0075428_100497082 3300006844 Bacteria 1305
140 Ga0075430_100199938 3300006846 Bacteria 1660
141 Ga0075431_100856965 3300006847 Bacteria 880
142 Ga0075431_101441277 3300006847 Bacteria 648
143 Ga0075433_10000310 3300006852 Bacteria 29590
144 Ga0075433_11287077 3300006852 Unclassified 634
145 Ga0075434_100003635 3300006871 Bacteria 13771
146 Ga0075434_100908225 3300006871 Bacteria 895
147 Ga0075434_101872589 3300006871 Unclassified 606
148 Ga0075429_100116032 3300006880 Bacteria 2341
149 Ga0068865_101622718 3300006881 Unclassified 582
150 Ga0075436_100000246 3300006914 Bacteria 33826
151 Ga0075436_100012084 3300006914 Bacteria 5920
152 Ga0075436_100059203 3300006914 Bacteria 2646
153 Ga0075436_100069985 3300006914 Unclassified 2425
154 Ga0097620_100967316 3300006931 Bacteria 934
155 Ga0075435_100000683 3300007076 Bacteria 21031
156 Ga0099794_10009817 3300007265 Unclassified 4043
157 Ga0099794_10016683 3300007265 Bacteria 3261
158 Ga0099794_10349598 3300007265 Unclassified 769
159 Ga0105240_10248256 3300009093 Unclassified 2060
160 Ga0105240_10366782 3300009093 Unclassified 1630
161 Ga0105240_10382646 3300009093 Unclassified 1589
162 Ga0105240_10581108 3300009093 Unclassified 1236
163 Ga0105240_10986474 3300009093 Unclassified 902
164 Ga0111539_10607492 3300009094 Bacteria 1274
165 Ga0105245_10007707 3300009098 Bacteria 9430
166 Ga0105245_10016475 3300009098 Bacteria 6449
167 Ga0105245_10060711 3300009098 Bacteria 3405
168 Ga0105245_10076511 3300009098 Bacteria 3049
169 Ga0105245_10255402 3300009098 Unclassified 1704
170 Ga0105245_10887368 3300009098 Unclassified 933
171 Ga0105247_10123203 3300009101 Bacteria 1682
172 Ga0105247_10246391 3300009101 Bacteria 1220
173 Ga0114129_10000138 3300009147 Bacteria 75755
174 Ga0114129_10785405 3300009147 Bacteria 1216
175 Ga0114129_10900119 3300009147 Bacteria 1121
176 Ga0105241_10039980 3300009174 Unclassified 3539
177 Ga0105241_10109415 3300009174 Unclassified 2210
178 Ga0105241_10166623 3300009174 Unclassified 1816
179 Ga0105241_10273148 3300009174 Unclassified 1441
180 Ga0105241_11200067 3300009174 Bacteria 719
181 Ga0105241_11312407 3300009174 Unclassified 690
182 Ga0105241_11968906 3300009174 Unclassified 574
183 Ga0105241_12473711 3300009174 Unclassified 519
184 Ga0105242_10024647 3300009176 Bacteria 4753
185 Ga0105242_10026022 3300009176 Bacteria 4634
186 Ga0105242_10060242 3300009176 Bacteria 3118
187 Ga0105242_10151346 3300009176 Bacteria 2023
188 Ga0105242_10174797 3300009176 Bacteria 1890
189 Ga0105242_11426833 3300009176 Unclassified 721
190 Ga0105242_12747096 3300009176 Unclassified 542
191 Ga0105248_10080338 3300009177 Bacteria 3665
192 Ga0105248_10100295 3300009177 Bacteria 3263
193 Ga0105248_10228458 3300009177 Bacteria 2095
194 Ga0105248_10700322 3300009177 Bacteria 1143
195 Ga0105248_10919120 3300009177 Unclassified 988
196 Ga0105237_10277518 3300009545 Unclassified 1678
197 Ga0105237_10731548 3300009545 Bacteria 996
198 Ga0105237_10834094 3300009545 Unclassified 929
199 Ga0105238_10002528 3300009551 Bacteria 18276
200 Ga0105238_10097706 3300009551 Unclassified 2922
201 Ga0105238_10520787 3300009551 Bacteria 1192
202 Ga0105238_11499026 3300009551 Unclassified 703
203 Ga0105238_11878048 3300009551 Unclassified 632
204 Ga0105249_10412319 3300009553 Bacteria 1383
205 Ga0105249_11868155 3300009553 Unclassified 673
206 Ga0099796_10002818 3300010159 Bacteria 3908
207 Ga0099796_10003748 3300010159 Bacteria 3576
208 Ga0105239_10435190 3300010375 Bacteria 1487
209 Ga0105239_11103238 3300010375 Unclassified 913
210 Ga0105239_11455047 3300010375 Bacteria 791
211 Ga0105239_13171293 3300010375 Bacteria 535
212 Ga0105246_10204246 3300011119 Unclassified 1538
213 Ga0105246_10286710 3300011119 Bacteria 1323
214 Ga0157373_10120644 3300013100 Bacteria 1843
215 Ga0157369_10026880 3300013105 Bacteria 6382
216 Ga0157374_10110494 3300013296 Bacteria 2644
217 Ga0157374_10207710 3300013296 Bacteria 1919
218 Ga0157374_10874026 3300013296 Unclassified 916
219 Ga0157374_11478835 3300013296 Unclassified 702
220 Ga0157378_10000013 3300013297 Bacteria 151930
221 Ga0157378_10000112 3300013297 Bacteria 77866
222 Ga0157378_10019881 3300013297 Bacteria 5903
223 Ga0157378_10109193 3300013297 Unclassified 2534
224 Ga0157378_10325644 3300013297 Bacteria 1494
225 Ga0157378_10459308 3300013297 Unclassified 1265
226 Ga0157378_11353822 3300013297 Bacteria 754
227 Ga0157378_11870464 3300013297 Unclassified 649
228 Ga0163162_10084748 3300013306 Bacteria 3245
229 Ga0163162_10539917 3300013306 Bacteria 1295
230 Ga0157372_10039850 3300013307 Bacteria 5187
231 Ga0157372_11177236 3300013307 Bacteria 886
232 Ga0157372_11276975 3300013307 Bacteria 847
233 Ga0157372_11681797 3300013307 Bacteria 730
234 Ga0157372_13258160 3300013307 Unclassified 517
235 Ga0157375_10148493 3300013308 Bacteria 2477
236 Ga0163163_10023482 3300014325 Bacteria 5853
237 Ga0163163_10479215 3300014325 Bacteria 1305
238 Ga0163163_10627248 3300014325 Bacteria 1138
239 Ga0157379_10015971 3300014968 Bacteria 6600
240 Ga0157379_10110616 3300014968 Unclassified 2467
241 Ga0157379_10913082 3300014968 Unclassified 833
242 Ga0157379_11579877 3300014968 Unclassified 640
243 Ga0157379_12098688 3300014968 Unclassified 560
244 Ga0157376_10027188 3300014969 Bacteria 4532
245 Ga0157376_10067298 3300014969 Bacteria 3029
246 Ga0157376_10075688 3300014969 Unclassified 2873
247 Ga0157376_10666557 3300014969 Bacteria 1042
248 Ga0163161_10134347 3300017792 Bacteria 1869
249 Ga0224570_108953 3300022730 Unclassified 624
250 Ga0224572_1015549 3300024225 Unclassified 1458
251 Ga0228598_1002153 3300024227 Bacteria 4312
252 Ga0228598_1008455 3300024227 Bacteria 2077
253 Ga0207692_10001901 3300025898 Bacteria 7938
254 Ga0207692_10281401 3300025898 Bacteria 1006
255 Ga0207642_10510880 3300025899 Unclassified 737
256 Ga0207642_10568090 3300025899 Unclassified 702
257 Ga0207680_10026649 3300025903 Unclassified 3206
258 Ga0207680_10597652 3300025903 Unclassified 789
259 Ga0207699_10000036 3300025906 Bacteria 129236
260 Ga0207699_10033209 3300025906 Unclassified 2915
261 Ga0207699_10793748 3300025906 Unclassified 696
262 Ga0207699_10808037 3300025906 Unclassified 690
263 Ga0207684_10000726 3300025910 Bacteria 38747
264 Ga0207684_10000755 3300025910 Bacteria 37749
265 Ga0207684_10029913 3300025910 Bacteria 4636
266 Ga0207684_10145722 3300025910 Unclassified 2037
267 Ga0207684_10164099 3300025910 Bacteria 1914
268 Ga0207684_10288157 3300025910 Bacteria 1416
269 Ga0207684_10338054 3300025910 Bacteria 1297
270 Ga0207654_10024057 3300025911 Unclassified 3270
271 Ga0207654_10220978 3300025911 Unclassified 1257
272 Ga0207654_10241986 3300025911 Unclassified 1206
273 Ga0207654_11140200 3300025911 Unclassified 568
274 Ga0207707_10165941 3300025912 Bacteria 1930
275 Ga0207695_10176354 3300025913 Bacteria 2060
276 Ga0207695_11072550 3300025913 Unclassified 685
277 Ga0207695_11299158 3300025913 Unclassified 608
278 Ga0207671_10654677 3300025914 Bacteria 836
279 Ga0207671_11017813 3300025914 Unclassified 652
280 Ga0207663_10058045 3300025916 Bacteria 2441
281 Ga0207663_10059265 3300025916 Bacteria 2421
282 Ga0207663_10164468 3300025916 Bacteria 1570
283 Ga0207663_10354548 3300025916 Bacteria 1111
284 Ga0207652_10592506 3300025921 Bacteria 994
285 Ga0207646_10000299 3300025922 Bacteria 67366
286 Ga0207646_10006105 3300025922 Bacteria 12546
287 Ga0207646_10018615 3300025922 Bacteria 6476
288 Ga0207646_10044231 3300025922 Bacteria 3997
289 Ga0207646_10124387 3300025922 Bacteria 2318
290 Ga0207646_10145224 3300025922 Bacteria 2138
291 Ga0207646_10151721 3300025922 Unclassified 2090
292 Ga0207646_11774843 3300025922 Unclassified 528
293 Ga0207694_10265002 3300025924 Unclassified 1408
294 Ga0207694_10806324 3300025924 Unclassified 793
295 Ga0207687_10001735 3300025927 Bacteria 15020
296 Ga0207687_10008070 3300025927 Bacteria 6889
297 Ga0207687_10023316 3300025927 Bacteria 4123
298 Ga0207687_10176510 3300025927 Unclassified 1652
299 Ga0207687_10243249 3300025927 Unclassified 1427
300 Ga0207700_11052014 3300025928 Bacteria 728
301 Ga0207664_10000037 3300025929 Bacteria 171467
302 Ga0207664_10070678 3300025929 Bacteria 2810
303 Ga0207664_10204934 3300025929 Bacteria 1704
304 Ga0207686_10168026 3300025934 Bacteria 1544
305 Ga0207686_11465384 3300025934 Unclassified 562
306 Ga0207670_10003987 3300025936 Bacteria 7881
307 Ga0207670_10101544 3300025936 Bacteria 2055
308 Ga0207670_11448654 3300025936 Unclassified 583
309 Ga0207704_10505418 3300025938 Unclassified 975
310 Ga0207704_10896869 3300025938 Unclassified 745
311 Ga0207665_10024240 3300025939 Bacteria 4000
312 Ga0207665_10077735 3300025939 Bacteria 2278
313 Ga0207665_10261125 3300025939 Bacteria 1283
314 Ga0207711_10337696 3300025941 Bacteria 1394
315 Ga0207711_10452613 3300025941 Unclassified 1195
316 Ga0207711_11222448 3300025941 Unclassified 693
317 Ga0207689_11424591 3300025942 Unclassified 580
318 Ga0207667_10734077 3300025949 Unclassified 988
319 Ga0207712_11162110 3300025961 Unclassified 688
320 Ga0207640_10543020 3300025981 Bacteria 975
321 Ga0207658_10148254 3300025986 Unclassified 1908
322 Ga0207658_10205186 3300025986 Bacteria 1648
323 Ga0207658_11461067 3300025986 Unclassified 625
324 Ga0207677_10000293 3300026023 Bacteria 37396
325 Ga0207677_10001027 3300026023 Bacteria 15369
326 Ga0207677_10006733 3300026023 Bacteria 6310
327 Ga0207677_10092334 3300026023 Unclassified 2204
328 Ga0207677_10170272 3300026023 Bacteria 1702
329 Ga0207677_12218036 3300026023 Bacteria 511
330 Ga0207703_10011015 3300026035 Bacteria 7046
331 Ga0207703_10018092 3300026035 Bacteria 5504
332 Ga0207703_10410536 3300026035 Bacteria 1258
333 Ga0207702_10023057 3300026078 Bacteria 5163
334 Ga0207702_10036582 3300026078 Unclassified 4107
335 Ga0207702_10151960 3300026078 Unclassified 2107
336 Ga0207702_10487801 3300026078 Bacteria 1200
337 Ga0207641_10416020 3300026088 Bacteria 1293
338 Ga0207648_10888212 3300026089 Unclassified 832
339 Ga0207676_10111707 3300026095 Bacteria 2288
340 Ga0207676_10763263 3300026095 Bacteria 941
341 Ga0207674_10136062 3300026116 Bacteria 2419
342 Ga0209179_1048841 3300027512 Bacteria 904
343 Ga0209588_1009387 3300027671 Unclassified 2924
344 Ga0265356_1002857 3300028017 Unclassified 2237
345 Ga0265355_1001422 3300028036 Bacteria 1553
346 Ga0268266_10132484 3300028379 Bacteria 2230
347 Ga0268265_11498860 3300028380 Unclassified 678
348 Ga0268264_10039063 3300028381 Bacteria 3920
349 Ga0268264_10073658 3300028381 Bacteria 2899
350 Ga0268264_10086190 3300028381 Bacteria 2698
351 Ga0268264_10407811 3300028381 Bacteria 1308
352 Ga0268264_11634975 3300028381 Bacteria 655
353 Ga0265334_10053248 3300028573 Bacteria 1546
354 Ga0265323_10059204 3300028653 Bacteria 1336
355 Ga0265338_10040783 3300028800 Unclassified 4355
356 Ga0265338_10139464 3300028800 Bacteria 1901
357 Ga0265338_10290964 3300028800 Bacteria 1190
358 Ga0265338_10720231 3300028800 Unclassified 687
359 Ga0307511_10007902 3300030521 Bacteria 10674
360 Ga0265762_1036657 3300030760 Bacteria 947
361 Ga0265760_10007350 3300031090 Unclassified 3153
362 Ga0265760_10123513 3300031090 Unclassified 833
363 Ga0265330_10014174 3300031235 Unclassified 3700
364 Ga0265330_10328897 3300031235 Unclassified 645
365 Ga0265332_10064172 3300031238 Bacteria 1568
366 Ga0265325_10024718 3300031241 Bacteria 3265
367 Ga0265329_10015760 3300031242 Bacteria 2633
368 Ga0265340_10011862 3300031247 Bacteria 4616
369 Ga0265340_10044003 3300031247 Bacteria 2186
370 Ga0265339_10210445 3300031249 Bacteria 955
371 Ga0265331_10064720 3300031250 Bacteria 1720
372 Ga0265327_10188093 3300031251 Bacteria 941
373 Ga0265316_10025699 3300031344 Bacteria 4911
374 Ga0265316_10088418 3300031344 Bacteria 2365
375 Ga0265316_10364541 3300031344 Unclassified 1044
376 Ga0265313_10153413 3300031595 Unclassified 982
377 Ga0265313_10181603 3300031595 Bacteria 884
378 Ga0265314_10253052 3300031711 Bacteria 1010
379 Ga0265342_10010585 3300031712 Bacteria 6382
380 Ga0265342_10432185 3300031712 Bacteria 677
381 Ga0316576_10109617 3300031727 Bacteria 2069
382 Ga0316576_11004256 3300031727 Unclassified 594
383 Ga0316578_10012398 3300031728 Bacteria 4496
384 Ga0316577_10724256 3300031733 Bacteria 565
385 Ga0307416_100725304 3300032002 Unclassified 1085
386 Ga0373926_0008712 3300035083 Unclassified 3376
387 Ga0373934_0168349 3300035086 Unclassified 899
388 Ga0373944_0285937 3300035089 Unclassified 616
389 Ga0373936_0022398 3300035113 Bacteria 2460
390 Ga0373936_0161683 3300035113 Unclassified 976
391 Ga0373945_0059360 3300035116 Bacteria 1424
392 Ga0373953_0031343 3300035117 Bacteria 2067
393 Ga0373953_0243446 3300035117 Unclassified 781
394 Ga0373953_0299518 3300035117 Unclassified 702
395 Ga0373954_0099028 3300035118 Unclassified 1405
396 Ga0373956_0057195 3300035119 Bacteria 1762
397 Ga0373957_0003928 3300035120 Bacteria 4468
398 Ga0373943_0245233 3300035170 Bacteria 1005
399 Ga0373946_0022200 3300035171 Unclassified 2468
400 Ga0373955_0034030 3300035172 Bacteria 2687
401 Ga0373955_0615549 3300035172 Unclassified 665
402 Ga0316574_0893416 3300035398 Bacteria 538
403 Ga0373924_0080945 3300035410 Bacteria 1381
404 Ga0373935_0009234 3300035692 Bacteria 5902
405 Ga0373935_0160364 3300035692 Bacteria 1532
406 Ga0373935_0272237 3300035692 Bacteria 1190
407 Ga0373935_0287619 3300035692 Unclassified 1159
408 Ga0373927_0003545 3300035695 Bacteria 11157
409 Ga0373927_0006673 3300035695 Bacteria 7853
410 Ga0373927_0011054 3300035695 Bacteria 6013
411 Ga0373927_0017024 3300035695 Bacteria 4789
412 Ga0373927_0047155 3300035695 Bacteria 2787
413 Ga0373927_0648410 3300035695 Unclassified 698
414 Ga0373927_0693371 3300035695 Unclassified 673
415 Ga0373927_0904027 3300035695 Unclassified 583
416 Ga0373933_0039085 3300035724 Bacteria 2790
417 Ga0373947_0053458 3300035725 Unclassified 2435
418 Ga0373947_0136451 3300035725 Unclassified 1570
419 Ga0373947_0272390 3300035725 Unclassified 1124
420 Ga0373947_0576357 3300035725 Unclassified 766
421 Ga0373947_0734145 3300035725 Unclassified 674
422 Ga0373937_0061897 3300036401 Unclassified 3440
423 Ga0373937_0861131 3300036401 Unclassified 855
424 Ga0373925_0020353 3300037068 Unclassified 4829
425 Ga0373925_0057881 3300037068 Bacteria 2905
426 Ga0373925_0388737 3300037068 Unclassified 1137
427 Ga0373925_0404015 3300037068 Unclassified 1114
428 Ga0373925_0868107 3300037068 Unclassified 744
429 Ga0395898_0092741 3300037466 Bacteria 2904
430 Ga0395898_0402615 3300037466 Bacteria 1305
431 Ga0395905_1134610 3300037471 Unclassified 685
432 Ga0242420_082403 3300038996 Unclassified 666
433 Ga0400489_12244 3300039093 Unclassified 1226
434 Ga0400489_87871 3300039093 Unclassified 2961
435 Ga0436361_0422569 3300039447 Unclassified 596
436 Ga0436363_0717882 3300039450 Unclassified 572
437 Ga0466965_0848013 3300044683 Unclassified 531
438 Ga0466964_0081228 3300044706 Bacteria 1392
439 Ga0453684_0479304 3300044712 Bacteria 1380
440 Ga0466957_0000086 3300044842 Bacteria 37571
441 Ga0466959_0024910 3300045049 Bacteria 4432
442 Ga0451576_2057706 3300045051 Unclassified 588
443 Ga0466958_0630385 3300045836 Unclassified 698
444 Ga0466967_0234605 3300045976 Unclassified 1748
445 Ga0495629_0752397 3300046459 Bacteria 645
446 Ga0495651_0974499 3300046462 Bacteria 515
447 Ga0495653_0148235 3300046463 Bacteria 1642
448 Ga0495653_0735460 3300046463 Unclassified 597
449 Ga0495580_0124875 3300046472 Unclassified 1786
450 Ga0495608_0261642 3300046511 Bacteria 1077
451 Ga0495628_0047605 3300046516 Bacteria 3401
452 Ga0495630_0031714 3300046517 Unclassified 3936
453 Ga0495630_0458984 3300046517 Unclassified 976
454 Ga0495630_1064665 3300046517 Unclassified 614
455 Ga0495630_1460985 3300046517 Unclassified 513
456 Ga0495665_0451541 3300046531 Unclassified 650
457 Ga0495634_0600524 3300046642 Unclassified 639
458 Ga0495634_0879291 3300046642 Bacteria 508
459 Ga0495611_0306175 3300046648 Unclassified 732
460 Ga0495635_0389467 3300046663 Bacteria 927
461 Ga0495624_0095333 3300046690 Unclassified 1834
462 Ga0495674_0363003 3300047319 Unclassified 1174
463 Ga0495674_0762428 3300047319 Unclassified 755
464 Ga0495675_0595396 3300047444 Unclassified 627
465 Ga0495684_0443562 3300047471 Bacteria 903
466 Ga0495684_0932413 3300047471 Unclassified 557
467 Ga0495593_0164415 3300047673 Unclassified 1120
468 Ga0495602_0768591 3300048088 Unclassified 649
469 Ga0496100_0021457 3300048903 Unclassified 3890
470 Ga0496101_0023624 3300048904 Unclassified 4249
471 Ga0496102_0040349 3300048905 Unclassified 4222
472 Ga0496104_0523161 3300048907 Bacteria 1097
473 Ga0496105_0059696 3300048908 Bacteria 3147
474 Ga0496107_0845869 3300048910 Unclassified 668
475 Ga0496109_1449339 3300048912 Unclassified 622
476 Ga0496112_0149258 3300048915 Unclassified 2305
477 Ga0496112_1192538 3300048915 Unclassified 678
478 Ga0496113_0038390 3300048916 Unclassified 3521
479 Ga0496114_0000011 3300048917 Bacteria 348290
480 Ga0496114_0377319 3300048917 Bacteria 1255
481 Ga0496115_0061766 3300048918 Unclassified 3021
482 Ga0501036_0975451 3300049572 Unclassified 694
483 Ga0501040_0117673 3300049576 Bacteria 1863
484 Ga0501042_0128718 3300049578 Bacteria 1824
485 Ga0501047_0002739 3300049581 Bacteria 16783
486 Ga0501071_0046266 3300049587 Bacteria 3125
487 Ga0501072_0015566 3300049588 Bacteria 5829
488 Ga0501072_0835261 3300049588 Unclassified 721
489 Ga0501072_0889302 3300049588 Unclassified 696
490 Ga0501075_0435634 3300049591 Unclassified 1000
491 Ga0501075_1551627 3300049591 Bacteria 501
492 Ga0501076_0666865 3300049592 Unclassified 858
493 Ga0501077_0326598 3300049593 Unclassified 978
494 Ga0501081_0268371 3300049743 Bacteria 1248
495 Ga0501083_0136160 3300049744 Unclassified 1609
496 Ga0501035_0285051 3300049822 Bacteria 1395
497 Ga0501045_0856702 3300049824 Unclassified 668
498 nmdc:mga05p37_21_c1 3300050507 Bacteria 122678
499 nmdc:mga05p37_630291_c1 3300050507 Bacteria 1205
500 nmdc:mga09592_95133_c1 3300050508 Bacteria 2548
501 nmdc:mga06r32_815525_c1 3300050510 Bacteria 893
502 nmdc:mga06r32_905578_c1 3300050510 Bacteria 838
503 nmdc:mga08y16_329032_c1 3300050511 Bacteria 1572
504 nmdc:mga08y16_646555_c1 3300050511 Bacteria 1062
505 nmdc:mga0n895_5233_c1 3300050512 Bacteria 10810
506 nmdc:mga0rr50_563_c1 3300050513 Bacteria 19875
507 nmdc:mga08x19_23469_c1 3300050514 Bacteria 3826
508 nmdc:mga08x19_39179_c1 3300050514 Bacteria 3012
509 nmdc:mga08x19_63115_c1 3300050514 Unclassified 2403
510 nmdc:mga08x19_6662_c1 3300050514 Bacteria 6851
511 nmdc:mga0a205_1072206_c1 3300050515 Unclassified 653
512 nmdc:mga0a205_279_c1 3300050515 Bacteria 37324
513 Ga0495619_0092729 3300053085 Unclassified 2046
514 Ga0501084_0140475 3300054114 Unclassified 2034
515 Ga0466962_0102025 3300061719 Bacteria 1378
516 Ga0530510_0386755 3300061734 Unclassified 1053
517 Ga0111539_10649458
518 LJNas_1001234
519 LJQas_1000015
520 Ga0065715_10379454
521 Ga0065707_10398514
522 Ga0070690_100108777
523 Ga0070690_101204305
524 Ga0068869_100298956
525 Ga0070666_10002609
526 Ga0070666_10996474
527 Ga0070680_100316172
528 Ga0070680_100668046
529 Ga0068868_100013851
530 Ga0068868_100109086
531 Ga0068868_100456411
532 Ga0068868_100487443
533 Ga0070689_100053983
534 Ga0070689_100846438
535 Ga0070689_101646747
536 Ga0070674_100226086
537 Ga0070673_101822716
538 Ga0070673_102126054
539 Ga0070659_101419848
540 Ga0070667_100151848
541 Ga0070667_100445439
542 Ga0070667_101282199
543 Ga0070709_10000025
544 Ga0070709_10236284
545 Ga0070709_10441279
546 Ga0070709_11365043
547 Ga0070714_100071366
548 Ga0070714_100080156
549 Ga0070714_101236978
550 Ga0070713_100599502
551 Ga0070713_100707320
552 Ga0070713_100732884
553 Ga0070710_10003108
554 Ga0070711_100097305
555 Ga0070711_100203876
556 Ga0070711_100610362
557 Ga0070711_101813570
558 Ga0070705_100542767
559 Ga0070694_100264121
560 Ga0070708_100001818
561 Ga0070708_100010435
562 Ga0070708_100036273
563 Ga0070708_100085787
564 Ga0070708_100086917
565 Ga0070708_100139649
566 Ga0070708_100474256
567 Ga0070708_100574290
568 Ga0070708_101327250
569 Ga0070678_100522904
570 Ga0070681_10109184
571 Ga0068867_100337967
572 Ga0070706_100001531
573 Ga0070706_100137922
574 Ga0070706_100178861
575 Ga0070706_100184991
576 Ga0070706_100220583
577 Ga0070706_100284200
578 Ga0070706_100306583
579 Ga0070706_100420330
580 Ga0070707_100001339
581 Ga0070707_100044544
582 Ga0070707_100045055
583 Ga0070707_100091567
584 Ga0070707_100097405
585 Ga0070707_100178009
586 Ga0070707_101068022
587 Ga0070707_101410222
588 Ga0070698_100000131
589 Ga0070698_100014129
590 Ga0070698_100072972
591 Ga0070698_100131088
592 Ga0070698_100402855
593 Ga0070698_100579715
594 Ga0070699_100010852
595 Ga0070699_100022526
596 Ga0070699_100054844
597 Ga0070699_100756036
598 Ga0070699_101254049
599 Ga0070697_100000106
600 Ga0070697_100009226
601 Ga0070697_100018388
602 Ga0070697_100033186
603 Ga0070697_100130009
604 Ga0070697_100451173
605 Ga0070697_100705821
606 Ga0070697_100964705
607 Ga0070697_101118245
608 Ga0070695_100022346
609 Ga0070695_100085023
610 Ga0070695_100286929
611 Ga0070696_100324694
612 Ga0070693_100161773
613 Ga0070693_100697139
614 Ga0070665_100105329
615 Ga0070665_100340205
616 Ga0070704_100192093
617 Ga0070704_101692375
618 Ga0068855_102584978
619 Ga0070664_100352991
620 Ga0068854_100159975
621 Ga0068856_100015225
622 Ga0068856_100074099
623 Ga0068856_100245939
624 Ga0068856_101089933
625 Ga0068852_100340192
626 Ga0068859_100967460
627 Ga0068864_100267796
628 Ga0068864_100745954
629 Ga0068866_10045362
630 Ga0068851_10013799
631 Ga0068863_100295527
632 Ga0068858_100019749
633 Ga0068858_100026672
634 Ga0068860_100001188
635 Ga0068860_100006115
636 Ga0068860_100143828
637 Ga0068860_101842416
638 Ga0068860_102460812
639 Ga0070717_10006540
640 Ga0070717_10017247
641 Ga0070717_10246694
642 Ga0070717_10391656
643 Ga0070717_10437142
644 Ga0070717_10479288
645 Ga0070716_100035583
646 Ga0070716_100127178
647 Ga0097621_100032504
648 Ga0097621_100283269
649 Ga0097621_101776498
650 Ga0068871_100035026
651 Ga0068871_100070055
652 Ga0068871_100104951
653 Ga0075428_100107491
654 Ga0075428_100244612
655 Ga0075428_100497082
656 Ga0075430_100199938
657 Ga0075431_100856965
658 Ga0075431_101441277
659 Ga0075433_10000310
660 Ga0075433_11287077
661 Ga0075434_100003635
662 Ga0075434_100908225
663 Ga0075434_101872589
664 Ga0075429_100116032
665 Ga0068865_101622718
666 Ga0075436_100000246
667 Ga0075436_100012084
668 Ga0075436_100059203
669 Ga0075436_100069985
670 Ga0097620_100967316
671 Ga0075435_100000683
672 Ga0099794_10009817
673 Ga0099794_10016683
674 Ga0099794_10349598
675 Ga0105240_10248256
676 Ga0105240_10366782
677 Ga0105240_10382646
678 Ga0105240_10581108
679 Ga0105240_10986474
680 Ga0111539_10607492
681 Ga0105245_10007707
682 Ga0105245_10016475
683 Ga0105245_10060711
684 Ga0105245_10076511
685 Ga0105245_10255402
686 Ga0105245_10887368
687 Ga0105247_10123203
688 Ga0105247_10246391
689 Ga0114129_10000138
690 Ga0114129_10785405
691 Ga0114129_10900119
692 Ga0105241_10039980
693 Ga0105241_10109415
694 Ga0105241_10166623
695 Ga0105241_10273148
696 Ga0105241_11200067
697 Ga0105241_11312407
698 Ga0105241_11968906
699 Ga0105241_12473711
700 Ga0105242_10024647
701 Ga0105242_10026022
702 Ga0105242_10060242
703 Ga0105242_10151346
704 Ga0105242_10174797
705 Ga0105242_11426833
706 Ga0105242_12747096
707 Ga0105248_10080338
708 Ga0105248_10100295
709 Ga0105248_10228458
710 Ga0105248_10700322
711 Ga0105248_10919120
712 Ga0105237_10277518
713 Ga0105237_10731548
714 Ga0105237_10834094
715 Ga0105238_10002528
716 Ga0105238_10097706
717 Ga0105238_10520787
718 Ga0105238_11499026
719 Ga0105238_11878048
720 Ga0105249_10412319
721 Ga0105249_11868155
722 Ga0099796_10002818
723 Ga0099796_10003748
724 Ga0105239_10435190
725 Ga0105239_11103238
726 Ga0105239_11455047
727 Ga0105239_13171293
728 Ga0105246_10204246
729 Ga0105246_10286710
730 Ga0157373_10120644
731 Ga0157369_10026880
732 Ga0157374_10110494
733 Ga0157374_10207710
734 Ga0157374_10874026
735 Ga0157374_11478835
736 Ga0157378_10000013
737 Ga0157378_10000112
738 Ga0157378_10019881
739 Ga0157378_10109193
740 Ga0157378_10325644
741 Ga0157378_10459308
742 Ga0157378_11353822
743 Ga0157378_11870464
744 Ga0163162_10084748
745 Ga0163162_10539917
746 Ga0157372_10039850
747 Ga0157372_11177236
748 Ga0157372_11276975
749 Ga0157372_11681797
750 Ga0157372_13258160
751 Ga0157375_10148493
752 Ga0163163_10023482
753 Ga0163163_10479215
754 Ga0163163_10627248
755 Ga0157379_10015971
756 Ga0157379_10110616
757 Ga0157379_10913082
758 Ga0157379_11579877
759 Ga0157379_12098688
760 Ga0157376_10027188
761 Ga0157376_10067298
762 Ga0157376_10075688
763 Ga0157376_10666557
764 Ga0163161_10134347
765 Ga0224570_108953
766 Ga0224572_1015549
767 Ga0228598_1002153
768 Ga0228598_1008455
769 Ga0207692_10001901
770 Ga0207692_10281401
771 Ga0207642_10510880
772 Ga0207642_10568090
773 Ga0207680_10026649
774 Ga0207680_10597652
775 Ga0207699_10000036
776 Ga0207699_10033209
777 Ga0207699_10793748
778 Ga0207699_10808037
779 Ga0207684_10000726
780 Ga0207684_10000755
781 Ga0207684_10029913
782 Ga0207684_10145722
783 Ga0207684_10164099
784 Ga0207684_10288157
785 Ga0207684_10338054
786 Ga0207654_10024057
787 Ga0207654_10220978
788 Ga0207654_10241986
789 Ga0207654_11140200
790 Ga0207707_10165941
791 Ga0207695_10176354
792 Ga0207695_11072550
793 Ga0207695_11299158
794 Ga0207671_10654677
795 Ga0207671_11017813
796 Ga0207663_10058045
797 Ga0207663_10059265
798 Ga0207663_10164468
799 Ga0207663_10354548
800 Ga0207652_10592506
801 Ga0207646_10000299
802 Ga0207646_10006105
803 Ga0207646_10018615
804 Ga0207646_10044231
805 Ga0207646_10124387
806 Ga0207646_10145224
807 Ga0207646_10151721
808 Ga0207646_11774843
809 Ga0207694_10265002
810 Ga0207694_10806324
811 Ga0207687_10001735
812 Ga0207687_10008070
813 Ga0207687_10023316
814 Ga0207687_10176510
815 Ga0207687_10243249
816 Ga0207700_11052014
817 Ga0207664_10000037
818 Ga0207664_10070678
819 Ga0207664_10204934
820 Ga0207686_10168026
821 Ga0207686_11465384
822 Ga0207670_10003987
823 Ga0207670_10101544
824 Ga0207670_11448654
825 Ga0207704_10505418
826 Ga0207704_10896869
827 Ga0207665_10024240
828 Ga0207665_10077735
829 Ga0207665_10261125
830 Ga0207711_10337696
831 Ga0207711_10452613
832 Ga0207711_11222448
833 Ga0207689_11424591
834 Ga0207667_10734077
835 Ga0207712_11162110
836 Ga0207640_10543020
837 Ga0207658_10148254
838 Ga0207658_10205186
839 Ga0207658_11461067
840 Ga0207677_10000293
841 Ga0207677_10001027
842 Ga0207677_10006733
843 Ga0207677_10092334
844 Ga0207677_10170272
845 Ga0207677_12218036
846 Ga0207703_10011015
847 Ga0207703_10018092
848 Ga0207703_10410536
849 Ga0207702_10023057
850 Ga0207702_10036582
851 Ga0207702_10151960
852 Ga0207702_10487801
853 Ga0207641_10416020
854 Ga0207648_10888212
855 Ga0207676_10111707
856 Ga0207676_10763263
857 Ga0207674_10136062
858 Ga0209179_1048841
859 Ga0209588_1009387
860 Ga0265356_1002857
861 Ga0265355_1001422
862 Ga0268266_10132484
863 Ga0268265_11498860
864 Ga0268264_10039063
865 Ga0268264_10073658
866 Ga0268264_10086190
867 Ga0268264_10407811
868 Ga0268264_11634975
869 Ga0265334_10053248
870 Ga0265323_10059204
871 Ga0265338_10040783
872 Ga0265338_10139464
873 Ga0265338_10290964
874 Ga0265338_10720231
875 Ga0307511_10007902
876 Ga0265762_1036657
877 Ga0265760_10007350
878 Ga0265760_10123513
879 Ga0265330_10014174
880 Ga0265330_10328897
881 Ga0265332_10064172
882 Ga0265325_10024718
883 Ga0265329_10015760
884 Ga0265340_10011862
885 Ga0265340_10044003
886 Ga0265339_10210445
887 Ga0265331_10064720
888 Ga0265327_10188093
889 Ga0265316_10025699
890 Ga0265316_10088418
891 Ga0265316_10364541
892 Ga0265313_10153413
893 Ga0265313_10181603
894 Ga0265314_10253052
895 Ga0265342_10010585
896 Ga0265342_10432185
897 Ga0316576_10109617
898 Ga0316576_11004256
899 Ga0316578_10012398
900 Ga0316577_10724256
901 Ga0307416_100725304
902 Ga0373926_0008712
903 Ga0373934_0168349
904 Ga0373944_0285937
905 Ga0373936_0022398
906 Ga0373936_0161683
907 Ga0373945_0059360
908 Ga0373953_0031343
909 Ga0373953_0243446
910 Ga0373953_0299518
911 Ga0373954_0099028
912 Ga0373956_0057195
913 Ga0373957_0003928
914 Ga0373943_0245233
915 Ga0373946_0022200
916 Ga0373955_0034030
917 Ga0373955_0615549
918 Ga0316574_0893416
919 Ga0373924_0080945
920 Ga0373935_0009234
921 Ga0373935_0160364
922 Ga0373935_0272237
923 Ga0373935_0287619
924 Ga0373927_0003545
925 Ga0373927_0006673
926 Ga0373927_0011054
927 Ga0373927_0017024
928 Ga0373927_0047155
929 Ga0373927_0648410
930 Ga0373927_0693371
931 Ga0373927_0904027
932 Ga0373933_0039085
933 Ga0373947_0053458
934 Ga0373947_0136451
935 Ga0373947_0272390
936 Ga0373947_0576357
937 Ga0373947_0734145
938 Ga0373937_0061897
939 Ga0373937_0861131
940 Ga0373925_0020353
941 Ga0373925_0057881
942 Ga0373925_0388737
943 Ga0373925_0404015
944 Ga0373925_0868107
945 Ga0395898_0092741
946 Ga0395898_0402615
947 Ga0395905_1134610
948 Ga0242420_082403
949 Ga0400489_12244
950 Ga0400489_87871
951 Ga0436361_0422569
952 Ga0436363_0717882
953 Ga0466965_0848013
954 Ga0466964_0081228
955 Ga0453684_0479304
956 Ga0466957_0000086
957 Ga0466959_0024910
958 Ga0451576_2057706
959 Ga0466958_0630385
960 Ga0466967_0234605
961 Ga0495629_0752397
962 Ga0495651_0974499
963 Ga0495653_0148235
964 Ga0495653_0735460
965 Ga0495580_0124875
966 Ga0495608_0261642
967 Ga0495628_0047605
968 Ga0495630_0031714
969 Ga0495630_0458984
970 Ga0495630_1064665
971 Ga0495630_1460985
972 Ga0495665_0451541
973 Ga0495634_0600524
974 Ga0495634_0879291
975 Ga0495611_0306175
976 Ga0495635_0389467
977 Ga0495624_0095333
978 Ga0495674_0363003
979 Ga0495674_0762428
980 Ga0495675_0595396
981 Ga0495684_0443562
982 Ga0495684_0932413
983 Ga0495593_0164415
984 Ga0495602_0768591
985 Ga0496100_0021457
986 Ga0496101_0023624
987 Ga0496102_0040349
988 Ga0496104_0523161
989 Ga0496105_0059696
990 Ga0496107_0845869
991 Ga0496109_1449339
992 Ga0496112_0149258
993 Ga0496112_1192538
994 Ga0496113_0038390
995 Ga0496114_0000011
996 Ga0496114_0377319
997 Ga0496115_0061766
998 Ga0501036_0975451
999 Ga0501040_0117673
1000 Ga0501042_0128718
1001 Ga0501047_0002739
1002 Ga0501071_0046266
1003 Ga0501072_0015566
1004 Ga0501072_0835261
1005 Ga0501072_0889302
1006 Ga0501075_0435634
1007 Ga0501075_1551627
1008 Ga0501076_0666865
1009 Ga0501077_0326598
1010 Ga0501081_0268371
1011 Ga0501083_0136160
1012 Ga0501035_0285051
1013 Ga0501045_0856702
1014 nmdc:mga05p37_21_c1
1015 nmdc:mga05p37_630291_c1
1016 nmdc:mga09592_95133_c1
1017 nmdc:mga06r32_815525_c1
1018 nmdc:mga06r32_905578_c1
1019 nmdc:mga08y16_329032_c1
1020 nmdc:mga08y16_646555_c1
1021 nmdc:mga0n895_5233_c1
1022 nmdc:mga0rr50_563_c1
1023 nmdc:mga08x19_23469_c1
1024 nmdc:mga08x19_39179_c1
1025 nmdc:mga08x19_63115_c1
1026 nmdc:mga08x19_6662_c1
1027 nmdc:mga0a205_1072206_c1
1028 nmdc:mga0a205_279_c1
1029 Ga0495619_0092729
1030 Ga0501084_0140475
1031 Ga0466962_0102025
1032 Ga0530510_0386755

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

2

105

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hk0-assembly2.cif.gz_C crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9264 1 106
5uct-assembly1.cif.gz_A-2 mycobacterium tuberculosis toxin mazf-mt6 0.924 5 107
5hk0-assembly1.cif.gz_A crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.9223 1 106
5xe3-assembly1.cif.gz_A endoribonuclease in complex with its cognate antitoxin from mycobacterial species 0.9215 1 107
5hk0-assembly2.cif.gz_C crystal structure of m. tuberculosis mazf-mt3 (rv1991c) in complex with rna 0.91 1 106
ID Description Score Start End Superfamily
5hk0C00 Mainly Beta;Roll;SH3 type barrels.; 0.9264 1 106 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9213 3 105 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9196 1 107 2.30.30.110
5hk0C00 Mainly Beta;Roll;SH3 type barrels.; 0.91 1 106 2.30.30.110
5ccaB00 Mainly Beta;Roll;SH3 type barrels.; 0.8978 8 103 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A2V9YF39-F1-model_v4 MazF family transcriptional regulator 0.9998 1 107 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A1W9IDQ8-F1-model_v4 deleted 0.997 1 107
AF-A0A2V9Q4D9-F1-model_v4 MazF family transcriptional regulator 0.9946 1 107 GO:0003677
AF-A0A538Q256-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9946 1 107 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A1W9IDQ8-F1-model_v4 deleted 0.9878 1 107

Map