F457791

General Info

Members Datasets Scaffolds Average Seq Length
514 325 1026 189

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_122127_c1|nmdc:mga0k408_122127_c1_776_1465
Length 229
Sequence MSQPPCGAEETGEVGCDRYRCARFDRNWRRSRPAHDIEDAALKVAASSLRKGSVVDLDGKLYVVLSAENIHPGKGTPVTQLNMRRISDGVKISERYRTTEQVERAIVDDREHTFLYKDGDGYHFMNPVSYDQLTASEDIVGDASYYLQEGMAVTLSVHNDLPIAIELPRLATFEVTETEPSVKGQTASSSYKPAILSNGLRTMIPPYIGPGTRIVVLTEDGSYVERAKD

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
203 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
204 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
207 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
208 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
214 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
215 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
216 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
217 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
218 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
219 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
222 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
223 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
224 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
226 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
227 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
228 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
229 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
230 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
231 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
232 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
233 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
234 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
235 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
236 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
237 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
238 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
239 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
240 2643221583 Caulobacter sp. Root655 Isolate Unclassified
241 2643221584 Caulobacter sp. Root656 Isolate Unclassified
242 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
243 2643221640 Caulobacter sp. Root342 Isolate Unclassified
244 2643221642 Caulobacter sp. Root343 Isolate Unclassified
245 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
246 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
247 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
248 2643221736 Bosea sp. Root483D1 Isolate Unclassified
249 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
250 2818991435 Caulobacter henricii 536 Isolate Unclassified
251 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
252 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
253 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
254 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
255 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
256 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
257 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
258 2849560528 Caulobacter zeae 410 Isolate Unclassified
259 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
260 2851153111 Caulobacter radicis 736 Isolate Unclassified
261 2851182111 Bosea sp. Tri-44 Isolate Nodule
262 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
263 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
264 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
265 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
266 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
267 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
268 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
269 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
270 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
271 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
272 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
273 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
274 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
275 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
276 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
277 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
278 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
279 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
280 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
281 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
282 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
283 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
284 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
285 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
286 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
287 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
288 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
289 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
290 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
291 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
292 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
293 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
294 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
295 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
296 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
297 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
298 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
299 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
300 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
301 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
302 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
303 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
304 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
305 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
306 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
307 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
308 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
309 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
310 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
311 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
312 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
313 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
314 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
315 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
316 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
317 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
318 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
319 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
320 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
321 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
322 641522639 Methylobacterium sp. 4-46 Isolate Nodule
323 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
324 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
325 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.54
Metatranscriptomes 0
Isolates 19.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.01
Nodule 11.67
Rhizoplane 1.75
Rhizosphere 55.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_122127_c1 3300050493 Bacteria 1543
2 JGI24739J22299_10051783 3300001989 Bacteria 1323
3 JGI25165J46597_1000070 3300003214 Bacteria 193557
4 Ga0055524_1019361 3300003775 Bacteria 2328
5 Ga0055524_1029300 3300003775 Bacteria 1629
6 Ga0055536_1001029 3300003781 Bacteria 17623
7 Ga0055536_1001720 3300003781 Bacteria 12948
8 Ga0055528_1012419 3300003790 Bacteria 3308
9 Ga0055530_10001412 3300003791 Bacteria 17669
10 Ga0055530_10003561 3300003791 Bacteria 8761
11 Ga0055531_10000505 3300003794 Bacteria 35554
12 Ga0055531_10001803 3300003794 Bacteria 15205
13 Ga0055531_10008543 3300003794 Bacteria 5377
14 Ga0065165_1000602 3300005262 Bacteria 52602
15 Ga0065165_1001696 3300005262 Bacteria 22184
16 Ga0070676_10127200 3300005328 Bacteria 1607
17 Ga0070670_100000246 3300005331 Bacteria 48778
18 Ga0070670_100029328 3300005331 Bacteria 4736
19 Ga0068869_100256769 3300005334 Bacteria 1398
20 Ga0070680_100155732 3300005336 Bacteria 1919
21 Ga0070689_100935630 3300005340 Bacteria 768
22 Ga0070668_100000442 3300005347 Bacteria 27426
23 Ga0070668_100004635 3300005347 Bacteria 10182
24 Ga0070668_100022864 3300005347 Bacteria 4726
25 Ga0070669_100012551 3300005353 Bacteria 6008
26 Ga0070671_100001456 3300005355 Bacteria 17668
27 Ga0070667_100000206 3300005367 Bacteria 69487
28 Ga0070667_100003206 3300005367 Bacteria 14012
29 Ga0070667_100029160 3300005367 Bacteria 4596
30 Ga0070667_100186576 3300005367 Bacteria 1835
31 Ga0070667_100457986 3300005367 Bacteria 1166
32 Ga0070713_101390090 3300005436 Bacteria 681
33 Ga0070681_10023668 3300005458 Bacteria 6180
34 Ga0070679_100927118 3300005530 Bacteria 815
35 Ga0068853_100434370 3300005539 Bacteria 1233
36 Ga0068853_100484255 3300005539 Bacteria 1166
37 Ga0068853_100626438 3300005539 Bacteria 1023
38 Ga0070665_100001069 3300005548 Bacteria 34148
39 Ga0070665_100002062 3300005548 Bacteria 22580
40 Ga0070665_100195045 3300005548 Bacteria 2026
41 Ga0070665_100246463 3300005548 Bacteria 1787
42 Ga0068855_100015822 3300005563 Bacteria 9074
43 Ga0068855_100217237 3300005563 Bacteria 2146
44 Ga0068855_100226961 3300005563 Bacteria 2093
45 Ga0070664_100376087 3300005564 Bacteria 1296
46 Ga0068856_101153608 3300005614 Bacteria 792
47 Ga0068852_100219247 3300005616 Bacteria 1808
48 Ga0068859_100000075 3300005617 Bacteria 91974
49 Ga0068859_100035710 3300005617 Bacteria 4988
50 Ga0068859_100125197 3300005617 Bacteria 2639
51 Ga0068864_100000167 3300005618 Bacteria 60640
52 Ga0068864_100105213 3300005618 Bacteria 2508
53 Ga0068861_100357684 3300005719 Bacteria 1283
54 Ga0068863_100000235 3300005841 Bacteria 58707
55 Ga0068863_100000562 3300005841 Bacteria 37687
56 Ga0068863_100020565 3300005841 Bacteria 6308
57 Ga0068858_100004447 3300005842 Bacteria 13740
58 Ga0068858_100006922 3300005842 Bacteria 11019
59 Ga0068858_100045427 3300005842 Bacteria 4071
60 Ga0068858_100705793 3300005842 Bacteria 982
61 Ga0068860_100000226 3300005843 Bacteria 87552
62 Ga0068860_100000851 3300005843 Bacteria 34076
63 Ga0068860_100004103 3300005843 Bacteria 14913
64 Ga0068860_100027609 3300005843 Bacteria 5465
65 Ga0068862_100000445 3300005844 Bacteria 44965
66 Ga0068862_100011263 3300005844 Bacteria 7383
67 Ga0068862_100120747 3300005844 Bacteria 2309
68 Ga0068862_100283515 3300005844 Bacteria 1519
69 Ga0081455_10206721 3300005937 Bacteria 1466
70 Ga0081538_10002523 3300005981 Bacteria 17830
71 Ga0075365_10046942 3300006038 Bacteria 2838
72 Ga0075368_10050789 3300006042 Bacteria 1648
73 Ga0075363_100192123 3300006048 Bacteria 1165
74 Ga0075364_10000113 3300006051 Bacteria 33477
75 Ga0075367_10148162 3300006178 Bacteria 1456
76 Ga0075367_10177846 3300006178 Bacteria 1326
77 Ga0075367_10226574 3300006178 Bacteria 1170
78 Ga0075369_10012948 3300006186 Bacteria 3301
79 Ga0075369_10024190 3300006186 Bacteria 2515
80 Ga0075366_10012053 3300006195 Bacteria 4897
81 Ga0075366_10089368 3300006195 Bacteria 1845
82 Ga0075366_10127951 3300006195 Bacteria 1532
83 Ga0075370_10023261 3300006353 Bacteria 3411
84 Ga0075370_10198392 3300006353 Bacteria 1183
85 Ga0075370_10287109 3300006353 Bacteria 978
86 Ga0075429_100108541 3300006880 Bacteria 2426
87 Ga0068865_100001450 3300006881 Bacteria 13803
88 Ga0097620_100000075 3300006931 Bacteria 91974
89 Ga0097620_100035709 3300006931 Bacteria 4988
90 Ga0097620_100125196 3300006931 Bacteria 2639
91 Ga0099795_10033320 3300007788 Bacteria 1788
92 Ga0105250_10026748 3300009092 Bacteria 2324
93 Ga0105240_10002106 3300009093 Bacteria 32565
94 Ga0105240_10081528 3300009093 Bacteria 3976
95 Ga0105247_10537846 3300009101 Bacteria 857
96 Ga0105241_10297537 3300009174 Bacteria 1384
97 Ga0105242_10300647 3300009176 Bacteria 1465
98 Ga0105248_10006392 3300009177 Bacteria 12928
99 Ga0105248_10010260 3300009177 Bacteria 10311
100 Ga0105248_10013291 3300009177 Bacteria 9062
101 Ga0105248_10084283 3300009177 Bacteria 3575
102 Ga0105237_10027683 3300009545 Bacteria 5781
103 Ga0105237_10691346 3300009545 Bacteria 1027
104 Ga0105237_10865510 3300009545 Bacteria 911
105 Ga0105238_10026083 3300009551 Bacteria 5956
106 Ga0105238_10052059 3300009551 Bacteria 4116
107 Ga0105238_10334266 3300009551 Bacteria 1502
108 Ga0105249_10000581 3300009553 Bacteria 33426
109 Ga0105249_10152430 3300009553 Bacteria 2226
110 Ga0105239_10034140 3300010375 Bacteria 5585
111 Ga0105239_10103434 3300010375 Bacteria 3152
112 Ga0105239_10277076 3300010375 Bacteria 1888
113 Ga0105239_10664792 3300010375 Bacteria 1190
114 Ga0157373_10232757 3300013100 Bacteria 1301
115 Ga0157373_10381106 3300013100 Bacteria 1009
116 Ga0157370_10275001 3300013104 Bacteria 1556
117 Ga0157369_10386411 3300013105 Bacteria 1452
118 Ga0157369_11241905 3300013105 Bacteria 760
119 Ga0157378_10468546 3300013297 Bacteria 1253
120 Ga0163162_10077890 3300013306 Bacteria 3379
121 Ga0163162_10621702 3300013306 Bacteria 1205
122 Ga0157372_10038503 3300013307 Bacteria 5277
123 Ga0157372_10654248 3300013307 Bacteria 1224
124 Ga0163163_10008655 3300014325 Bacteria 9051
125 Ga0163163_10221431 3300014325 Bacteria 1941
126 Ga0163163_10242534 3300014325 Bacteria 1852
127 Ga0163163_10465438 3300014325 Bacteria 1325
128 Ga0157379_10148690 3300014968 Bacteria 2113
129 Ga0182005_1036254 3300015265 Bacteria 1341
130 Ga0213876_10000165 3300021384 Bacteria 69795
131 Ga0209026_1000002 3300025250 Bacteria 1136158
132 Ga0209759_1000381 3300025256 Bacteria 55381
133 Ga0209233_1000131 3300025261 Bacteria 205257
134 Ga0209233_1008027 3300025261 Bacteria 3297
135 Ga0209565_1000234 3300025263 Bacteria 60830
136 Ga0209673_1005235 3300025273 Bacteria 6605
137 Ga0209675_1010205 3300025291 Bacteria 3229
138 Ga0209676_1000043 3300025292 Bacteria 418680
139 Ga0209758_1001974 3300025297 Bacteria 22165
140 Ga0209758_1004024 3300025297 Bacteria 12679
141 Ga0209758_1006845 3300025297 Bacteria 7984
142 Ga0209758_1030262 3300025297 Bacteria 2246
143 Ga0209050_1000098 3300025298 Bacteria 236717
144 Ga0209050_1000729 3300025298 Bacteria 47913
145 Ga0209050_1001088 3300025298 Bacteria 33087
146 Ga0209256_1002229 3300025299 Bacteria 16533
147 Ga0209256_1009118 3300025299 Bacteria 4418
148 Ga0209256_1010078 3300025299 Bacteria 4022
149 Ga0209256_1012931 3300025299 Bacteria 3141
150 Ga0209051_1001677 3300025303 Bacteria 17853
151 Ga0209257_1000235 3300025304 Bacteria 129620
152 Ga0209257_1000246 3300025304 Bacteria 125942
153 Ga0209257_1000979 3300025304 Bacteria 38834
154 Ga0207710_10210464 3300025900 Bacteria 962
155 Ga0207710_10240532 3300025900 Bacteria 903
156 Ga0207680_10003381 3300025903 Bacteria 7515
157 Ga0207647_10018296 3300025904 Bacteria 4744
158 Ga0207645_10183324 3300025907 Bacteria 1374
159 Ga0207705_10055433 3300025909 Bacteria 2858
160 Ga0207705_10283836 3300025909 Bacteria 1268
161 Ga0207695_10002784 3300025913 Bacteria 25453
162 Ga0207695_10054649 3300025913 Bacteria 4168
163 Ga0207695_10103261 3300025913 Bacteria 2842
164 Ga0207671_10031519 3300025914 Bacteria 3950
165 Ga0207671_10226882 3300025914 Bacteria 1464
166 Ga0207662_10353019 3300025918 Bacteria 988
167 Ga0207657_10547937 3300025919 Bacteria 904
168 Ga0207652_11179278 3300025921 Bacteria 667
169 Ga0207681_10011039 3300025923 Bacteria 5548
170 Ga0207681_10116119 3300025923 Bacteria 1955
171 Ga0207694_10077909 3300025924 Bacteria 2598
172 Ga0207694_10672448 3300025924 Bacteria 873
173 Ga0207650_10000031 3300025925 Bacteria 230128
174 Ga0207650_10009830 3300025925 Bacteria 6543
175 Ga0207644_10155226 3300025931 Bacteria 1774
176 Ga0207669_10662202 3300025937 Bacteria 855
177 Ga0207711_10008400 3300025941 Bacteria 8637
178 Ga0207711_10021527 3300025941 Bacteria 5386
179 Ga0207711_10105155 3300025941 Bacteria 2503
180 Ga0207711_10368463 3300025941 Bacteria 1332
181 Ga0207689_10262188 3300025942 Bacteria 1430
182 Ga0207667_10140891 3300025949 Bacteria 2483
183 Ga0207667_10198925 3300025949 Bacteria 2056
184 Ga0207667_10228044 3300025949 Bacteria 1908
185 Ga0207667_10768079 3300025949 Bacteria 962
186 Ga0207712_10015421 3300025961 Bacteria 4931
187 Ga0207712_10076980 3300025961 Bacteria 2416
188 Ga0207668_10000018 3300025972 Bacteria 158577
189 Ga0207668_10000680 3300025972 Bacteria 20866
190 Ga0207668_10000978 3300025972 Bacteria 17178
191 Ga0207640_10759257 3300025981 Bacteria 837
192 Ga0207658_10000581 3300025986 Bacteria 32905
193 Ga0207658_10003900 3300025986 Bacteria 10491
194 Ga0207658_10016417 3300025986 Bacteria 5093
195 Ga0207658_10024159 3300025986 Bacteria 4249
196 Ga0207703_10001015 3300026035 Bacteria 26978
197 Ga0207703_10016937 3300026035 Bacteria 5684
198 Ga0207703_10061534 3300026035 Bacteria 3073
199 Ga0207639_10031923 3300026041 Bacteria 3873
200 Ga0207639_10206495 3300026041 Bacteria 1688
201 Ga0207639_10231202 3300026041 Bacteria 1603
202 Ga0207639_10459685 3300026041 Bacteria 1157
203 Ga0207702_10126105 3300026078 Bacteria 2298
204 Ga0207641_10000019 3300026088 Bacteria 295899
205 Ga0207641_10000697 3300026088 Bacteria 36201
206 Ga0207641_10065243 3300026088 Bacteria 3114
207 Ga0207676_10000763 3300026095 Bacteria 25158
208 Ga0207676_10002092 3300026095 Bacteria 14460
209 Ga0207676_10159074 3300026095 Bacteria 1955
210 Ga0207674_10144673 3300026116 Bacteria 2336
211 Ga0207675_100581032 3300026118 Bacteria 1122
212 Ga0207675_101060599 3300026118 Bacteria 830
213 Ga0207698_10189394 3300026142 Bacteria 1831
214 Ga0207698_10856018 3300026142 Bacteria 914
215 Ga0209813_10022589 3300027866 Bacteria 1781
216 Ga0268266_10002757 3300028379 Bacteria 18364
217 Ga0268266_10006655 3300028379 Bacteria 10545
218 Ga0268266_10209498 3300028379 Bacteria 1787
219 Ga0268265_10000923 3300028380 Bacteria 27194
220 Ga0268265_10008899 3300028380 Bacteria 6785
221 Ga0268265_10019723 3300028380 Bacteria 4694
222 Ga0268264_10000110 3300028381 Bacteria 206663
223 Ga0268264_10000361 3300028381 Bacteria 67632
224 Ga0268264_10024343 3300028381 Bacteria 4944
225 Ga0268264_10490770 3300028381 Bacteria 1196
226 Ga0307515_10053988 3300028794 Bacteria 5910
227 Ga0265338_10024459 3300028800 Bacteria 6169
228 Ga0265338_10051962 3300028800 Bacteria 3684
229 Ga0307511_10224932 3300030521 Bacteria 937
230 Ga0265320_10056071 3300031240 Bacteria 1895
231 Ga0265327_10003250 3300031251 Bacteria 15764
232 Ga0265327_10084656 3300031251 Bacteria 1558
233 Ga0307513_10001833 3300031456 Bacteria 30170
234 Ga0307408_101116169 3300031548 Bacteria 732
235 Ga0265314_10081090 3300031711 Bacteria 2139
236 Ga0307516_10000001 3300031730 Bacteria 510338
237 Ga0307406_10095971 3300031901 Bacteria 2008
238 Ga0373951_0137904 3300035091 Bacteria 675
239 Ga0373935_0047292 3300035692 Bacteria 2720
240 Ga0373935_0143464 3300035692 Bacteria 1615
241 Ga0373947_0080955 3300035725 Bacteria 2010
242 Ga0373937_0098993 3300036401 Bacteria 2705
243 Ga0373937_1008789 3300036401 Bacteria 781
244 Ga0373925_0048359 3300037068 Bacteria 3169
245 Ga0373925_0515447 3300037068 Bacteria 982
246 Ga0395899_0000030 3300037312 Bacteria 329063
247 Ga0395899_0014636 3300037312 Bacteria 5987
248 Ga0395899_0186835 3300037312 Bacteria 1452
249 Ga0395900_0000009 3300037418 Bacteria 476249
250 Ga0395900_0000023 3300037418 Bacteria 336048
251 Ga0395900_0158114 3300037418 Bacteria 2314
252 Ga0395900_0568784 3300037418 Bacteria 1076
253 Ga0395900_0600958 3300037418 Bacteria 1041
254 Ga0395900_1051998 3300037418 Bacteria 732
255 Ga0395898_0000038 3300037466 Bacteria 329063
256 Ga0395898_0012203 3300037466 Bacteria 8886
257 Ga0395898_0053337 3300037466 Bacteria 3949
258 Ga0395898_0175926 3300037466 Bacteria 2045
259 Ga0395898_0267821 3300037466 Bacteria 1629
260 Ga0395898_0311882 3300037466 Bacteria 1501
261 Ga0395905_0000021 3300037471 Bacteria 329054
262 Ga0395905_0012294 3300037471 Bacteria 8242
263 Ga0395905_0012952 3300037471 Bacteria 8017
264 Ga0395905_0020775 3300037471 Bacteria 6217
265 Ga0395905_0148670 3300037471 Bacteria 2204
266 Ga0395905_0151712 3300037471 Bacteria 2180
267 Ga0436364_0606945 3300037853 Bacteria 1573
268 Ga0436364_1191731 3300037853 Bacteria 1000
269 Ga0395901_0000014 3300038443 Bacteria 375100
270 Ga0395901_0000018 3300038443 Bacteria 336048
271 Ga0395901_0072220 3300038443 Bacteria 3597
272 Ga0395901_0086114 3300038443 Bacteria 3285
273 Ga0395901_0123885 3300038443 Bacteria 2716
274 Ga0395901_0161522 3300038443 Bacteria 2353
275 Ga0395901_0182463 3300038443 Bacteria 2201
276 Ga0395901_0458164 3300038443 Bacteria 1303
277 Ga0395901_0538770 3300038443 Bacteria 1184
278 Ga0436365_1563942 3300039437 Bacteria 128562
279 Ga0436365_1710079 3300039437 Bacteria 1866
280 Ga0436361_0184346 3300039447 Bacteria 628
281 Ga0436363_0634210 3300039450 Bacteria 5579
282 Ga0436362_0556131 3300039453 Bacteria 641
283 Ga0466969_0083710 3300044656 Bacteria 1519
284 Ga0466965_0088599 3300044683 Bacteria 1572
285 Ga0466965_0398302 3300044683 Bacteria 760
286 Ga0466961_0165743 3300044693 Bacteria 1376
287 Ga0466968_0025848 3300044735 Bacteria 2406
288 Ga0466957_0149076 3300044842 Bacteria 1512
289 Ga0466959_0220463 3300045049 Bacteria 1316
290 Ga0495590_0000622 3300046457 Bacteria 16501
291 Ga0495650_0045955 3300046471 Bacteria 1835
292 Ga0495594_0056684 3300046499 Bacteria 2163
293 Ga0495596_0301706 3300046500 Bacteria 623
294 Ga0495583_0000013 3300046506 Bacteria 323372
295 Ga0495606_0143901 3300046507 Bacteria 1406
296 Ga0495620_0032331 3300046515 Bacteria 2385
297 Ga0495628_0240141 3300046516 Bacteria 1355
298 Ga0495631_0002661 3300046518 Bacteria 9960
299 Ga0495643_0123281 3300046522 Bacteria 1307
300 Ga0495643_0295660 3300046522 Bacteria 740
301 Ga0495648_0000575 3300046524 Bacteria 39312
302 Ga0495648_0236721 3300046524 Bacteria 890
303 Ga0495652_0096276 3300046529 Bacteria 2411
304 Ga0495652_0238002 3300046529 Bacteria 1357
305 Ga0495654_0111930 3300046530 Bacteria 1244
306 Ga0495609_0054958 3300046538 Bacteria 1767
307 Ga0495597_0006546 3300046542 Bacteria 6011
308 Ga0495668_0000061 3300046616 Bacteria 192499
309 Ga0495668_0007234 3300046616 Bacteria 7123
310 Ga0495668_0020502 3300046616 Bacteria 3803
311 Ga0495668_0064483 3300046616 Bacteria 2016
312 Ga0495668_0175778 3300046616 Bacteria 1173
313 Ga0495668_0322518 3300046616 Bacteria 847
314 Ga0495613_0001148 3300046689 Bacteria 20201
315 Ga0495600_0164215 3300046809 Bacteria 1435
316 Ga0495604_0305200 3300047317 Bacteria 1068
317 Ga0495680_0283445 3300047322 Bacteria 1167
318 Ga0495673_0000264 3300047469 Bacteria 72931
319 Ga0495686_0001221 3300047472 Bacteria 29433
320 Ga0495593_0249578 3300047673 Bacteria 888
321 Ga0496102_0055772 3300048905 Bacteria 3603
322 Ga0496102_0767369 3300048905 Bacteria 887
323 Ga0496103_0365693 3300048906 Bacteria 927
324 Ga0496105_0702661 3300048908 Bacteria 776
325 Ga0496106_0339712 3300048909 Bacteria 1206
326 Ga0496112_0133536 3300048915 Bacteria 2452
327 Ga0496113_0497899 3300048916 Bacteria 978
328 Ga0496113_0988498 3300048916 Bacteria 663
329 Ga0496117_0020420 3300048920 Bacteria 5400
330 Ga0496118_0045681 3300048921 Bacteria 3415
331 Ga0496119_0030754 3300048922 Bacteria 3614
332 Ga0496120_0001808 3300048923 Bacteria 23949
333 Ga0496120_0106214 3300048923 Bacteria 1475
334 Ga0496121_0000699 3300048924 Bacteria 62415
335 Ga0496121_0179262 3300048924 Bacteria 1531
336 Ga0496121_0306550 3300048924 Bacteria 1075
337 Ga0496122_0103067 3300048925 Bacteria 1900
338 Ga0496124_0018292 3300048927 Bacteria 6566
339 Ga0496125_0004567 3300048928 Bacteria 15871
340 Ga0496125_0111024 3300048928 Bacteria 1986
341 Ga0496126_0002022 3300048929 Bacteria 28683
342 Ga0501034_0177460 3300049571 Bacteria 2096
343 Ga0501034_0265255 3300049571 Bacteria 1659
344 Ga0501037_0063570 3300049573 Bacteria 2690
345 Ga0501037_0577295 3300049573 Bacteria 757
346 Ga0501041_0314460 3300049577 Bacteria 988
347 Ga0501047_0096870 3300049581 Bacteria 2829
348 Ga0501070_0059110 3300049586 Bacteria 3178
349 Ga0501070_0867231 3300049586 Bacteria 706
350 Ga0501257_006423 3300049686 Bacteria 2607
351 Ga0501044_0049510 3300049823 Bacteria 4337
352 Ga0501044_0089414 3300049823 Bacteria 3108
353 Ga0501044_0898125 3300049823 Bacteria 761
354 Ga0501045_0732856 3300049824 Bacteria 729
355 nmdc:mga03n38_5652_c1 3300050490 Bacteria 4277
356 nmdc:mga00v17_196771_c1 3300050491 Bacteria 1302
357 nmdc:mga00v17_229_c1 3300050491 Bacteria 33373
358 nmdc:mga0yw44_2416_c1 3300050492 Bacteria 5429
359 nmdc:mga0yw44_535458_c1 3300050492 Bacteria 795
360 nmdc:mga06z11_41168_c1 3300050494 Bacteria 2311
361 nmdc:mga06z11_41738_c1 3300050494 Bacteria 2297
362 nmdc:mga04h51_65396_c1 3300050495 Bacteria 1257
363 nmdc:mga07m45_1287_c1 3300050496 Bacteria 11425
364 nmdc:mga07m45_209046_c1 3300050496 Bacteria 1135
365 nmdc:mga07m45_463343_c1 3300050496 Bacteria 735
366 nmdc:mga09592_103176_c1 3300050508 Bacteria 2443
367 nmdc:mga0qj67_158783_c1 3300050509 Bacteria 1835
368 nmdc:mga0sz30_105696_c1 3300050516 Bacteria 1232
369 nmdc:mga0sz30_2167_c2 3300050516 Bacteria 6211
370 Ga0500635_0000143 3300053080 Bacteria 40708
371 Ga0495595_0050543 3300053084 Bacteria 1925
372 Ga0500578_0000070 3300053086 Bacteria 113202
373 Ga0500643_000745 3300053087 Bacteria 21249
374 Ga0500644_0000087 3300053088 Bacteria 56947
375 Ga0500647_0014739 3300053091 Bacteria 3560
376 Ga0500647_0021020 3300053091 Bacteria 3043
377 Ga0500651_0113848 3300053093 Bacteria 1648
378 Ga0500651_0163734 3300053093 Bacteria 1329
379 Ga0500566_0025000 3300053094 Bacteria 3502
380 Ga0500641_0000614 3300053096 Bacteria 12863
381 Ga0500641_0000941 3300053096 Bacteria 10396
382 Ga0500554_001394 3300053102 Bacteria 4679
383 Ga0500555_064838 3300053103 Bacteria 975
384 Ga0500556_0001335 3300053104 Bacteria 10914
385 Ga0500556_0018502 3300053104 Bacteria 2200
386 Ga0500562_000696 3300053108 Bacteria 8217
387 Ga0500562_001115 3300053108 Bacteria 6601
388 Ga0500562_007063 3300053108 Bacteria 2834
389 Ga0500562_007559 3300053108 Bacteria 2742
390 Ga0500572_000529 3300053111 Bacteria 12963
391 Ga0500572_065295 3300053111 Bacteria 1114
392 Ga0500595_010629 3300053119 Bacteria 3649
393 Ga0500608_004669 3300053122 Bacteria 5334
394 Ga0500559_0000018 3300053136 Bacteria 140924
395 Ga0500559_0000060 3300053136 Bacteria 87673
396 Ga0500559_0039766 3300053136 Bacteria 2046
397 Ga0500559_0269917 3300053136 Bacteria 800
398 Ga0500564_000023 3300053138 Bacteria 45842
399 Ga0500588_0237884 3300053146 Bacteria 682
400 Ga0500616_0010142 3300053153 Bacteria 5659
401 Ga0500616_0112704 3300053153 Bacteria 1311
402 Ga0500622_0005631 3300053156 Bacteria 7461
403 Ga0500622_0005992 3300053156 Bacteria 7145
404 Ga0500622_0010072 3300053156 Bacteria 5207
405 Ga0500622_0012633 3300053156 Bacteria 4571
406 Ga0500622_0056547 3300053156 Bacteria 2008
407 Ga0500638_022118 3300053162 Bacteria 3009
408 Ga0500636_0004384 3300053177 Bacteria 7984
409 Ga0500636_0082482 3300053177 Bacteria 1851
410 Ga0500625_091899 3300053729 Bacteria 1296
411 Ga0500645_000833 3300053730 Bacteria 18318
412 Ga0500645_000995 3300053730 Bacteria 15986
413 Ga0500645_016857 3300053730 Bacteria 2297
414 2511121300 2510917020 Bacteria 5657507
415 2513611842 2513237090 Bacteria 7096802
416 2545677323 2545555834 Bacteria 8130841
417 2585146609 2582581279 Bacteria 4980720
418 2585151535 2582581280 Bacteria 5994497
419 2585195591 2582581293 Bacteria 5907401
420 2587917749 2585428106 Bacteria 5179711
421 2599937330 2599185301 Bacteria 6161860
422 2643749300 2643221545 Bacteria 5083237
423 2643770369 2643221550 Bacteria 4619371
424 2643776173 2643221551 Bacteria 3750538
425 2643781423 2643221552 Bacteria 5708754
426 2643794620 2643221555 Bacteria 3749717
427 2643838371 2643221564 Bacteria 4193379
428 2643923112 2643221583 Bacteria 5218014
429 2643929106 2643221584 Bacteria 5511711
430 2644085468 2643221614 Bacteria 4260023
431 2644226731 2643221640 Bacteria 5258820
432 2644233799 2643221642 Bacteria 5357871
433 2644343020 2643221661 Bacteria 4267604
434 2644366320 2643221666 Bacteria 4265935
435 2644508926 2643221691 Bacteria 5093099
436 2644742564 2643221736 Bacteria 6608466
437 2792461152 2791355048 Bacteria 5832535
438 2819536399 2818991435 Bacteria 5433759
439 2819644654 2818991454 Bacteria 5563326
440 2835316846 2835312727 Bacteria 7413381
441 2841915501 2841911363 Bacteria 6173697
442 2841920703 2841917233 Bacteria 6173500
443 2843749439 2843744320 Bacteria 5659202
444 2847671198 2847670302 Bacteria 6165597
445 2847687336 2847686936 Bacteria 6278406
446 2849562427 2849560528 Bacteria 5393480
447 2849573806 2849573788 Bacteria 5421256
448 2851156967 2851153111 Bacteria 5542585
449 2851185210 2851182111 Bacteria 6047226
450 2856316711 2856314179 Bacteria 6477897
451 2856353242 2856349417 Bacteria 6230045
452 2857355238 2857349434 Bacteria 7926032
453 2871449498 2871444079 Bacteria 6423508
454 2871495950 2871495908 Bacteria 6935695
455 2874102867 2874102143 Bacteria 6342645
456 2876370282 2876369609 Bacteria 6807521
457 2876381881 2876377896 Bacteria 6565995
458 2876395549 2876392853 Bacteria 6660880
459 2878036921 2878035449 Bacteria 6555736
460 2878760183 2878760144 Bacteria 6823465
461 2878767143 2878767105 Bacteria 6898628
462 2881152260 2881147464 Bacteria 7779814
463 2881156735 2881155292 Bacteria 6461656
464 2881162143 2881161766 Bacteria 7127907
465 2881854775 2881853255 Bacteria 6698367
466 2884300253 2884298095 Bacteria 3823049
467 2884961662 2884960567 Bacteria 5437054
468 2885310981 2885305155 Bacteria 7348390
469 2885329826 2885326080 Bacteria 7134805
470 2885339634 2885334103 Bacteria 7216818
471 2885349019 2885342637 Bacteria 7011821
472 2885356822 2885350715 Bacteria 6787678
473 2889307620 2889306138 Bacteria 6358934
474 2898334030 2898329390 Bacteria 5168154
475 2903540745 2903540706 Bacteria 7062119
476 2904662180 2904659560 Bacteria 6685615
477 2906332657 2906328253 Bacteria 6585166
478 2906416848 2906414383 Bacteria 6580790
479 2919455441 2919450847 Bacteria 5631160
480 2922161226 2922158528 Bacteria 6573167
481 2924727109 2924726620 Bacteria 6271473
482 2928531398 2928531327 Bacteria 5101314
483 2937894527 2937891427 Bacteria 6357007
484 2937994600 2937994558 Bacteria 7036190
485 2938019767 2938014810 Bacteria 6700592
486 2939670505 2939669807 Bacteria 5028511
487 2958117684 2958115193 Bacteria 6923548
488 2958165078 2958165035 Bacteria 6906348
489 2961117334 2961114664 Bacteria 6680456
490 2961132059 2961127735 Bacteria 7196641
491 2961163538 2961163497 Bacteria 6901077
492 2965018341 2965018300 Bacteria 6883036
493 2965063214 2965062239 Bacteria 7412989
494 2968096698 2968091066 Bacteria 6052692
495 2968099900 2968097103 Bacteria 6107094
496 2968113242 2968110612 Bacteria 6814636
497 2968123586 2968117919 Bacteria 6536078
498 2968132865 2968128360 Bacteria 6270294
499 2968171941 2968171901 Bacteria 6894245
500 2970555034 2970554993 Bacteria 6814252
501 2977864595 2977858184 Bacteria 6215359
502 2977866439 2977864932 Bacteria 7534097
503 2977948782 2977942078 Bacteria 7570577
504 2979780124 2979779861 Bacteria 6219781
505 2987640371 2987636660 Bacteria 8088555
506 2987659546 2987659509 Bacteria 6966464
507 2996347251 2996341866 Bacteria 6643098
508 3004188589 3004188549 Bacteria 6952365
509 3004208569 3004203850 Bacteria 7307914
510 641640707 641522639 Bacteria 7737025
511 8001849600 8001845381 Bacteria 5804942
512 8004451208 8004445564 Bacteria 6322258
513 8004711567 8004703790 Bacteria 8006957
514 nmdc:mga0k408_122127_c1
515 JGI24739J22299_10051783
516 JGI25165J46597_1000070
517 Ga0055524_1019361
518 Ga0055524_1029300
519 Ga0055536_1001029
520 Ga0055536_1001720
521 Ga0055528_1012419
522 Ga0055530_10001412
523 Ga0055530_10003561
524 Ga0055531_10000505
525 Ga0055531_10001803
526 Ga0055531_10008543
527 Ga0065165_1000602
528 Ga0065165_1001696
529 Ga0070676_10127200
530 Ga0070670_100000246
531 Ga0070670_100029328
532 Ga0068869_100256769
533 Ga0070680_100155732
534 Ga0070689_100935630
535 Ga0070668_100000442
536 Ga0070668_100004635
537 Ga0070668_100022864
538 Ga0070669_100012551
539 Ga0070671_100001456
540 Ga0070667_100000206
541 Ga0070667_100003206
542 Ga0070667_100029160
543 Ga0070667_100186576
544 Ga0070667_100457986
545 Ga0070713_101390090
546 Ga0070681_10023668
547 Ga0070679_100927118
548 Ga0068853_100434370
549 Ga0068853_100484255
550 Ga0068853_100626438
551 Ga0070665_100001069
552 Ga0070665_100002062
553 Ga0070665_100195045
554 Ga0070665_100246463
555 Ga0068855_100015822
556 Ga0068855_100217237
557 Ga0068855_100226961
558 Ga0070664_100376087
559 Ga0068856_101153608
560 Ga0068852_100219247
561 Ga0068859_100000075
562 Ga0068859_100035710
563 Ga0068859_100125197
564 Ga0068864_100000167
565 Ga0068864_100105213
566 Ga0068861_100357684
567 Ga0068863_100000235
568 Ga0068863_100000562
569 Ga0068863_100020565
570 Ga0068858_100004447
571 Ga0068858_100006922
572 Ga0068858_100045427
573 Ga0068858_100705793
574 Ga0068860_100000226
575 Ga0068860_100000851
576 Ga0068860_100004103
577 Ga0068860_100027609
578 Ga0068862_100000445
579 Ga0068862_100011263
580 Ga0068862_100120747
581 Ga0068862_100283515
582 Ga0081455_10206721
583 Ga0081538_10002523
584 Ga0075365_10046942
585 Ga0075368_10050789
586 Ga0075363_100192123
587 Ga0075364_10000113
588 Ga0075367_10148162
589 Ga0075367_10177846
590 Ga0075367_10226574
591 Ga0075369_10012948
592 Ga0075369_10024190
593 Ga0075366_10012053
594 Ga0075366_10089368
595 Ga0075366_10127951
596 Ga0075370_10023261
597 Ga0075370_10198392
598 Ga0075370_10287109
599 Ga0075429_100108541
600 Ga0068865_100001450
601 Ga0097620_100000075
602 Ga0097620_100035709
603 Ga0097620_100125196
604 Ga0099795_10033320
605 Ga0105250_10026748
606 Ga0105240_10002106
607 Ga0105240_10081528
608 Ga0105247_10537846
609 Ga0105241_10297537
610 Ga0105242_10300647
611 Ga0105248_10006392
612 Ga0105248_10010260
613 Ga0105248_10013291
614 Ga0105248_10084283
615 Ga0105237_10027683
616 Ga0105237_10691346
617 Ga0105237_10865510
618 Ga0105238_10026083
619 Ga0105238_10052059
620 Ga0105238_10334266
621 Ga0105249_10000581
622 Ga0105249_10152430
623 Ga0105239_10034140
624 Ga0105239_10103434
625 Ga0105239_10277076
626 Ga0105239_10664792
627 Ga0157373_10232757
628 Ga0157373_10381106
629 Ga0157370_10275001
630 Ga0157369_10386411
631 Ga0157369_11241905
632 Ga0157378_10468546
633 Ga0163162_10077890
634 Ga0163162_10621702
635 Ga0157372_10038503
636 Ga0157372_10654248
637 Ga0163163_10008655
638 Ga0163163_10221431
639 Ga0163163_10242534
640 Ga0163163_10465438
641 Ga0157379_10148690
642 Ga0182005_1036254
643 Ga0213876_10000165
644 Ga0209026_1000002
645 Ga0209759_1000381
646 Ga0209233_1000131
647 Ga0209233_1008027
648 Ga0209565_1000234
649 Ga0209673_1005235
650 Ga0209675_1010205
651 Ga0209676_1000043
652 Ga0209758_1001974
653 Ga0209758_1004024
654 Ga0209758_1006845
655 Ga0209758_1030262
656 Ga0209050_1000098
657 Ga0209050_1000729
658 Ga0209050_1001088
659 Ga0209256_1002229
660 Ga0209256_1009118
661 Ga0209256_1010078
662 Ga0209256_1012931
663 Ga0209051_1001677
664 Ga0209257_1000235
665 Ga0209257_1000246
666 Ga0209257_1000979
667 Ga0207710_10210464
668 Ga0207710_10240532
669 Ga0207680_10003381
670 Ga0207647_10018296
671 Ga0207645_10183324
672 Ga0207705_10055433
673 Ga0207705_10283836
674 Ga0207695_10002784
675 Ga0207695_10054649
676 Ga0207695_10103261
677 Ga0207671_10031519
678 Ga0207671_10226882
679 Ga0207662_10353019
680 Ga0207657_10547937
681 Ga0207652_11179278
682 Ga0207681_10011039
683 Ga0207681_10116119
684 Ga0207694_10077909
685 Ga0207694_10672448
686 Ga0207650_10000031
687 Ga0207650_10009830
688 Ga0207644_10155226
689 Ga0207669_10662202
690 Ga0207711_10008400
691 Ga0207711_10021527
692 Ga0207711_10105155
693 Ga0207711_10368463
694 Ga0207689_10262188
695 Ga0207667_10140891
696 Ga0207667_10198925
697 Ga0207667_10228044
698 Ga0207667_10768079
699 Ga0207712_10015421
700 Ga0207712_10076980
701 Ga0207668_10000018
702 Ga0207668_10000680
703 Ga0207668_10000978
704 Ga0207640_10759257
705 Ga0207658_10000581
706 Ga0207658_10003900
707 Ga0207658_10016417
708 Ga0207658_10024159
709 Ga0207703_10001015
710 Ga0207703_10016937
711 Ga0207703_10061534
712 Ga0207639_10031923
713 Ga0207639_10206495
714 Ga0207639_10231202
715 Ga0207639_10459685
716 Ga0207702_10126105
717 Ga0207641_10000019
718 Ga0207641_10000697
719 Ga0207641_10065243
720 Ga0207676_10000763
721 Ga0207676_10002092
722 Ga0207676_10159074
723 Ga0207674_10144673
724 Ga0207675_100581032
725 Ga0207675_101060599
726 Ga0207698_10189394
727 Ga0207698_10856018
728 Ga0209813_10022589
729 Ga0268266_10002757
730 Ga0268266_10006655
731 Ga0268266_10209498
732 Ga0268265_10000923
733 Ga0268265_10008899
734 Ga0268265_10019723
735 Ga0268264_10000110
736 Ga0268264_10000361
737 Ga0268264_10024343
738 Ga0268264_10490770
739 Ga0307515_10053988
740 Ga0265338_10024459
741 Ga0265338_10051962
742 Ga0307511_10224932
743 Ga0265320_10056071
744 Ga0265327_10003250
745 Ga0265327_10084656
746 Ga0307513_10001833
747 Ga0307408_101116169
748 Ga0265314_10081090
749 Ga0307516_10000001
750 Ga0307406_10095971
751 Ga0373951_0137904
752 Ga0373935_0047292
753 Ga0373935_0143464
754 Ga0373947_0080955
755 Ga0373937_0098993
756 Ga0373937_1008789
757 Ga0373925_0048359
758 Ga0373925_0515447
759 Ga0395899_0000030
760 Ga0395899_0014636
761 Ga0395899_0186835
762 Ga0395900_0000009
763 Ga0395900_0000023
764 Ga0395900_0158114
765 Ga0395900_0568784
766 Ga0395900_0600958
767 Ga0395900_1051998
768 Ga0395898_0000038
769 Ga0395898_0012203
770 Ga0395898_0053337
771 Ga0395898_0175926
772 Ga0395898_0267821
773 Ga0395898_0311882
774 Ga0395905_0000021
775 Ga0395905_0012294
776 Ga0395905_0012952
777 Ga0395905_0020775
778 Ga0395905_0148670
779 Ga0395905_0151712
780 Ga0436364_0606945
781 Ga0436364_1191731
782 Ga0395901_0000014
783 Ga0395901_0000018
784 Ga0395901_0072220
785 Ga0395901_0086114
786 Ga0395901_0123885
787 Ga0395901_0161522
788 Ga0395901_0182463
789 Ga0395901_0458164
790 Ga0395901_0538770
791 Ga0436365_1563942
792 Ga0436365_1710079
793 Ga0436361_0184346
794 Ga0436363_0634210
795 Ga0436362_0556131
796 Ga0466969_0083710
797 Ga0466965_0088599
798 Ga0466965_0398302
799 Ga0466961_0165743
800 Ga0466968_0025848
801 Ga0466957_0149076
802 Ga0466959_0220463
803 Ga0495590_0000622
804 Ga0495650_0045955
805 Ga0495594_0056684
806 Ga0495596_0301706
807 Ga0495583_0000013
808 Ga0495606_0143901
809 Ga0495620_0032331
810 Ga0495628_0240141
811 Ga0495631_0002661
812 Ga0495643_0123281
813 Ga0495643_0295660
814 Ga0495648_0000575
815 Ga0495648_0236721
816 Ga0495652_0096276
817 Ga0495652_0238002
818 Ga0495654_0111930
819 Ga0495609_0054958
820 Ga0495597_0006546
821 Ga0495668_0000061
822 Ga0495668_0007234
823 Ga0495668_0020502
824 Ga0495668_0064483
825 Ga0495668_0175778
826 Ga0495668_0322518
827 Ga0495613_0001148
828 Ga0495600_0164215
829 Ga0495604_0305200
830 Ga0495680_0283445
831 Ga0495673_0000264
832 Ga0495686_0001221
833 Ga0495593_0249578
834 Ga0496102_0055772
835 Ga0496102_0767369
836 Ga0496103_0365693
837 Ga0496105_0702661
838 Ga0496106_0339712
839 Ga0496112_0133536
840 Ga0496113_0497899
841 Ga0496113_0988498
842 Ga0496117_0020420
843 Ga0496118_0045681
844 Ga0496119_0030754
845 Ga0496120_0001808
846 Ga0496120_0106214
847 Ga0496121_0000699
848 Ga0496121_0179262
849 Ga0496121_0306550
850 Ga0496122_0103067
851 Ga0496124_0018292
852 Ga0496125_0004567
853 Ga0496125_0111024
854 Ga0496126_0002022
855 Ga0501034_0177460
856 Ga0501034_0265255
857 Ga0501037_0063570
858 Ga0501037_0577295
859 Ga0501041_0314460
860 Ga0501047_0096870
861 Ga0501070_0059110
862 Ga0501070_0867231
863 Ga0501257_006423
864 Ga0501044_0049510
865 Ga0501044_0089414
866 Ga0501044_0898125
867 Ga0501045_0732856
868 nmdc:mga03n38_5652_c1
869 nmdc:mga00v17_196771_c1
870 nmdc:mga00v17_229_c1
871 nmdc:mga0yw44_2416_c1
872 nmdc:mga0yw44_535458_c1
873 nmdc:mga06z11_41168_c1
874 nmdc:mga06z11_41738_c1
875 nmdc:mga04h51_65396_c1
876 nmdc:mga07m45_1287_c1
877 nmdc:mga07m45_209046_c1
878 nmdc:mga07m45_463343_c1
879 nmdc:mga09592_103176_c1
880 nmdc:mga0qj67_158783_c1
881 nmdc:mga0sz30_105696_c1
882 nmdc:mga0sz30_2167_c2
883 Ga0500635_0000143
884 Ga0495595_0050543
885 Ga0500578_0000070
886 Ga0500643_000745
887 Ga0500644_0000087
888 Ga0500647_0014739
889 Ga0500647_0021020
890 Ga0500651_0113848
891 Ga0500651_0163734
892 Ga0500566_0025000
893 Ga0500641_0000614
894 Ga0500641_0000941
895 Ga0500554_001394
896 Ga0500555_064838
897 Ga0500556_0001335
898 Ga0500556_0018502
899 Ga0500562_000696
900 Ga0500562_001115
901 Ga0500562_007063
902 Ga0500562_007559
903 Ga0500572_000529
904 Ga0500572_065295
905 Ga0500595_010629
906 Ga0500608_004669
907 Ga0500559_0000018
908 Ga0500559_0000060
909 Ga0500559_0039766
910 Ga0500559_0269917
911 Ga0500564_000023
912 Ga0500588_0237884
913 Ga0500616_0010142
914 Ga0500616_0112704
915 Ga0500622_0005631
916 Ga0500622_0005992
917 Ga0500622_0010072
918 Ga0500622_0012633
919 Ga0500622_0056547
920 Ga0500638_022118
921 Ga0500636_0004384
922 Ga0500636_0082482
923 Ga0500625_091899
924 Ga0500645_000833
925 Ga0500645_000995
926 Ga0500645_016857
927 2511121300
928 2513611842
929 2545677323
930 2585146609
931 2585151535
932 2585195591
933 2587917749
934 2599937330
935 2643749300
936 2643770369
937 2643776173
938 2643781423
939 2643794620
940 2643838371
941 2643923112
942 2643929106
943 2644085468
944 2644226731
945 2644233799
946 2644343020
947 2644366320
948 2644508926
949 2644742564
950 2792461152
951 2819536399
952 2819644654
953 2835316846
954 2841915501
955 2841920703
956 2843749439
957 2847671198
958 2847687336
959 2849562427
960 2849573806
961 2851156967
962 2851185210
963 2856316711
964 2856353242
965 2857355238
966 2871449498
967 2871495950
968 2874102867
969 2876370282
970 2876381881
971 2876395549
972 2878036921
973 2878760183
974 2878767143
975 2881152260
976 2881156735
977 2881162143
978 2881854775
979 2884300253
980 2884961662
981 2885310981
982 2885329826
983 2885339634
984 2885349019
985 2885356822
986 2889307620
987 2898334030
988 2903540745
989 2904662180
990 2906332657
991 2906416848
992 2919455441
993 2922161226
994 2924727109
995 2928531398
996 2937894527
997 2937994600
998 2938019767
999 2939670505
1000 2958117684
1001 2958165078
1002 2961117334
1003 2961132059
1004 2961163538
1005 2965018341
1006 2965063214
1007 2968096698
1008 2968099900
1009 2968113242
1010 2968123586
1011 2968132865
1012 2968171941
1013 2970555034
1014 2977864595
1015 2977866439
1016 2977948782
1017 2979780124
1018 2987640371
1019 2987659546
1020 2996347251
1021 3004188589
1022 3004208569
1023 641640707
1024 8001849600
1025 8004451208
1026 8004711567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

171

226

0.98

PF01132

EFP

Elongation factor P (EF-P) OB domain

110

163

0.98

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

45

102

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wxk-assembly1.cif.gz_B earp bound with domain i of ef-p 0.9108 9 69
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.8881 9 65
3a5z-assembly2.cif.gz_H crystal structure of escherichia coli genx in complex with elongation factor p 0.883 10 192
6s8z-assembly1.cif.gz_A elongation factor p from corynebacterium glutamicum 0.8812 9 194
3tre-assembly1.cif.gz_A structure of a translation elongation factor p (efp) from coxiella burnetii 0.8789 10 133
ID Description Score Start End Superfamily
af_I1JVU1_64_124_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9787 9 69 2.30.30.30
af_I1JVU1_64_124_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9633 9 69 2.30.30.30
af_F4JUX3_73_134_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9623 9 70 2.30.30.30
af_Q557H6_34_95_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9603 9 70 2.30.30.30
3a5zH02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9551 71 133 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A6A5LHS1-F1-model_v4 deleted 0.955 1 194
AF-A0A2W6XYJ0-F1-model_v4 Elongation factor P 0.9538 73 194 GO:0003746
GO:0005737
GO:0043043
AF-B1M2B1-F1-model_v4 Elongation factor P (EF-P) 0.9521 7 194 GO:0003746
GO:0005737
GO:0043043
AF-A0A435RUS1-F1-model_v4 deleted 0.9512 64 194
AF-A0A6A5LHS1-F1-model_v4 deleted 0.9502 1 194

Map