F457693

General Info

Members Datasets Scaffolds Average Seq Length
514 230 514 124

Family's Representative Sequence

Representative Sequence 3300005615|Ga0070702_100021002|Ga0070702_1000210023
Length 118
Sequence MADILVVDDDDVIRETLCELLSADYSCETAEAELALKKLEAQRFDVVLTDISMPGLSGKDLLNRVVELYPGTPVIIVSGLSDQDQAESLMERGAFEYLLKPFRLELVEASVRRAINQQ

Samples

Sample ID Description Type Environment
1 2124908026 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v1 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
165 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
177 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
178 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
179 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
180 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
181 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
182 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
183 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
184 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
187 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
188 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
189 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
190 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
191 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
192 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
193 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
194 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
195 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
196 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
197 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
200 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
201 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
202 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
203 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
204 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
207 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
208 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
211 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
212 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
213 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
214 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
215 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
216 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
219 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
220 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
221 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
222 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
223 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
224 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
225 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.11
Rhizosphere 96.5
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1a_Contig_2924 2124908026 Bacteria 720
2 SwRhRL3b_contig_1543783 2162886006 Bacteria 1010
3 SwRhRL2b_contig_2418641 2162886007 Bacteria 1147
4 CNBas_1001024 3300000531 Bacteria 1410
5 JGI24751J29686_10000017 3300002459 Bacteria 109415
6 JGI24751J29686_10000149 3300002459 Bacteria 33687
7 rootL2_10100126 3300003322 Bacteria 2269
8 rootL2_10352565 3300003322 Bacteria 1608
9 Ga0065714_10064460 3300005288 Bacteria 66400
10 Ga0065714_10466215 3300005288 Unclassified 543
11 Ga0065704_10138292 3300005289 Bacteria 1546
12 Ga0065704_10244608 3300005289 Unclassified 1006
13 Ga0065704_10570640 3300005289 Unclassified 623
14 Ga0065712_10023479 3300005290 Bacteria 2177
15 Ga0065712_10068069 3300005290 Bacteria 15521
16 Ga0065712_10088236 3300005290 Bacteria 2514
17 Ga0065712_10097738 3300005290 Unclassified 2141
18 Ga0065712_10356386 3300005290 Bacteria 763
19 Ga0065715_10034020 3300005293 Unclassified 1230
20 Ga0065715_10113683 3300005293 Unclassified 2479
21 Ga0065715_10127672 3300005293 Bacteria 2082
22 Ga0065715_10164881 3300005293 Bacteria 1595
23 Ga0065715_10213456 3300005293 Unclassified 1304
24 Ga0065715_10233854 3300005293 Unclassified 1224
25 Ga0065715_10260477 3300005293 Unclassified 1133
26 Ga0065715_10737313 3300005293 Unclassified 636
27 Ga0065707_10003124 3300005295 Bacteria 5333
28 Ga0065707_10313967 3300005295 Bacteria 979
29 Ga0065707_10549429 3300005295 Unclassified 722
30 Ga0065707_10641527 3300005295 Bacteria 668
31 Ga0070676_10624055 3300005328 Bacteria 780
32 Ga0070676_10887878 3300005328 Unclassified 663
33 Ga0070690_100036190 3300005330 Unclassified 3100
34 Ga0070690_100133828 3300005330 Bacteria 1677
35 Ga0070690_100394660 3300005330 Bacteria 1015
36 Ga0070670_100000232 3300005331 Bacteria 51314
37 Ga0070670_100109704 3300005331 Unclassified 2378
38 Ga0070670_100634465 3300005331 Bacteria 958
39 Ga0068869_100057679 3300005334 Bacteria 2836
40 Ga0068869_100189488 3300005334 Bacteria 1617
41 Ga0068869_100269724 3300005334 Bacteria 1365
42 Ga0068869_100498488 3300005334 Bacteria 1016
43 Ga0068869_100576776 3300005334 Unclassified 948
44 Ga0068869_101011346 3300005334 Bacteria 724
45 Ga0068869_101166545 3300005334 Unclassified 676
46 Ga0070682_100004467 3300005337 Bacteria 7768
47 Ga0070682_101527225 3300005337 Unclassified 575
48 Ga0070682_101808152 3300005337 Unclassified 533
49 Ga0068868_100560446 3300005338 Unclassified 1008
50 Ga0068868_100981568 3300005338 Unclassified 772
51 Ga0068868_102031203 3300005338 Unclassified 546
52 Ga0070660_100771788 3300005339 Bacteria 808
53 Ga0070689_100547508 3300005340 Bacteria 997
54 Ga0070689_100688730 3300005340 Bacteria 892
55 Ga0070689_100728623 3300005340 Unclassified 868
56 Ga0070689_101573228 3300005340 Bacteria 596
57 Ga0070687_100021490 3300005343 Unclassified 3035
58 Ga0070687_100094099 3300005343 Bacteria 1664
59 Ga0070687_100920531 3300005343 Unclassified 628
60 Ga0070687_100925491 3300005343 Unclassified 627
61 Ga0070692_10006925 3300005345 Unclassified 4958
62 Ga0070692_10453125 3300005345 Bacteria 821
63 Ga0070692_10823043 3300005345 Unclassified 636
64 Ga0070692_11223127 3300005345 Bacteria 536
65 Ga0070669_100078278 3300005353 Bacteria 2457
66 Ga0070669_100280519 3300005353 Bacteria 1335
67 Ga0070669_100446160 3300005353 Bacteria 1066
68 Ga0070669_101033253 3300005353 Bacteria 706
69 Ga0070675_100050511 3300005354 Bacteria 3414
70 Ga0070671_100800818 3300005355 Unclassified 820
71 Ga0070673_100223788 3300005364 Unclassified 1630
72 Ga0070673_100533336 3300005364 Bacteria 1065
73 Ga0070673_100645100 3300005364 Bacteria 969
74 Ga0070673_101501373 3300005364 Bacteria 635
75 Ga0070673_101562391 3300005364 Bacteria 623
76 Ga0070688_100031808 3300005365 Bacteria 3176
77 Ga0070688_100621934 3300005365 Bacteria 829
78 Ga0070688_100765034 3300005365 Bacteria 753
79 Ga0070659_100103803 3300005366 Bacteria 2290
80 Ga0070667_100517430 3300005367 Bacteria 1095
81 Ga0070703_10002444 3300005406 Bacteria 5355
82 Ga0070701_10038352 3300005438 Bacteria 2425
83 Ga0070701_10162494 3300005438 Bacteria 1295
84 Ga0070705_101183449 3300005440 Unclassified 629
85 Ga0070700_100038842 3300005441 Bacteria 2904
86 Ga0070700_100512780 3300005441 Bacteria 925
87 Ga0070700_101754724 3300005441 Unclassified 534
88 Ga0070694_100079845 3300005444 Bacteria 2272
89 Ga0070694_100109309 3300005444 Bacteria 1968
90 Ga0070694_100149487 3300005444 Bacteria 1704
91 Ga0070694_100960930 3300005444 Unclassified 708
92 Ga0070662_100972062 3300005457 Unclassified 726
93 Ga0070662_101208569 3300005457 Unclassified 650
94 Ga0070681_10088369 3300005458 Unclassified 3051
95 Ga0068867_100039774 3300005459 Bacteria 3430
96 Ga0068867_100535949 3300005459 Bacteria 1012
97 Ga0068867_101466121 3300005459 Unclassified 635
98 Ga0070685_10264117 3300005466 Unclassified 1146
99 Ga0070706_100000088 3300005467 Bacteria 107818
100 Ga0070707_100310526 3300005468 Bacteria 1533
101 Ga0070698_100044465 3300005471 Bacteria 4547
102 Ga0070698_100801146 3300005471 Unclassified 886
103 Ga0070699_100072451 3300005518 Unclassified 2997
104 Ga0070699_100191173 3300005518 Bacteria 1818
105 Ga0070699_100347191 3300005518 Bacteria 1336
106 Ga0068853_100347749 3300005539 Bacteria 1379
107 Ga0068853_100919331 3300005539 Unclassified 841
108 Ga0070686_100067207 3300005544 Bacteria 2334
109 Ga0070686_100196890 3300005544 Unclassified 1442
110 Ga0070695_100029753 3300005545 Unclassified 3395
111 Ga0070695_100105572 3300005545 Bacteria 1904
112 Ga0070695_100480289 3300005545 Bacteria 958
113 Ga0070695_100620170 3300005545 Bacteria 851
114 Ga0070695_100994317 3300005545 Unclassified 682
115 Ga0070695_101827341 3300005545 Unclassified 510
116 Ga0070696_100140994 3300005546 Bacteria 1762
117 Ga0070696_101636000 3300005546 Unclassified 554
118 Ga0070693_100056842 3300005547 Unclassified 2259
119 Ga0070693_100059069 3300005547 Bacteria 2222
120 Ga0070693_100146527 3300005547 Bacteria 1492
121 Ga0070693_100161224 3300005547 Unclassified 1428
122 Ga0070693_100273864 3300005547 Bacteria 1128
123 Ga0070693_100524552 3300005547 Unclassified 844
124 Ga0070693_100918175 3300005547 Bacteria 657
125 Ga0070693_101628730 3300005547 Unclassified 507
126 Ga0070665_102261314 3300005548 Unclassified 547
127 Ga0070704_100140107 3300005549 Bacteria 1887
128 Ga0070704_100195208 3300005549 Bacteria 1630
129 Ga0070704_100701374 3300005549 Unclassified 897
130 Ga0070704_101065983 3300005549 Unclassified 733
131 Ga0070704_101404584 3300005549 Unclassified 640
132 Ga0068855_101439347 3300005563 Unclassified 709
133 Ga0068855_102206042 3300005563 Bacteria 553
134 Ga0070664_100473717 3300005564 Unclassified 1152
135 Ga0070664_100587457 3300005564 Bacteria 1032
136 Ga0068857_100187659 3300005577 Bacteria 1882
137 Ga0068857_100872552 3300005577 Bacteria 862
138 Ga0068857_100983505 3300005577 Unclassified 812
139 Ga0068857_101846538 3300005577 Unclassified 592
140 Ga0068854_100029675 3300005578 Bacteria 3788
141 Ga0068854_100742376 3300005578 Bacteria 851
142 Ga0068854_100887772 3300005578 Unclassified 783
143 Ga0070702_100021002 3300005615 Bacteria 3429
144 Ga0070702_100032543 3300005615 Bacteria 2862
145 Ga0070702_100394665 3300005615 Unclassified 988
146 Ga0070702_100479195 3300005615 Bacteria 909
147 Ga0070702_100538462 3300005615 Bacteria 864
148 Ga0068852_100380528 3300005616 Bacteria 1385
149 Ga0068859_100093958 3300005617 Unclassified 3050
150 Ga0068859_100102941 3300005617 Bacteria 2913
151 Ga0068859_100110223 3300005617 Bacteria 2814
152 Ga0068859_100221163 3300005617 Bacteria 1981
153 Ga0068859_100236514 3300005617 Bacteria 1915
154 Ga0068859_100275958 3300005617 Bacteria 1773
155 Ga0068859_100983135 3300005617 Unclassified 926
156 Ga0068859_101154612 3300005617 Unclassified 852
157 Ga0068859_101327460 3300005617 Unclassified 793
158 Ga0068864_100084016 3300005618 Bacteria 2797
159 Ga0068864_100121094 3300005618 Bacteria 2339
160 Ga0068864_100353762 3300005618 Bacteria 1386
161 Ga0068864_100369589 3300005618 Bacteria 1357
162 Ga0068864_100762875 3300005618 Unclassified 949
163 Ga0068864_100977680 3300005618 Unclassified 839
164 Ga0068866_10436184 3300005718 Unclassified 853
165 Ga0068861_100060825 3300005719 Bacteria 2896
166 Ga0068861_100296857 3300005719 Bacteria 1398
167 Ga0068861_101412243 3300005719 Unclassified 680
168 Ga0068861_102265821 3300005719 Unclassified 545
169 Ga0068870_10221675 3300005840 Bacteria 1158
170 Ga0068863_100020026 3300005841 Bacteria 6399
171 Ga0068863_100044217 3300005841 Bacteria 4227
172 Ga0068863_100675388 3300005841 Bacteria 1025
173 Ga0068863_101984538 3300005841 Unclassified 592
174 Ga0068858_100034627 3300005842 Unclassified 4685
175 Ga0068858_100154813 3300005842 Unclassified 2156
176 Ga0068858_100173254 3300005842 Bacteria 2035
177 Ga0068858_100196734 3300005842 Unclassified 1905
178 Ga0068858_100197547 3300005842 Unclassified 1901
179 Ga0068858_100307405 3300005842 Bacteria 1513
180 Ga0068858_101433509 3300005842 Bacteria 680
181 Ga0068860_100325701 3300005843 Unclassified 1508
182 Ga0068860_101365658 3300005843 Bacteria 730
183 Ga0068860_101648855 3300005843 Unclassified 663
184 Ga0068860_101853619 3300005843 Unclassified 625
185 Ga0068862_100055721 3300005844 Unclassified 3386
186 Ga0068862_100389045 3300005844 Bacteria 1302
187 Ga0068862_100573868 3300005844 Bacteria 1080
188 Ga0068862_101286901 3300005844 Bacteria 732
189 Ga0081539_10000043 3300005985 Bacteria 288108
190 Ga0075432_10038593 3300006058 Bacteria 1664
191 Ga0070716_100752238 3300006173 Unclassified 750
192 Ga0097621_101477630 3300006237 Unclassified 644
193 Ga0068871_100026181 3300006358 Bacteria 4549
194 Ga0068871_101257801 3300006358 Bacteria 695
195 Ga0075428_100479998 3300006844 Unclassified 1330
196 Ga0075433_10277804 3300006852 Bacteria 1484
197 Ga0075433_10278909 3300006852 Unclassified 1481
198 Ga0075433_10283348 3300006852 Unclassified 1468
199 Ga0075434_100207703 3300006871 Bacteria 1979
200 Ga0075434_100389424 3300006871 Unclassified 1415
201 Ga0075429_100839968 3300006880 Bacteria 804
202 Ga0075429_101009687 3300006880 Unclassified 727
203 Ga0068865_100003932 3300006881 Bacteria 8920
204 Ga0068865_100289875 3300006881 Bacteria 1306
205 Ga0075436_100036723 3300006914 Bacteria 3383
206 Ga0097620_100093956 3300006931 Unclassified 3050
207 Ga0097620_100102945 3300006931 Bacteria 2913
208 Ga0097620_100110234 3300006931 Bacteria 2814
209 Ga0097620_100221160 3300006931 Bacteria 1981
210 Ga0097620_100236507 3300006931 Bacteria 1915
211 Ga0097620_100275960 3300006931 Bacteria 1773
212 Ga0097620_100983173 3300006931 Unclassified 926
213 Ga0097620_101154555 3300006931 Unclassified 852
214 Ga0097620_101327720 3300006931 Unclassified 793
215 Ga0105240_10042014 3300009093 Bacteria 5829
216 Ga0105240_11001317 3300009093 Unclassified 894
217 Ga0111539_10000627 3300009094 Bacteria 45686
218 Ga0111539_10609139 3300009094 Unclassified 1272
219 Ga0105245_11306554 3300009098 Unclassified 774
220 Ga0105245_11726778 3300009098 Unclassified 678
221 Ga0105247_10000592 3300009101 Bacteria 29439
222 Ga0105247_10094200 3300009101 Bacteria 1905
223 Ga0105247_10239260 3300009101 Bacteria 1236
224 Ga0105247_11150446 3300009101 Unclassified 615
225 Ga0105247_11332838 3300009101 Unclassified 578
226 Ga0114129_10222807 3300009147 Bacteria 2544
227 Ga0114129_13281568 3300009147 Unclassified 524
228 Ga0105243_10219336 3300009148 Bacteria 1680
229 Ga0105243_10356450 3300009148 Unclassified 1345
230 Ga0105243_10416015 3300009148 Bacteria 1252
231 Ga0105241_10075409 3300009174 Unclassified 2628
232 Ga0105241_10111856 3300009174 Unclassified 2187
233 Ga0105241_10325947 3300009174 Bacteria 1326
234 Ga0105241_10660959 3300009174 Bacteria 950
235 Ga0105241_11889490 3300009174 Bacteria 585
236 Ga0105241_11981180 3300009174 Bacteria 573
237 Ga0105241_12110955 3300009174 Bacteria 557
238 Ga0105242_10136314 3300009176 Bacteria 2125
239 Ga0105242_10413182 3300009176 Unclassified 1262
240 Ga0105242_12122488 3300009176 Unclassified 606
241 Ga0105248_10031377 3300009177 Bacteria 5940
242 Ga0105248_10058934 3300009177 Unclassified 4312
243 Ga0105248_10172362 3300009177 Unclassified 2439
244 Ga0105248_10415032 3300009177 Unclassified 1516
245 Ga0105248_10720570 3300009177 Bacteria 1126
246 Ga0105248_10728726 3300009177 Bacteria 1119
247 Ga0105248_11863051 3300009177 Unclassified 682
248 Ga0105237_10008903 3300009545 Bacteria 10815
249 Ga0105237_10938743 3300009545 Unclassified 872
250 Ga0105238_10013915 3300009551 Bacteria 8138
251 Ga0105249_10079461 3300009553 Bacteria 3045
252 Ga0105249_11226321 3300009553 Unclassified 821
253 Ga0105249_12254330 3300009553 Unclassified 617
254 Ga0105239_10101647 3300010375 Unclassified 3181
255 Ga0105239_10720297 3300010375 Bacteria 1141
256 Ga0105246_10119343 3300011119 Bacteria 1951
257 Ga0105246_10241867 3300011119 Bacteria 1427
258 Ga0105246_10255653 3300011119 Unclassified 1393
259 Ga0157345_1034611 3300012498 Unclassified 582
260 Ga0157373_10184438 3300013100 Bacteria 1470
261 Ga0157373_10203625 3300013100 Bacteria 1395
262 Ga0157373_10235246 3300013100 Unclassified 1294
263 Ga0157373_11115071 3300013100 Unclassified 592
264 Ga0157371_11667602 3300013102 Unclassified 500
265 Ga0157374_10683273 3300013296 Unclassified 1039
266 Ga0157374_12130306 3300013296 Bacteria 588
267 Ga0157378_10016275 3300013297 Bacteria 6512
268 Ga0157378_10475940 3300013297 Unclassified 1243
269 Ga0157378_10507540 3300013297 Bacteria 1205
270 Ga0163162_10291370 3300013306 Unclassified 1764
271 Ga0163162_10954358 3300013306 Unclassified 968
272 Ga0163162_11126234 3300013306 Unclassified 890
273 Ga0163162_11329496 3300013306 Bacteria 817
274 Ga0163162_11448138 3300013306 Unclassified 782
275 Ga0163162_11503961 3300013306 Unclassified 767
276 Ga0157372_10001564 3300013307 Bacteria 24928
277 Ga0157372_10525322 3300013307 Unclassified 1380
278 Ga0157375_10026276 3300013308 Bacteria 5422
279 Ga0157375_11237144 3300013308 Bacteria 876
280 Ga0163163_10000862 3300014325 Bacteria 25852
281 Ga0163163_10028737 3300014325 Bacteria 5344
282 Ga0163163_10239359 3300014325 Unclassified 1865
283 Ga0163163_12981797 3300014325 Bacteria 528
284 Ga0157380_10041329 3300014326 Bacteria 3598
285 Ga0157377_10166491 3300014745 Unclassified 1375
286 Ga0157377_10638848 3300014745 Bacteria 764
287 Ga0157379_10171916 3300014968 Bacteria 1956
288 Ga0157379_10334949 3300014968 Bacteria 1383
289 Ga0157379_10598975 3300014968 Unclassified 1029
290 Ga0157379_12479524 3300014968 Bacteria 518
291 Ga0157376_10092080 3300014969 Bacteria 2628
292 Ga0157376_10304672 3300014969 Bacteria 1509
293 Ga0163161_10020068 3300017792 Bacteria 4688
294 Ga0163161_10361721 3300017792 Unclassified 1156
295 Ga0207697_10027211 3300025315 Bacteria 2338
296 Ga0207653_10004069 3300025885 Bacteria 4602
297 Ga0207653_10268023 3300025885 Bacteria 657
298 Ga0207642_10516416 3300025899 Bacteria 733
299 Ga0207710_10001345 3300025900 Bacteria 12343
300 Ga0207710_10247398 3300025900 Bacteria 891
301 Ga0207710_10292953 3300025900 Unclassified 821
302 Ga0207710_10377876 3300025900 Bacteria 725
303 Ga0207688_10137459 3300025901 Bacteria 1436
304 Ga0207684_10000131 3300025910 Bacteria 137508
305 Ga0207654_10073342 3300025911 Bacteria 2040
306 Ga0207654_10224092 3300025911 Bacteria 1249
307 Ga0207654_10575672 3300025911 Bacteria 802
308 Ga0207654_10750465 3300025911 Bacteria 703
309 Ga0207695_10185550 3300025913 Bacteria 1999
310 Ga0207695_10336996 3300025913 Bacteria 1396
311 Ga0207671_10095047 3300025914 Bacteria 2250
312 Ga0207662_10007196 3300025918 Bacteria 6052
313 Ga0207662_10356086 3300025918 Unclassified 984
314 Ga0207662_11362165 3300025918 Unclassified 504
315 Ga0207652_11283239 3300025921 Bacteria 635
316 Ga0207681_11042149 3300025923 Unclassified 687
317 Ga0207681_11108626 3300025923 Unclassified 665
318 Ga0207694_10007934 3300025924 Bacteria 8032
319 Ga0207694_10768580 3300025924 Bacteria 813
320 Ga0207650_10000005 3300025925 Bacteria 663190
321 Ga0207650_10143550 3300025925 Unclassified 1878
322 Ga0207650_10377185 3300025925 Bacteria 1171
323 Ga0207650_11706722 3300025925 Unclassified 534
324 Ga0207687_10070577 3300025927 Bacteria 2494
325 Ga0207644_10288668 3300025931 Unclassified 1319
326 Ga0207690_10069982 3300025932 Bacteria 2416
327 Ga0207690_10523915 3300025932 Unclassified 961
328 Ga0207706_10516221 3300025933 Bacteria 1030
329 Ga0207686_11301564 3300025934 Unclassified 597
330 Ga0207709_10246975 3300025935 Bacteria 1301
331 Ga0207709_10415901 3300025935 Unclassified 1032
332 Ga0207670_10210854 3300025936 Bacteria 1481
333 Ga0207670_10982339 3300025936 Bacteria 710
334 Ga0207670_11715281 3300025936 Unclassified 534
335 Ga0207669_10434986 3300025937 Unclassified 1036
336 Ga0207704_11020054 3300025938 Bacteria 700
337 Ga0207665_10682235 3300025939 Unclassified 807
338 Ga0207691_10001531 3300025940 Bacteria 22999
339 Ga0207711_10119115 3300025941 Bacteria 2355
340 Ga0207711_10733183 3300025941 Unclassified 921
341 Ga0207711_10859117 3300025941 Bacteria 844
342 Ga0207711_11280659 3300025941 Unclassified 675
343 Ga0207689_10016157 3300025942 Bacteria 6321
344 Ga0207689_10118785 3300025942 Bacteria 2175
345 Ga0207689_10286502 3300025942 Bacteria 1364
346 Ga0207689_10846277 3300025942 Bacteria 772
347 Ga0207689_11210648 3300025942 Unclassified 636
348 Ga0207679_10456899 3300025945 Bacteria 1133
349 Ga0207679_10519866 3300025945 Unclassified 1064
350 Ga0207679_10520563 3300025945 Bacteria 1064
351 Ga0207651_10566526 3300025960 Unclassified 989
352 Ga0207712_10087238 3300025961 Unclassified 2288
353 Ga0207712_10161080 3300025961 Bacteria 1744
354 Ga0207640_10011656 3300025981 Bacteria 4983
355 Ga0207640_10511601 3300025981 Bacteria 1002
356 Ga0207677_10195755 3300026023 Bacteria 1602
357 Ga0207677_10502253 3300026023 Unclassified 1049
358 Ga0207703_10187358 3300026035 Bacteria 1830
359 Ga0207703_10678168 3300026035 Bacteria 979
360 Ga0207703_10884838 3300026035 Bacteria 855
361 Ga0207703_11052691 3300026035 Unclassified 781
362 Ga0207703_11450807 3300026035 Unclassified 660
363 Ga0207639_10251594 3300026041 Unclassified 1541
364 Ga0207639_10482397 3300026041 Unclassified 1130
365 Ga0207639_11388458 3300026041 Bacteria 659
366 Ga0207708_10026030 3300026075 Bacteria 4426
367 Ga0207708_10143451 3300026075 Bacteria 1875
368 Ga0207708_10341943 3300026075 Bacteria 1226
369 Ga0207708_10985504 3300026075 Unclassified 732
370 Ga0207641_11486728 3300026088 Bacteria 679
371 Ga0207641_11573785 3300026088 Bacteria 659
372 Ga0207641_11642128 3300026088 Bacteria 645
373 Ga0207648_10024682 3300026089 Bacteria 5363
374 Ga0207648_10177204 3300026089 Unclassified 1886
375 Ga0207648_10890254 3300026089 Bacteria 831
376 Ga0207676_10113462 3300026095 Bacteria 2272
377 Ga0207676_10273092 3300026095 Bacteria 1532
378 Ga0207676_10305641 3300026095 Bacteria 1454
379 Ga0207676_10443944 3300026095 Bacteria 1222
380 Ga0207676_10964679 3300026095 Bacteria 839
381 Ga0207676_12210764 3300026095 Bacteria 548
382 Ga0207674_10102552 3300026116 Bacteria 2841
383 Ga0207674_10678387 3300026116 Bacteria 995
384 Ga0207675_100098231 3300026118 Bacteria 2757
385 Ga0207675_100351838 3300026118 Unclassified 1444
386 Ga0207675_100957978 3300026118 Bacteria 873
387 Ga0207675_101244856 3300026118 Unclassified 764
388 Ga0207698_10803468 3300026142 Unclassified 943
389 Ga0207428_10014828 3300027907 Bacteria 6751
390 Ga0207428_10305080 3300027907 Bacteria 1178
391 Ga0268265_10162894 3300028380 Bacteria 1897
392 Ga0268265_10251127 3300028380 Bacteria 1567
393 Ga0268265_10784642 3300028380 Unclassified 927
394 Ga0268264_10318714 3300028381 Unclassified 1469
395 Ga0268264_10321652 3300028381 Bacteria 1463
396 Ga0268264_10366833 3300028381 Unclassified 1375
397 Ga0268264_11842655 3300028381 Unclassified 615
398 Ga0307408_100138249 3300031548 Unclassified 1909
399 Ga0307408_100918624 3300031548 Bacteria 802
400 Ga0307405_10623862 3300031731 Unclassified 883
401 Ga0307406_10771261 3300031901 Unclassified 809
402 Ga0307412_10200959 3300031911 Bacteria 1513
403 Ga0307409_100076182 3300031995 Unclassified 2689
404 Ga0307416_100921074 3300032002 Unclassified 975
405 Ga0307414_10085449 3300032004 Unclassified 2325
406 Ga0307414_10104884 3300032004 Unclassified 2136
407 Ga0307411_10136050 3300032005 Bacteria 1804
408 Ga0307411_10187762 3300032005 Unclassified 1575
409 Ga0307415_100129769 3300032126 Bacteria 1906
410 Ga0373940_0101130 3300035088 Bacteria 875
411 Ga0373949_0237474 3300035090 Unclassified 559
412 Ga0373951_0110502 3300035091 Unclassified 739
413 Ga0373937_0133226 3300036401 Bacteria 2322
414 Ga0395899_0589182 3300037312 Bacteria 710
415 Ga0395898_0955603 3300037466 Bacteria 794
416 Ga0395898_1571108 3300037466 Bacteria 583
417 Ga0395901_0535616 3300038443 Unclassified 1188
418 Ga0395901_0634837 3300038443 Bacteria 1073
419 Ga0242419_008447 3300038698 Bacteria 770
420 Ga0242420_016162 3300038996 Bacteria 1297
421 Ga0242420_081728 3300038996 Unclassified 668
422 Ga0495580_0896283 3300046472 Unclassified 570
423 Ga0495658_0247584 3300046683 Unclassified 1120
424 Ga0496102_0597497 3300048905 Unclassified 1027
425 Ga0496102_0964465 3300048905 Bacteria 774
426 Ga0496104_0288307 3300048907 Bacteria 1554
427 Ga0496106_0038689 3300048909 Bacteria 3571
428 Ga0496107_0087684 3300048910 Unclassified 2272
429 Ga0496108_0660777 3300048911 Bacteria 908
430 Ga0496111_0874641 3300048914 Bacteria 648
431 Ga0496112_0211265 3300048915 Bacteria 1898
432 Ga0496112_0443163 3300048915 Bacteria 1237
433 Ga0496112_0470643 3300048915 Bacteria 1194
434 Ga0496112_0478351 3300048915 Bacteria 1182
435 Ga0496112_0692355 3300048915 Bacteria 947
436 Ga0496112_1055648 3300048915 Unclassified 731
437 Ga0496112_1091426 3300048915 Unclassified 716
438 Ga0496112_1814173 3300048915 Bacteria 522
439 Ga0496113_0744662 3300048916 Unclassified 780
440 Ga0501290_001861 3300049513 Unclassified 2791
441 Ga0501291_001249 3300049514 Bacteria 2940
442 Ga0501292_001674 3300049515 Unclassified 2755
443 Ga0501293_015441 3300049516 Unclassified 703
444 Ga0501296_000404 3300049519 Unclassified 4288
445 Ga0501296_001018 3300049519 Bacteria 2797
446 Ga0501297_004082 3300049520 Unclassified 1478
447 Ga0501298_012798 3300049521 Unclassified 1476
448 Ga0501298_091367 3300049521 Unclassified 683
449 Ga0501299_002554 3300049522 Bacteria 2531
450 Ga0501299_038684 3300049522 Bacteria 949
451 Ga0501303_066599 3300049526 Unclassified 502
452 Ga0501038_0011801 3300049574 Bacteria 7972
453 Ga0501199_012741 3300049650 Unclassified 921
454 Ga0501201_024900 3300049651 Unclassified 653
455 Ga0501202_033463 3300049652 Unclassified 1083
456 Ga0501202_038628 3300049652 Bacteria 1024
457 Ga0501202_050114 3300049652 Unclassified 923
458 Ga0501206_003397 3300049653 Bacteria 2023
459 Ga0501206_013590 3300049653 Unclassified 1113
460 Ga0501208_090234 3300049655 Unclassified 643
461 Ga0501216_047476 3300049660 Unclassified 837
462 Ga0501217_003386 3300049661 Unclassified 3223
463 Ga0501217_103831 3300049661 Unclassified 810
464 Ga0501223_016143 3300049663 Unclassified 1476
465 Ga0501223_025637 3300049663 Bacteria 1147
466 Ga0501223_037852 3300049663 Unclassified 936
467 Ga0501224_009138 3300049664 Unclassified 1449
468 Ga0501227_001709 3300049665 Unclassified 4870
469 Ga0501230_001295 3300049667 Unclassified 2949
470 Ga0501233_008480 3300049668 Bacteria 1982
471 Ga0501233_026315 3300049668 Unclassified 1284
472 Ga0501235_001873 3300049669 Unclassified 4498
473 Ga0501235_102702 3300049669 Unclassified 700
474 Ga0501236_003095 3300049670 Unclassified 1931
475 Ga0501239_006219 3300049672 Bacteria 1223
476 Ga0501240_118462 3300049673 Unclassified 521
477 Ga0501243_000844 3300049675 Unclassified 4261
478 Ga0501246_002553 3300049676 Unclassified 1438
479 Ga0501247_018673 3300049677 Bacteria 887
480 Ga0501249_031028 3300049679 Unclassified 1191
481 Ga0501249_118231 3300049679 Bacteria 645
482 Ga0501250_003242 3300049680 Bacteria 1544
483 Ga0501251_008275 3300049681 Unclassified 1175
484 Ga0501251_030483 3300049681 Unclassified 767
485 Ga0501255_051223 3300049684 Unclassified 633
486 Ga0501257_025373 3300049686 Bacteria 1410
487 Ga0501258_039897 3300049687 Unclassified 623
488 Ga0501260_039553 3300049689 Unclassified 568
489 Ga0501261_012430 3300049690 Bacteria 1146
490 Ga0501221_204090 3300049704 Unclassified 550
491 Ga0501229_014292 3300049706 Bacteria 1022
492 Ga0501234_010257 3300049707 Bacteria 1459
493 Ga0501234_089355 3300049707 Unclassified 551
494 Ga0501245_001961 3300049708 Unclassified 2716
495 Ga0501081_1243917 3300049743 Unclassified 564
496 Ga0501263_056096 3300049760 Unclassified 609
497 Ga0501268_000952 3300049765 Unclassified 3420
498 Ga0501270_127258 3300049767 Unclassified 560
499 Ga0501273_002987 3300049770 Unclassified 1762
500 Ga0501273_012193 3300049770 Bacteria 1080
501 Ga0501275_018475 3300049772 Bacteria 833
502 Ga0501283_076336 3300049779 Unclassified 624
503 Ga0501204_040087 3300049850 Unclassified 683
504 Ga0501212_009345 3300049851 Bacteria 1379
505 Ga0501212_012789 3300049851 Unclassified 1225
506 nmdc:mga05p37_40709_c1 3300050507 Bacteria 5706
507 nmdc:mga09592_1048159_c1 3300050508 Bacteria 680
508 nmdc:mga08y16_3655_c1 3300050511 Bacteria 15997
509 nmdc:mga08y16_568344_c1 3300050511 Bacteria 1146
510 nmdc:mga08x19_79247_c1 3300050514 Bacteria 2154
511 nmdc:mga0a205_1489596_c1 3300050515 Bacteria 525
512 nmdc:mga0a205_284846_c1 3300050515 Unclassified 1527
513 nmdc:mga0a205_321845_c1 3300050515 Unclassified 1417
514 nmdc:mga0a205_449605_c1 3300050515 Bacteria 1148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025913 Ga0207695_10336996 Ga0207695_103369961 115
2 3300005289 Ga0065704_10244608 Ga0065704_102446081 117
3 3300005615 Ga0070702_100021002 Ga0070702_1000210023 117
4 3300009147 Ga0114129_13281568 Ga0114129_132815681 117
5 3300000531 CNBas_1001024 CNBas_10010242 118
6 3300003322 rootL2_10352565 rootL2_103525652 118
7 3300005289 Ga0065704_10138292 Ga0065704_101382923 118
8 3300005290 Ga0065712_10356386 Ga0065712_103563861 118
9 3300005293 Ga0065715_10164881 Ga0065715_101648812 118
10 3300005295 Ga0065707_10641527 Ga0065707_106415271 118
11 3300005334 Ga0068869_100189488 Ga0068869_1001894882 118
12 3300005334 Ga0068869_100269724 Ga0068869_1002697242 118
13 3300005334 Ga0068869_101011346 Ga0068869_1010113461 118
14 3300005337 Ga0070682_100004467 Ga0070682_1000044674 118
15 3300005338 Ga0068868_100560446 Ga0068868_1005604462 118
16 3300005338 Ga0068868_102031203 Ga0068868_1020312031 118
17 3300005340 Ga0070689_101573228 Ga0070689_1015732281 118
18 3300005343 Ga0070687_100920531 Ga0070687_1009205311 118
19 3300005345 Ga0070692_10006925 Ga0070692_100069253 118
20 3300005353 Ga0070669_101033253 Ga0070669_1010332532 118
21 3300005364 Ga0070673_101501373 Ga0070673_1015013731 118
22 3300005364 Ga0070673_101562391 Ga0070673_1015623911 118
23 3300005406 Ga0070703_10002444 Ga0070703_100024444 118
24 3300005441 Ga0070700_100512780 Ga0070700_1005127802 118
25 3300005441 Ga0070700_101754724 Ga0070700_1017547241 118
26 3300005444 Ga0070694_100079845 Ga0070694_1000798452 118
27 3300005444 Ga0070694_100149487 Ga0070694_1001494872 118
28 3300005518 Ga0070699_100072451 Ga0070699_1000724513 118
29 3300005545 Ga0070695_100029753 Ga0070695_1000297532 118
30 3300005545 Ga0070695_100620170 Ga0070695_1006201702 118
31 3300005546 Ga0070696_100140994 Ga0070696_1001409943 118
32 3300005549 Ga0070704_100140107 Ga0070704_1001401072 118
33 3300005549 Ga0070704_100195208 Ga0070704_1001952082 118
34 3300005577 Ga0068857_100983505 Ga0068857_1009835052 118
35 3300005615 Ga0070702_100032543 Ga0070702_1000325434 118
36 3300005615 Ga0070702_100538462 Ga0070702_1005384622 118
37 3300005617 Ga0068859_101327460 Ga0068859_1013274601 118
38 3300005618 Ga0068864_100084016 Ga0068864_1000840163 118
39 3300005719 Ga0068861_101412243 Ga0068861_1014122431 118
40 3300005840 Ga0068870_10221675 Ga0068870_102216753 118
41 3300005841 Ga0068863_100044217 Ga0068863_1000442173 118
42 3300005842 Ga0068858_100034627 Ga0068858_1000346272 118
43 3300005842 Ga0068858_100196734 Ga0068858_1001967343 118
44 3300005843 Ga0068860_101648855 Ga0068860_1016488552 118
45 3300005843 Ga0068860_101853619 Ga0068860_1018536192 118
46 3300005985 Ga0081539_10000043 Ga0081539_1000004356 118
47 3300006844 Ga0075428_100479998 Ga0075428_1004799982 118
48 3300006880 Ga0075429_100839968 Ga0075429_1008399682 118
49 3300006931 Ga0097620_101327720 Ga0097620_1013277201 118
50 3300009094 Ga0111539_10609139 Ga0111539_106091392 118
51 3300009147 Ga0114129_10222807 Ga0114129_102228073 118
52 3300009148 Ga0105243_10416015 Ga0105243_104160152 118
53 3300009174 Ga0105241_10111856 Ga0105241_101118562 118
54 3300009545 Ga0105237_10008903 Ga0105237_100089033 118
55 3300011119 Ga0105246_10241867 Ga0105246_102418672 118
56 3300013100 Ga0157373_11115071 Ga0157373_111150711 118
57 3300013306 Ga0163162_10291370 Ga0163162_102913703 118
58 3300014968 Ga0157379_10171916 Ga0157379_101719162 118
59 3300014968 Ga0157379_12479524 Ga0157379_124795241 118
60 3300025885 Ga0207653_10004069 Ga0207653_100040692 118
61 3300025885 Ga0207653_10268023 Ga0207653_102680232 118
62 3300025911 Ga0207654_10224092 Ga0207654_102240922 118
63 3300025914 Ga0207671_10095047 Ga0207671_100950472 118
64 3300025918 Ga0207662_10356086 Ga0207662_103560861 118
65 3300025918 Ga0207662_11362165 Ga0207662_113621651 118
66 3300025932 Ga0207690_10523915 Ga0207690_105239151 118
67 3300025936 Ga0207670_10982339 Ga0207670_109823392 118
68 3300025942 Ga0207689_10118785 Ga0207689_101187852 118
69 3300025942 Ga0207689_10286502 Ga0207689_102865022 118
70 3300025942 Ga0207689_10846277 Ga0207689_108462771 118
71 3300026023 Ga0207677_10502253 Ga0207677_105022532 118
72 3300026035 Ga0207703_10678168 Ga0207703_106781682 118
73 3300026075 Ga0207708_10341943 Ga0207708_103419432 118
74 3300026075 Ga0207708_10985504 Ga0207708_109855041 118
75 3300026088 Ga0207641_11642128 Ga0207641_116421281 118
76 3300026095 Ga0207676_10273092 Ga0207676_102730922 118
77 3300026095 Ga0207676_12210764 Ga0207676_122107642 118
78 3300026116 Ga0207674_10102552 Ga0207674_101025522 118
79 3300026118 Ga0207675_100957978 Ga0207675_1009579782 118
80 3300026118 Ga0207675_101244856 Ga0207675_1012448561 118
81 3300027907 Ga0207428_10305080 Ga0207428_103050802 118
82 3300028381 Ga0268264_11842655 Ga0268264_118426551 118
83 3300038443 Ga0395901_0535616 Ga0395901_0535616_14_373 118
84 3300048915 Ga0496112_0470643 Ga0496112_0470643_217_576 118
85 3300048916 Ga0496113_0744662 Ga0496113_0744662_189_617 118
86 3300049514 Ga0501291_001249 Ga0501291_001249_876_1235 118
87 3300049521 Ga0501298_091367 Ga0501298_091367_219_578 118
88 3300049526 Ga0501303_066599 Ga0501303_066599_48_407 118
89 3300049652 Ga0501202_038628 Ga0501202_038628_60_419 118
90 3300049663 Ga0501223_025637 Ga0501223_025637_536_895 118
91 3300049668 Ga0501233_008480 Ga0501233_008480_518_877 118
92 3300049669 Ga0501235_102702 Ga0501235_102702_65_424 118
93 3300049672 Ga0501239_006219 Ga0501239_006219_491_850 118
94 3300049673 Ga0501240_118462 Ga0501240_118462_65_424 118
95 3300049681 Ga0501251_030483 Ga0501251_030483_275_634 118
96 3300049689 Ga0501260_039553 Ga0501260_039553_103_462 118
97 3300049690 Ga0501261_012430 Ga0501261_012430_337_696 118
98 3300049707 Ga0501234_089355 Ga0501234_089355_91_450 118
99 3300049760 Ga0501263_056096 Ga0501263_056096_182_541 118
100 3300049767 Ga0501270_127258 Ga0501270_127258_96_455 118
101 3300049770 Ga0501273_012193 Ga0501273_012193_642_1001 118
102 3300049772 Ga0501275_018475 Ga0501275_018475_387_746 118
103 3300049851 Ga0501212_009345 Ga0501212_009345_580_939 118
104 3300050507 nmdc:mga05p37_40709_c1 nmdc:mga05p37_40709_c1_1230_1589 118
105 3300050511 nmdc:mga08y16_568344_c1 nmdc:mga08y16_568344_c1_422_781 118
106 3300005293 Ga0065715_10213456 Ga0065715_102134563 119
107 3300005334 Ga0068869_101166545 Ga0068869_1011665452 119
108 3300005343 Ga0070687_100021490 Ga0070687_1000214903 119
109 3300005345 Ga0070692_10453125 Ga0070692_104531252 119
110 3300005353 Ga0070669_100280519 Ga0070669_1002805192 119
111 3300005468 Ga0070707_100310526 Ga0070707_1003105262 119
112 3300005471 Ga0070698_100044465 Ga0070698_1000444653 119
113 3300005518 Ga0070699_100191173 Ga0070699_1001911732 119
114 3300005545 Ga0070695_100994317 Ga0070695_1009943172 119
115 3300005617 Ga0068859_100102941 Ga0068859_1001029411 119
116 3300005618 Ga0068864_100353762 Ga0068864_1003537623 119
117 3300006852 Ga0075433_10278909 Ga0075433_102789092 119
118 3300006852 Ga0075433_10283348 Ga0075433_102833482 119
119 3300006931 Ga0097620_100102945 Ga0097620_1001029451 119
120 3300009101 Ga0105247_10094200 Ga0105247_100942002 119
121 3300009101 Ga0105247_10239260 Ga0105247_102392602 119
122 3300009174 Ga0105241_12110955 Ga0105241_121109551 119
123 3300009177 Ga0105248_10058934 Ga0105248_100589343 119
124 3300013306 Ga0163162_11329496 Ga0163162_113294961 119
125 3300013308 Ga0157375_10026276 Ga0157375_100262763 119
126 3300014968 Ga0157379_10334949 Ga0157379_103349492 119
127 3300025900 Ga0207710_10247398 Ga0207710_102473981 119
128 3300028380 Ga0268265_10251127 Ga0268265_102511271 119
129 3300031731 Ga0307405_10623862 Ga0307405_106238622 119
130 3300031995 Ga0307409_100076182 Ga0307409_1000761822 119
131 3300032002 Ga0307416_100921074 Ga0307416_1009210741 119
132 3300032004 Ga0307414_10104884 Ga0307414_101048842 119
133 3300032005 Ga0307411_10136050 Ga0307411_101360502 119
134 3300032126 Ga0307415_100129769 Ga0307415_1001297692 119
135 3300037312 Ga0395899_0589182 Ga0395899_0589182_317_679 119
136 3300037466 Ga0395898_0955603 Ga0395898_0955603_243_629 119
137 3300038443 Ga0395901_0634837 Ga0395901_0634837_121_483 119
138 3300048910 Ga0496107_0087684 Ga0496107_0087684_845_1207 119
139 3300048915 Ga0496112_0211265 Ga0496112_0211265_1401_1763 119
140 3300049513 Ga0501290_001861 Ga0501290_001861_1521_1883 119
141 3300049515 Ga0501292_001674 Ga0501292_001674_2348_2710 119
142 3300049516 Ga0501293_015441 Ga0501293_015441_285_647 119
143 3300049519 Ga0501296_000404 Ga0501296_000404_1113_1475 119
144 3300049521 Ga0501298_012798 Ga0501298_012798_639_1001 119
145 3300049522 Ga0501299_002554 Ga0501299_002554_1677_2039 119
146 3300049650 Ga0501199_012741 Ga0501199_012741_176_538 119
147 3300049652 Ga0501202_050114 Ga0501202_050114_276_638 119
148 3300049653 Ga0501206_013590 Ga0501206_013590_170_532 119
149 3300049655 Ga0501208_090234 Ga0501208_090234_252_614 119
150 3300049660 Ga0501216_047476 Ga0501216_047476_65_427 119
151 3300049661 Ga0501217_103831 Ga0501217_103831_170_532 119
152 3300049663 Ga0501223_016143 Ga0501223_016143_684_1046 119
153 3300049664 Ga0501224_009138 Ga0501224_009138_443_805 119
154 3300049665 Ga0501227_001709 Ga0501227_001709_676_1038 119
155 3300049667 Ga0501230_001295 Ga0501230_001295_2132_2494 119
156 3300049668 Ga0501233_026315 Ga0501233_026315_657_1019 119
157 3300049669 Ga0501235_001873 Ga0501235_001873_1851_2213 119
158 3300049670 Ga0501236_003095 Ga0501236_003095_448_810 119
159 3300049675 Ga0501243_000844 Ga0501243_000844_3087_3449 119
160 3300049676 Ga0501246_002553 Ga0501246_002553_55_417 119
161 3300049679 Ga0501249_031028 Ga0501249_031028_440_802 119
162 3300049680 Ga0501250_003242 Ga0501250_003242_536_898 119
163 3300049681 Ga0501251_008275 Ga0501251_008275_170_532 119
164 3300049684 Ga0501255_051223 Ga0501255_051223_126_488 119
165 3300049686 Ga0501257_025373 Ga0501257_025373_534_896 119
166 3300049687 Ga0501258_039897 Ga0501258_039897_203_565 119
167 3300049704 Ga0501221_204090 Ga0501221_204090_51_413 119
168 3300049706 Ga0501229_014292 Ga0501229_014292_146_508 119
169 3300049707 Ga0501234_010257 Ga0501234_010257_688_1050 119
170 3300049708 Ga0501245_001961 Ga0501245_001961_796_1158 119
171 3300049765 Ga0501268_000952 Ga0501268_000952_644_1006 119
172 3300049770 Ga0501273_002987 Ga0501273_002987_35_397 119
173 3300049779 Ga0501283_076336 Ga0501283_076336_204_566 119
174 3300049850 Ga0501204_040087 Ga0501204_040087_83_445 119
175 3300049851 Ga0501212_012789 Ga0501212_012789_276_638 119
176 3300050508 nmdc:mga09592_1048159_c1 nmdc:mga09592_1048159_c1_306_668 119
177 3300050515 nmdc:mga0a205_284846_c1 nmdc:mga0a205_284846_c1_61_423 119
178 3300050515 nmdc:mga0a205_321845_c1 nmdc:mga0a205_321845_c1_1009_1371 119
179 2124908026 MRS1a_Contig_2924 MRS1a_00144600 120
180 2162886006 SwRhRL3b_contig_1543783 SwRhRL3b_0027.00000590 120
181 2162886007 SwRhRL2b_contig_2418641 SwRhRL2b_0004.00005310 120
182 3300002459 JGI24751J29686_10000017 JGI24751J29686_1000001714 120
183 3300002459 JGI24751J29686_10000149 JGI24751J29686_1000014926 120
184 3300003322 rootL2_10100126 rootL2_101001262 120
185 3300005288 Ga0065714_10064460 Ga0065714_1006446065 120
186 3300005288 Ga0065714_10466215 Ga0065714_104662151 120
187 3300005289 Ga0065704_10570640 Ga0065704_105706401 120
188 3300005290 Ga0065712_10023479 Ga0065712_100234792 120
189 3300005290 Ga0065712_10068069 Ga0065712_100680693 120
190 3300005290 Ga0065712_10088236 Ga0065712_100882362 120
191 3300005290 Ga0065712_10097738 Ga0065712_100977382 120
192 3300005293 Ga0065715_10034020 Ga0065715_100340202 120
193 3300005293 Ga0065715_10113683 Ga0065715_101136833 120
194 3300005293 Ga0065715_10127672 Ga0065715_101276721 120
195 3300005293 Ga0065715_10233854 Ga0065715_102338542 120
196 3300005293 Ga0065715_10260477 Ga0065715_102604771 120
197 3300005293 Ga0065715_10737313 Ga0065715_107373131 120
198 3300005295 Ga0065707_10003124 Ga0065707_100031242 120
199 3300005295 Ga0065707_10313967 Ga0065707_103139671 120
200 3300005295 Ga0065707_10549429 Ga0065707_105494292 120
201 3300005328 Ga0070676_10624055 Ga0070676_106240553 120
202 3300005328 Ga0070676_10887878 Ga0070676_108878782 120
203 3300005330 Ga0070690_100036190 Ga0070690_1000361902 120
204 3300005330 Ga0070690_100133828 Ga0070690_1001338282 120
205 3300005330 Ga0070690_100394660 Ga0070690_1003946602 120
206 3300005331 Ga0070670_100000232 Ga0070670_1000002324 120
207 3300005331 Ga0070670_100109704 Ga0070670_1001097041 120
208 3300005331 Ga0070670_100634465 Ga0070670_1006344652 120
209 3300005334 Ga0068869_100057679 Ga0068869_1000576794 120
210 3300005334 Ga0068869_100498488 Ga0068869_1004984882 120
211 3300005334 Ga0068869_100576776 Ga0068869_1005767762 120
212 3300005337 Ga0070682_101527225 Ga0070682_1015272251 120
213 3300005337 Ga0070682_101808152 Ga0070682_1018081521 120
214 3300005338 Ga0068868_100981568 Ga0068868_1009815681 120
215 3300005339 Ga0070660_100771788 Ga0070660_1007717882 120
216 3300005340 Ga0070689_100547508 Ga0070689_1005475082 120
217 3300005340 Ga0070689_100688730 Ga0070689_1006887301 120
218 3300005340 Ga0070689_100728623 Ga0070689_1007286231 120
219 3300005343 Ga0070687_100094099 Ga0070687_1000940992 120
220 3300005343 Ga0070687_100925491 Ga0070687_1009254912 120
221 3300005345 Ga0070692_10823043 Ga0070692_108230431 120
222 3300005345 Ga0070692_11223127 Ga0070692_112231271 120
223 3300005353 Ga0070669_100078278 Ga0070669_1000782783 120
224 3300005353 Ga0070669_100446160 Ga0070669_1004461602 120
225 3300005354 Ga0070675_100050511 Ga0070675_1000505115 120
226 3300005355 Ga0070671_100800818 Ga0070671_1008008182 120
227 3300005364 Ga0070673_100223788 Ga0070673_1002237882 120
228 3300005364 Ga0070673_100533336 Ga0070673_1005333362 120
229 3300005364 Ga0070673_100645100 Ga0070673_1006451003 120
230 3300005365 Ga0070688_100031808 Ga0070688_1000318081 120
231 3300005365 Ga0070688_100621934 Ga0070688_1006219341 120
232 3300005365 Ga0070688_100765034 Ga0070688_1007650342 120
233 3300005366 Ga0070659_100103803 Ga0070659_1001038033 120
234 3300005367 Ga0070667_100517430 Ga0070667_1005174302 120
235 3300005438 Ga0070701_10038352 Ga0070701_100383522 120
236 3300005438 Ga0070701_10162494 Ga0070701_101624941 120
237 3300005440 Ga0070705_101183449 Ga0070705_1011834491 120
238 3300005441 Ga0070700_100038842 Ga0070700_1000388421 120
239 3300005444 Ga0070694_100109309 Ga0070694_1001093093 120
240 3300005444 Ga0070694_100960930 Ga0070694_1009609301 120
241 3300005457 Ga0070662_100972062 Ga0070662_1009720621 120
242 3300005457 Ga0070662_101208569 Ga0070662_1012085691 120
243 3300005458 Ga0070681_10088369 Ga0070681_100883692 120
244 3300005459 Ga0068867_100039774 Ga0068867_1000397745 120
245 3300005459 Ga0068867_100535949 Ga0068867_1005359492 120
246 3300005459 Ga0068867_101466121 Ga0068867_1014661211 120
247 3300005466 Ga0070685_10264117 Ga0070685_102641171 120
248 3300005467 Ga0070706_100000088 Ga0070706_10000008829 120
249 3300005471 Ga0070698_100801146 Ga0070698_1008011461 120
250 3300005518 Ga0070699_100347191 Ga0070699_1003471912 120
251 3300005539 Ga0068853_100347749 Ga0068853_1003477491 120
252 3300005539 Ga0068853_100919331 Ga0068853_1009193312 120
253 3300005544 Ga0070686_100067207 Ga0070686_1000672073 120
254 3300005544 Ga0070686_100196890 Ga0070686_1001968902 120
255 3300005545 Ga0070695_100105572 Ga0070695_1001055722 120
256 3300005545 Ga0070695_100480289 Ga0070695_1004802891 120
257 3300005545 Ga0070695_101827341 Ga0070695_1018273411 120
258 3300005546 Ga0070696_101636000 Ga0070696_1016360001 120
259 3300005547 Ga0070693_100056842 Ga0070693_1000568422 120
260 3300005547 Ga0070693_100059069 Ga0070693_1000590693 120
261 3300005547 Ga0070693_100146527 Ga0070693_1001465273 120
262 3300005547 Ga0070693_100161224 Ga0070693_1001612242 120
263 3300005547 Ga0070693_100273864 Ga0070693_1002738641 120
264 3300005547 Ga0070693_100524552 Ga0070693_1005245522 120
265 3300005547 Ga0070693_100918175 Ga0070693_1009181752 120
266 3300005547 Ga0070693_101628730 Ga0070693_1016287301 120
267 3300005548 Ga0070665_102261314 Ga0070665_1022613141 120
268 3300005549 Ga0070704_100701374 Ga0070704_1007013742 120
269 3300005549 Ga0070704_101065983 Ga0070704_1010659831 120
270 3300005549 Ga0070704_101404584 Ga0070704_1014045841 120
271 3300005563 Ga0068855_101439347 Ga0068855_1014393472 120
272 3300005563 Ga0068855_102206042 Ga0068855_1022060421 120
273 3300005564 Ga0070664_100473717 Ga0070664_1004737173 120
274 3300005564 Ga0070664_100587457 Ga0070664_1005874572 120
275 3300005577 Ga0068857_100187659 Ga0068857_1001876592 120
276 3300005577 Ga0068857_100872552 Ga0068857_1008725522 120
277 3300005577 Ga0068857_101846538 Ga0068857_1018465381 120
278 3300005578 Ga0068854_100029675 Ga0068854_1000296752 120
279 3300005578 Ga0068854_100742376 Ga0068854_1007423762 120
280 3300005578 Ga0068854_100887772 Ga0068854_1008877722 120
281 3300005615 Ga0070702_100394665 Ga0070702_1003946651 120
282 3300005615 Ga0070702_100479195 Ga0070702_1004791952 120
283 3300005616 Ga0068852_100380528 Ga0068852_1003805282 120
284 3300005617 Ga0068859_100093958 Ga0068859_1000939582 120
285 3300005617 Ga0068859_100110223 Ga0068859_1001102232 120
286 3300005617 Ga0068859_100221163 Ga0068859_1002211633 120
287 3300005617 Ga0068859_100236514 Ga0068859_1002365142 120
288 3300005617 Ga0068859_100275958 Ga0068859_1002759582 120
289 3300005617 Ga0068859_100983135 Ga0068859_1009831352 120
290 3300005617 Ga0068859_101154612 Ga0068859_1011546122 120
291 3300005618 Ga0068864_100121094 Ga0068864_1001210942 120
292 3300005618 Ga0068864_100369589 Ga0068864_1003695892 120
293 3300005618 Ga0068864_100762875 Ga0068864_1007628752 120
294 3300005618 Ga0068864_100977680 Ga0068864_1009776802 120
295 3300005718 Ga0068866_10436184 Ga0068866_104361842 120
296 3300005719 Ga0068861_100060825 Ga0068861_1000608255 120
297 3300005719 Ga0068861_100296857 Ga0068861_1002968572 120
298 3300005719 Ga0068861_102265821 Ga0068861_1022658211 120
299 3300005841 Ga0068863_100020026 Ga0068863_1000200264 120
300 3300005841 Ga0068863_100675388 Ga0068863_1006753882 120
301 3300005841 Ga0068863_101984538 Ga0068863_1019845382 120
302 3300005842 Ga0068858_100154813 Ga0068858_1001548132 120
303 3300005842 Ga0068858_100173254 Ga0068858_1001732542 120
304 3300005842 Ga0068858_100197547 Ga0068858_1001975472 120
305 3300005842 Ga0068858_100307405 Ga0068858_1003074052 120
306 3300005842 Ga0068858_101433509 Ga0068858_1014335091 120
307 3300005843 Ga0068860_100325701 Ga0068860_1003257012 120
308 3300005843 Ga0068860_101365658 Ga0068860_1013656582 120
309 3300005844 Ga0068862_100055721 Ga0068862_1000557212 120
310 3300005844 Ga0068862_100389045 Ga0068862_1003890452 120
311 3300005844 Ga0068862_100573868 Ga0068862_1005738681 120
312 3300005844 Ga0068862_101286901 Ga0068862_1012869011 120
313 3300006058 Ga0075432_10038593 Ga0075432_100385932 120
314 3300006173 Ga0070716_100752238 Ga0070716_1007522382 120
315 3300006237 Ga0097621_101477630 Ga0097621_1014776301 120
316 3300006358 Ga0068871_100026181 Ga0068871_1000261812 120
317 3300006358 Ga0068871_101257801 Ga0068871_1012578011 120
318 3300006852 Ga0075433_10277804 Ga0075433_102778043 120
319 3300006871 Ga0075434_100207703 Ga0075434_1002077033 120
320 3300006871 Ga0075434_100389424 Ga0075434_1003894242 120
321 3300006880 Ga0075429_101009687 Ga0075429_1010096872 120
322 3300006881 Ga0068865_100003932 Ga0068865_1000039324 120
323 3300006881 Ga0068865_100289875 Ga0068865_1002898752 120
324 3300006914 Ga0075436_100036723 Ga0075436_1000367232 120
325 3300006931 Ga0097620_100093956 Ga0097620_1000939562 120
326 3300006931 Ga0097620_100110234 Ga0097620_1001102342 120
327 3300006931 Ga0097620_100221160 Ga0097620_1002211603 120
328 3300006931 Ga0097620_100236507 Ga0097620_1002365072 120
329 3300006931 Ga0097620_100275960 Ga0097620_1002759602 120
330 3300006931 Ga0097620_100983173 Ga0097620_1009831732 120
331 3300006931 Ga0097620_101154555 Ga0097620_1011545552 120
332 3300009093 Ga0105240_10042014 Ga0105240_100420143 120
333 3300009093 Ga0105240_11001317 Ga0105240_110013172 120
334 3300009094 Ga0111539_10000627 Ga0111539_1000062736 120
335 3300009098 Ga0105245_11306554 Ga0105245_113065542 120
336 3300009098 Ga0105245_11726778 Ga0105245_117267781 120
337 3300009101 Ga0105247_10000592 Ga0105247_1000059212 120
338 3300009101 Ga0105247_11150446 Ga0105247_111504461 120
339 3300009101 Ga0105247_11332838 Ga0105247_113328381 120
340 3300009148 Ga0105243_10219336 Ga0105243_102193362 120
341 3300009148 Ga0105243_10356450 Ga0105243_103564502 120
342 3300009174 Ga0105241_10075409 Ga0105241_100754094 120
343 3300009174 Ga0105241_10325947 Ga0105241_103259472 120
344 3300009174 Ga0105241_10660959 Ga0105241_106609591 120
345 3300009174 Ga0105241_11889490 Ga0105241_118894901 120
346 3300009174 Ga0105241_11981180 Ga0105241_119811801 120
347 3300009176 Ga0105242_10136314 Ga0105242_101363142 120
348 3300009176 Ga0105242_10413182 Ga0105242_104131822 120
349 3300009176 Ga0105242_12122488 Ga0105242_121224881 120
350 3300009177 Ga0105248_10031377 Ga0105248_100313772 120
351 3300009177 Ga0105248_10172362 Ga0105248_101723623 120
352 3300009177 Ga0105248_10415032 Ga0105248_104150321 120
353 3300009177 Ga0105248_10720570 Ga0105248_107205702 120
354 3300009177 Ga0105248_10728726 Ga0105248_107287261 120
355 3300009177 Ga0105248_11863051 Ga0105248_118630511 120
356 3300009545 Ga0105237_10938743 Ga0105237_109387431 120
357 3300009551 Ga0105238_10013915 Ga0105238_100139157 120
358 3300009553 Ga0105249_10079461 Ga0105249_100794613 120
359 3300009553 Ga0105249_11226321 Ga0105249_112263211 120
360 3300009553 Ga0105249_12254330 Ga0105249_122543301 120
361 3300010375 Ga0105239_10101647 Ga0105239_101016473 120
362 3300010375 Ga0105239_10720297 Ga0105239_107202972 120
363 3300011119 Ga0105246_10119343 Ga0105246_101193433 120
364 3300011119 Ga0105246_10255653 Ga0105246_102556532 120
365 3300012498 Ga0157345_1034611 Ga0157345_10346111 120
366 3300013100 Ga0157373_10184438 Ga0157373_101844381 120
367 3300013100 Ga0157373_10203625 Ga0157373_102036252 120
368 3300013100 Ga0157373_10235246 Ga0157373_102352461 120
369 3300013102 Ga0157371_11667602 Ga0157371_116676021 120
370 3300013296 Ga0157374_10683273 Ga0157374_106832731 120
371 3300013296 Ga0157374_12130306 Ga0157374_121303061 120
372 3300013297 Ga0157378_10016275 Ga0157378_100162753 120
373 3300013297 Ga0157378_10475940 Ga0157378_104759402 120
374 3300013297 Ga0157378_10507540 Ga0157378_105075402 120
375 3300013306 Ga0163162_10954358 Ga0163162_109543582 120
376 3300013306 Ga0163162_11126234 Ga0163162_111262341 120
377 3300013306 Ga0163162_11448138 Ga0163162_114481382 120
378 3300013306 Ga0163162_11503961 Ga0163162_115039611 120
379 3300013307 Ga0157372_10001564 Ga0157372_1000156411 120
380 3300013307 Ga0157372_10525322 Ga0157372_105253222 120
381 3300013308 Ga0157375_11237144 Ga0157375_112371442 120
382 3300014325 Ga0163163_10000862 Ga0163163_1000086211 120
383 3300014325 Ga0163163_10028737 Ga0163163_100287373 120
384 3300014325 Ga0163163_10239359 Ga0163163_102393592 120
385 3300014325 Ga0163163_12981797 Ga0163163_129817971 120
386 3300014326 Ga0157380_10041329 Ga0157380_100413292 120
387 3300014745 Ga0157377_10166491 Ga0157377_101664912 120
388 3300014745 Ga0157377_10638848 Ga0157377_106388482 120
389 3300014968 Ga0157379_10598975 Ga0157379_105989751 120
390 3300014969 Ga0157376_10092080 Ga0157376_100920801 120
391 3300014969 Ga0157376_10304672 Ga0157376_103046722 120
392 3300017792 Ga0163161_10020068 Ga0163161_100200686 120
393 3300017792 Ga0163161_10361721 Ga0163161_103617211 120
394 3300025315 Ga0207697_10027211 Ga0207697_100272112 120
395 3300025899 Ga0207642_10516416 Ga0207642_105164161 120
396 3300025900 Ga0207710_10001345 Ga0207710_1000134512 120
397 3300025900 Ga0207710_10292953 Ga0207710_102929532 120
398 3300025900 Ga0207710_10377876 Ga0207710_103778761 120
399 3300025901 Ga0207688_10137459 Ga0207688_101374591 120
400 3300025910 Ga0207684_10000131 Ga0207684_10000131115 120
401 3300025911 Ga0207654_10073342 Ga0207654_100733423 120
402 3300025911 Ga0207654_10575672 Ga0207654_105756722 120
403 3300025911 Ga0207654_10750465 Ga0207654_107504651 120
404 3300025913 Ga0207695_10185550 Ga0207695_101855502 120
405 3300025918 Ga0207662_10007196 Ga0207662_100071964 120
406 3300025921 Ga0207652_11283239 Ga0207652_112832392 120
407 3300025923 Ga0207681_11042149 Ga0207681_110421491 120
408 3300025923 Ga0207681_11108626 Ga0207681_111086261 120
409 3300025924 Ga0207694_10007934 Ga0207694_100079346 120
410 3300025924 Ga0207694_10768580 Ga0207694_107685802 120
411 3300025925 Ga0207650_10000005 Ga0207650_10000005333 120
412 3300025925 Ga0207650_10143550 Ga0207650_101435502 120
413 3300025925 Ga0207650_10377185 Ga0207650_103771853 120
414 3300025925 Ga0207650_11706722 Ga0207650_117067221 120
415 3300025927 Ga0207687_10070577 Ga0207687_100705773 120
416 3300025931 Ga0207644_10288668 Ga0207644_102886681 120
417 3300025932 Ga0207690_10069982 Ga0207690_100699823 120
418 3300025933 Ga0207706_10516221 Ga0207706_105162212 120
419 3300025934 Ga0207686_11301564 Ga0207686_113015641 120
420 3300025935 Ga0207709_10246975 Ga0207709_102469752 120
421 3300025935 Ga0207709_10415901 Ga0207709_104159011 120
422 3300025936 Ga0207670_10210854 Ga0207670_102108542 120
423 3300025936 Ga0207670_11715281 Ga0207670_117152812 120
424 3300025937 Ga0207669_10434986 Ga0207669_104349862 120
425 3300025938 Ga0207704_11020054 Ga0207704_110200542 120
426 3300025939 Ga0207665_10682235 Ga0207665_106822352 120
427 3300025940 Ga0207691_10001531 Ga0207691_1000153111 120
428 3300025941 Ga0207711_10119115 Ga0207711_101191154 120
429 3300025941 Ga0207711_10733183 Ga0207711_107331832 120
430 3300025941 Ga0207711_10859117 Ga0207711_108591172 120
431 3300025941 Ga0207711_11280659 Ga0207711_112806592 120
432 3300025942 Ga0207689_10016157 Ga0207689_100161572 120
433 3300025942 Ga0207689_11210648 Ga0207689_112106482 120
434 3300025945 Ga0207679_10456899 Ga0207679_104568992 120
435 3300025945 Ga0207679_10519866 Ga0207679_105198662 120
436 3300025945 Ga0207679_10520563 Ga0207679_105205632 120
437 3300025960 Ga0207651_10566526 Ga0207651_105665262 120
438 3300025961 Ga0207712_10087238 Ga0207712_100872382 120
439 3300025961 Ga0207712_10161080 Ga0207712_101610803 120
440 3300025981 Ga0207640_10011656 Ga0207640_100116564 120
441 3300025981 Ga0207640_10511601 Ga0207640_105116011 120
442 3300026023 Ga0207677_10195755 Ga0207677_101957552 120
443 3300026035 Ga0207703_10187358 Ga0207703_101873582 120
444 3300026035 Ga0207703_10884838 Ga0207703_108848382 120
445 3300026035 Ga0207703_11052691 Ga0207703_110526912 120
446 3300026035 Ga0207703_11450807 Ga0207703_114508072 120
447 3300026041 Ga0207639_10251594 Ga0207639_102515943 120
448 3300026041 Ga0207639_10482397 Ga0207639_104823972 120
449 3300026041 Ga0207639_11388458 Ga0207639_113884582 120
450 3300026075 Ga0207708_10026030 Ga0207708_100260303 120
451 3300026075 Ga0207708_10143451 Ga0207708_101434513 120
452 3300026088 Ga0207641_11486728 Ga0207641_114867281 120
453 3300026088 Ga0207641_11573785 Ga0207641_115737851 120
454 3300026089 Ga0207648_10024682 Ga0207648_100246823 120
455 3300026089 Ga0207648_10177204 Ga0207648_101772041 120
456 3300026089 Ga0207648_10890254 Ga0207648_108902542 120
457 3300026095 Ga0207676_10113462 Ga0207676_101134622 120
458 3300026095 Ga0207676_10305641 Ga0207676_103056413 120
459 3300026095 Ga0207676_10443944 Ga0207676_104439442 120
460 3300026095 Ga0207676_10964679 Ga0207676_109646792 120
461 3300026116 Ga0207674_10678387 Ga0207674_106783872 120
462 3300026118 Ga0207675_100098231 Ga0207675_1000982311 120
463 3300026118 Ga0207675_100351838 Ga0207675_1003518382 120
464 3300026142 Ga0207698_10803468 Ga0207698_108034682 120
465 3300027907 Ga0207428_10014828 Ga0207428_100148286 120
466 3300028380 Ga0268265_10162894 Ga0268265_101628942 120
467 3300028380 Ga0268265_10784642 Ga0268265_107846421 120
468 3300028381 Ga0268264_10318714 Ga0268264_103187142 120
469 3300028381 Ga0268264_10321652 Ga0268264_103216523 120
470 3300028381 Ga0268264_10366833 Ga0268264_103668332 120
471 3300031548 Ga0307408_100138249 Ga0307408_1001382492 120
472 3300031548 Ga0307408_100918624 Ga0307408_1009186242 120
473 3300031901 Ga0307406_10771261 Ga0307406_107712612 120
474 3300031911 Ga0307412_10200959 Ga0307412_102009592 120
475 3300032004 Ga0307414_10085449 Ga0307414_100854492 120
476 3300032005 Ga0307411_10187762 Ga0307411_101877623 120
477 3300035088 Ga0373940_0101130 Ga0373940_0101130_25_396 120
478 3300035090 Ga0373949_0237474 Ga0373949_0237474_92_463 120
479 3300035091 Ga0373951_0110502 Ga0373951_0110502_188_559 120
480 3300036401 Ga0373937_0133226 Ga0373937_0133226_328_717 120
481 3300037466 Ga0395898_1571108 Ga0395898_1571108_119_490 120
482 3300038698 Ga0242419_008447 Ga0242419_008447_218_589 120
483 3300038996 Ga0242420_016162 Ga0242420_016162_652_1023 120
484 3300038996 Ga0242420_081728 Ga0242420_081728_18_389 120
485 3300046472 Ga0495580_0896283 Ga0495580_0896283_14_403 120
486 3300046683 Ga0495658_0247584 Ga0495658_0247584_584_973 120
487 3300048905 Ga0496102_0597497 Ga0496102_0597497_228_599 120
488 3300048905 Ga0496102_0964465 Ga0496102_0964465_277_657 120
489 3300048907 Ga0496104_0288307 Ga0496104_0288307_258_623 120
490 3300048909 Ga0496106_0038689 Ga0496106_0038689_262_633 120
491 3300048911 Ga0496108_0660777 Ga0496108_0660777_252_623 120
492 3300048914 Ga0496111_0874641 Ga0496111_0874641_210_590 120
493 3300048915 Ga0496112_0443163 Ga0496112_0443163_555_932 120
494 3300048915 Ga0496112_0478351 Ga0496112_0478351_21_395 120
495 3300048915 Ga0496112_0692355 Ga0496112_0692355_158_529 120
496 3300048915 Ga0496112_1055648 Ga0496112_1055648_69_446 120
497 3300048915 Ga0496112_1091426 Ga0496112_1091426_269_640 120
498 3300048915 Ga0496112_1814173 Ga0496112_1814173_52_423 120
499 3300049519 Ga0501296_001018 Ga0501296_001018_1614_1985 120
500 3300049520 Ga0501297_004082 Ga0501297_004082_775_1146 120
501 3300049522 Ga0501299_038684 Ga0501299_038684_387_758 120
502 3300049574 Ga0501038_0011801 Ga0501038_0011801_1431_1805 120
503 3300049651 Ga0501201_024900 Ga0501201_024900_71_442 120
504 3300049652 Ga0501202_033463 Ga0501202_033463_477_848 120
505 3300049653 Ga0501206_003397 Ga0501206_003397_1194_1565 120
506 3300049661 Ga0501217_003386 Ga0501217_003386_2625_2996 120
507 3300049663 Ga0501223_037852 Ga0501223_037852_191_562 120
508 3300049677 Ga0501247_018673 Ga0501247_018673_155_526 120
509 3300049679 Ga0501249_118231 Ga0501249_118231_94_465 120
510 3300049743 Ga0501081_1243917 Ga0501081_1243917_161_544 120
511 3300050511 nmdc:mga08y16_3655_c1 nmdc:mga08y16_3655_c1_13103_13474 120
512 3300050514 nmdc:mga08x19_79247_c1 nmdc:mga08x19_79247_c1_1528_1905 120
513 3300050515 nmdc:mga0a205_1489596_c1 nmdc:mga0a205_1489596_c1_140_505 120
514 3300050515 nmdc:mga0a205_449605_c1 nmdc:mga0a205_449605_c1_703_1074 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

4

112

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.961 1 118
1zy2-assembly1.cif.gz_B crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus 0.9608 3 119
4d6x-assembly1.cif.gz_A crystal structure of the receiver domain of ntrx from brucella abortus 0.9593 4 117
7w9h-assembly1.cif.gz_A crystal structure of the receiver domain of the transcription regulator fler from pseudomonas aeruginosa 0.9591 2 114
5m7p-assembly1.cif.gz_A crystal structure of ntrx from brucella abortus in complex with adp processed with the crystaldirect automated mounting and cryo-cooling technology 0.9582 2 119
ID Description Score Start End Superfamily
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9698 1 118 3.40.50.2300
4d6yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9697 4 117 3.40.50.2300
2oqrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9631 1 77 3.40.50.2300
1zy2B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9608 3 119 3.40.50.2300
1zy2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.958 3 119 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3B9LSD2-F1-model_v4 Response regulatory domain-containing protein 0.9986 2 119 GO:0000155
AF-A0A3D5SHZ5-F1-model_v4 Response regulatory domain-containing protein 0.9982 2 119 GO:0000155
AF-A0A3B9MM53-F1-model_v4 Response regulatory domain-containing protein 0.9981 2 119 GO:0000155
AF-A0A317I708-F1-model_v4 Response regulatory domain-containing protein 0.9956 1 118 GO:0000160
AF-A0A7V9KP87-F1-model_v4 Response regulator 0.9948 1 114 GO:0000160

Feature Viewer

pLDDT pTM Quality
89.23 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map