F457644

General Info

Members Datasets Scaffolds Average Seq Length
513 248 502 684

Family's Representative Sequence

Representative Sequence 3300053092|Ga0500583_0000975|Ga0500583_0000975_2957_5161
Length 734
Sequence MIDERIIIFHGKTEPNGAPILFECQSVIPYAGVIRSHWRTIKFFYLRKLTTVCMSKLGNYITGDXXXXDGEGQALYNAVTGETIAHASTKGLDFKSILAYARDIGNPALRKMTFPERGRMLRALALYLKERVEPFYRISYLTGATRADSWIDLEGGIGNLFSYASLRRKFPNESFCLDGDGMSLGKANTFMGQHILVPKVGVAIHINAFNFPVWGMLEKIAVNLLAGVPAVVKPASVTSYLTEAVVREIVASGILPPGALQLICGSAGDLLDHVTDQDVVTFTGSASTGQQLKAHPAILRENTPFNMEADSLNCLILGEDVDPGMPEWDLFIKELRKEMTVKAGQKCTAVRRIFVPAAKMEDAWKALAKALTQTTIGNPENEKVRMGALAGNAQRDEVRGQVRRLLASSQILYGSLDSVSVIDADSVKGAFLSPLLLLNEKPFTSEEPHTIEAFGPVSTIMPYNGADEAIELSKKGKGSLCSTIVTADPRQAREYVLGAATHHGRILILNNECAKESTGHGSPLPLLVHGGPGRAGGGEEMGGLRGVKHYMQRVAVQGSPSMITSLTHTWQPHARQHTEDKHPFRKYFEELQIGDTVITHKRTVTEADITNFANLSWDHFYAHTDHTSLEGTLFEKPVAHGYFVLSAAAGLFVDAGKGPVMLNYGLEECRFLKPVYAGTTIGVRLTCKEKIEQEKREETDLPRGIVKWYVDVYDQTGDSVAIATILTMVQKQSS

Samples

Sample ID Description Type Environment
1 2643221546 Microbacterium sp. Root53 Isolate Unclassified
2 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
5 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
6 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
7 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
8 2818991444 Filimonas endophytica 3197 Isolate Unclassified
9 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
10 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
11 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
218 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
219 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
220 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
221 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
222 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
223 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
224 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
225 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
226 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
227 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
228 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
229 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
230 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
239 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
240 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
241 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
242 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
243 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
246 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
247 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
248 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 0
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.31
Nodule 0.19
Rhizoplane 1.75
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001692 3300001979 Bacteria 10127
2 JGI24739J22299_10009431 3300001989 Bacteria 3637
3 JGI25406J46586_10003399 3300003203 Bacteria 7488
4 rootH2_10006463 3300003320 Bacteria 45674
5 rootH2_10012033 3300003320 Bacteria 19273
6 rootL2_10010261 3300003322 Bacteria 11482
7 rootL2_10101088 3300003322 Bacteria 11252
8 rootH1_10020501 3300003323 Bacteria 26877
9 rootH1_10052994 3300003323 Bacteria 7506
10 JGI25160J50197_1000539 3300003354 Bacteria 21642
11 Ga0065165_1001114 3300005262 Bacteria 31744
12 Ga0065712_10070884 3300005290 Bacteria 5616
13 Ga0065707_10086561 3300005295 Bacteria 5401
14 Ga0070658_10009105 3300005327 Bacteria 7982
15 Ga0070658_10062039 3300005327 Unclassified 3046
16 Ga0070676_10015381 3300005328 Bacteria 4220
17 Ga0070683_100010274 3300005329 Bacteria 8046
18 Ga0070683_100027291 3300005329 Bacteria 5148
19 Ga0070690_100027439 3300005330 Bacteria 3520
20 Ga0070670_100056284 3300005331 Bacteria 3375
21 Ga0068869_100003043 3300005334 Bacteria 10197
22 Ga0068869_100019937 3300005334 Unclassified 4591
23 Ga0068869_100046514 3300005334 Bacteria 3129
24 Ga0068869_100074640 3300005334 Bacteria 2517
25 Ga0068869_100094155 3300005334 Bacteria 2258
26 Ga0070666_10000180 3300005335 Bacteria 43265
27 Ga0070666_10000842 3300005335 Bacteria 18608
28 Ga0070666_10001692 3300005335 Bacteria 13450
29 Ga0070666_10036589 3300005335 Unclassified 3260
30 Ga0070666_10064692 3300005335 Bacteria 2481
31 Ga0070680_100000160 3300005336 Bacteria 42287
32 Ga0070680_100003835 3300005336 Bacteria 11246
33 Ga0070682_100000012 3300005337 Bacteria 265658
34 Ga0070682_100000504 3300005337 Bacteria 24569
35 Ga0068868_100004644 3300005338 Bacteria 9642
36 Ga0068868_100058084 3300005338 Bacteria 3057
37 Ga0070660_100000295 3300005339 Bacteria 33225
38 Ga0070660_100028417 3300005339 Unclassified 4184
39 Ga0070689_100014387 3300005340 Bacteria 5746
40 Ga0070689_100017112 3300005340 Bacteria 5318
41 Ga0070689_100043867 3300005340 Unclassified 3439
42 Ga0070689_100046147 3300005340 Bacteria 3356
43 Ga0070689_100048207 3300005340 Unclassified 3285
44 Ga0070691_10002266 3300005341 Bacteria 8520
45 Ga0070687_100005317 3300005343 Bacteria 5204
46 Ga0070661_100004288 3300005344 Bacteria 9834
47 Ga0070669_100029342 3300005353 Unclassified 3964
48 Ga0070675_100017907 3300005354 Bacteria 5635
49 Ga0070675_100025666 3300005354 Bacteria 4724
50 Ga0070675_100095767 3300005354 Unclassified 2493
51 Ga0070671_100003764 3300005355 Bacteria 11909
52 Ga0070671_100028086 3300005355 Bacteria 4633
53 Ga0070674_100005144 3300005356 Bacteria 7522
54 Ga0070688_100004858 3300005365 Bacteria 7030
55 Ga0070659_100006147 3300005366 Bacteria 8668
56 Ga0070659_100006546 3300005366 Bacteria 8413
57 Ga0070667_100001665 3300005367 Bacteria 19848
58 Ga0070667_100007424 3300005367 Bacteria 9107
59 Ga0070667_100020042 3300005367 Bacteria 5552
60 Ga0070667_100041155 3300005367 Bacteria 3877
61 Ga0070678_100030700 3300005456 Unclassified 3697
62 Ga0070678_100085360 3300005456 Bacteria 2405
63 Ga0070662_100000209 3300005457 Bacteria 34168
64 Ga0070662_100005589 3300005457 Bacteria 8035
65 Ga0070681_10040021 3300005458 Unclassified 4700
66 Ga0068867_100006143 3300005459 Bacteria 8502
67 Ga0070706_100048635 3300005467 Bacteria 3913
68 Ga0070698_100002783 3300005471 Bacteria 19250
69 Ga0070698_100006808 3300005471 Bacteria 12392
70 Ga0070679_100000373 3300005530 Bacteria 38042
71 Ga0070679_100000789 3300005530 Bacteria 27515
72 Ga0070679_100016461 3300005530 Bacteria 7133
73 Ga0070684_100001647 3300005535 Bacteria 16191
74 Ga0070684_100013550 3300005535 Bacteria 6579
75 Ga0068853_100002923 3300005539 Bacteria 12995
76 Ga0068853_100004047 3300005539 Bacteria 11285
77 Ga0068853_100031752 3300005539 Unclassified 4468
78 Ga0070672_100002200 3300005543 Bacteria 12292
79 Ga0070686_100023472 3300005544 Bacteria 3686
80 Ga0070693_100013776 3300005547 Bacteria 4126
81 Ga0070665_100000002 3300005548 Bacteria 849037
82 Ga0070665_100013088 3300005548 Bacteria 8354
83 Ga0070665_100023765 3300005548 Bacteria 6173
84 Ga0068855_100000795 3300005563 Bacteria 39086
85 Ga0068855_100002019 3300005563 Bacteria 25173
86 Ga0068855_100004845 3300005563 Bacteria 16427
87 Ga0068855_100020840 3300005563 Bacteria 7861
88 Ga0070664_100006035 3300005564 Bacteria 9794
89 Ga0070664_100032071 3300005564 Unclassified 4394
90 Ga0070664_100055437 3300005564 Bacteria 3365
91 Ga0070664_100108050 3300005564 Bacteria 2426
92 Ga0068857_100002333 3300005577 Bacteria 15434
93 Ga0068857_100014246 3300005577 Bacteria 6927
94 Ga0068857_100031357 3300005577 Bacteria 4696
95 Ga0070702_100027918 3300005615 Bacteria 3051
96 Ga0068852_100000391 3300005616 Bacteria 29415
97 Ga0068852_100002613 3300005616 Bacteria 12447
98 Ga0068852_100009517 3300005616 Bacteria 7220
99 Ga0068852_100065186 3300005616 Bacteria 3177
100 Ga0068852_100114834 3300005616 Unclassified 2454
101 Ga0068859_100000003 3300005617 Bacteria 479218
102 Ga0068859_100000289 3300005617 Bacteria 49979
103 Ga0068859_100003424 3300005617 Bacteria 16130
104 Ga0068859_100022800 3300005617 Bacteria 6276
105 Ga0068859_100041644 3300005617 Unclassified 4613
106 Ga0068859_100068012 3300005617 Bacteria 3597
107 Ga0068859_100097766 3300005617 Unclassified 2989
108 Ga0068864_100039400 3300005618 Bacteria 4039
109 Ga0068866_10011485 3300005718 Bacteria 3832
110 Ga0068861_100002293 3300005719 Bacteria 12423
111 Ga0068861_100029501 3300005719 Bacteria 4013
112 Ga0068870_10004265 3300005840 Bacteria 6145
113 Ga0068863_100002737 3300005841 Bacteria 17430
114 Ga0068863_100002952 3300005841 Bacteria 16798
115 Ga0068863_100005498 3300005841 Bacteria 12469
116 Ga0068863_100005788 3300005841 Bacteria 12118
117 Ga0068863_100017654 3300005841 Bacteria 6833
118 Ga0068863_100043781 3300005841 Bacteria 4249
119 Ga0068863_100046158 3300005841 Bacteria 4135
120 Ga0068858_100002818 3300005842 Bacteria 17483
121 Ga0068860_100000003 3300005843 Bacteria 575741
122 Ga0068860_100000453 3300005843 Bacteria 51733
123 Ga0068860_100000891 3300005843 Bacteria 33145
124 Ga0068860_100003354 3300005843 Bacteria 16492
125 Ga0068860_100003470 3300005843 Bacteria 16223
126 Ga0068860_100003552 3300005843 Bacteria 16035
127 Ga0068860_100058691 3300005843 Bacteria 3658
128 Ga0068862_100015255 3300005844 Bacteria 6381
129 Ga0081540_1004235 3300005983 Bacteria 11020
130 Ga0081539_10000389 3300005985 Bacteria 94754
131 Ga0097621_100001274 3300006237 Bacteria 17377
132 Ga0097621_100003854 3300006237 Bacteria 10386
133 Ga0097621_100027293 3300006237 Bacteria 4488
134 Ga0068871_100001455 3300006358 Bacteria 15838
135 Ga0068871_100004728 3300006358 Bacteria 9526
136 Ga0068871_100005215 3300006358 Bacteria 9088
137 Ga0068871_100006345 3300006358 Bacteria 8356
138 Ga0068871_100020520 3300006358 Bacteria 5063
139 Ga0075428_100056157 3300006844 Bacteria 4313
140 Ga0075430_100018743 3300006846 Bacteria 5889
141 Ga0075431_100003549 3300006847 Bacteria 15101
142 Ga0075429_100007833 3300006880 Bacteria 9278
143 Ga0068865_100058278 3300006881 Bacteria 2697
144 Ga0097620_100000003 3300006931 Bacteria 479218
145 Ga0097620_100000289 3300006931 Bacteria 49979
146 Ga0097620_100003424 3300006931 Bacteria 16130
147 Ga0097620_100022799 3300006931 Bacteria 6276
148 Ga0097620_100041643 3300006931 Unclassified 4613
149 Ga0097620_100068014 3300006931 Bacteria 3597
150 Ga0097620_100097767 3300006931 Unclassified 2989
151 Ga0105240_10000664 3300009093 Bacteria 63206
152 Ga0105240_10003417 3300009093 Bacteria 24669
153 Ga0105240_10005202 3300009093 Bacteria 19460
154 Ga0105240_10007539 3300009093 Bacteria 15772
155 Ga0105240_10013672 3300009093 Bacteria 11131
156 Ga0105240_10021183 3300009093 Bacteria 8653
157 Ga0105240_10029564 3300009093 Bacteria 7135
158 Ga0105240_10035628 3300009093 Bacteria 6411
159 Ga0105240_10121311 3300009093 Bacteria 3147
160 Ga0111539_10078829 3300009094 Bacteria 3874
161 Ga0105245_10001226 3300009098 Bacteria 23156
162 Ga0105247_10002199 3300009101 Bacteria 13422
163 Ga0114129_10001630 3300009147 Bacteria 30480
164 Ga0114129_10083808 3300009147 Bacteria 4426
165 Ga0114129_10101053 3300009147 Bacteria 3991
166 Ga0105243_10000150 3300009148 Bacteria 79825
167 Ga0105241_10000439 3300009174 Bacteria 31338
168 Ga0105241_10015312 3300009174 Bacteria 5617
169 Ga0105241_10026137 3300009174 Bacteria 4341
170 Ga0105242_10006916 3300009176 Bacteria 8752
171 Ga0105242_10007104 3300009176 Bacteria 8646
172 Ga0105242_10014808 3300009176 Bacteria 6040
173 Ga0105242_10117752 3300009176 Bacteria 2275
174 Ga0105248_10000478 3300009177 Bacteria 45595
175 Ga0105237_10000144 3300009545 Bacteria 100105
176 Ga0105237_10001444 3300009545 Bacteria 31385
177 Ga0105237_10001848 3300009545 Bacteria 27201
178 Ga0105237_10011031 3300009545 Bacteria 9586
179 Ga0105237_10030374 3300009545 Bacteria 5488
180 Ga0105238_10010105 3300009551 Bacteria 9458
181 Ga0105238_10017671 3300009551 Bacteria 7250
182 Ga0105238_10045249 3300009551 Bacteria 4447
183 Ga0105249_10002316 3300009553 Bacteria 16533
184 Ga0105249_10003201 3300009553 Bacteria 14176
185 Ga0105249_10010160 3300009553 Bacteria 8264
186 Ga0105249_10015813 3300009553 Bacteria 6686
187 Ga0105239_10001785 3300010375 Bacteria 28298
188 Ga0105239_10003647 3300010375 Bacteria 18816
189 Ga0105239_10003970 3300010375 Bacteria 17928
190 Ga0105239_10026020 3300010375 Bacteria 6442
191 Ga0105239_10075623 3300010375 Unclassified 3703
192 Ga0105246_10009077 3300011119 Bacteria 6123
193 Ga0157373_10008395 3300013100 Bacteria 7670
194 Ga0157373_10068516 3300013100 Bacteria 2508
195 Ga0157371_10001264 3300013102 Bacteria 26671
196 Ga0157371_10001864 3300013102 Bacteria 21109
197 Ga0157371_10002926 3300013102 Bacteria 15940
198 Ga0157371_10003669 3300013102 Bacteria 13798
199 Ga0157371_10006555 3300013102 Bacteria 9572
200 Ga0157371_10007523 3300013102 Bacteria 8813
201 Ga0157371_10013546 3300013102 Bacteria 6190
202 Ga0157371_10056978 3300013102 Bacteria 2771
203 Ga0157370_10002079 3300013104 Bacteria 24513
204 Ga0157370_10003185 3300013104 Bacteria 19409
205 Ga0157370_10005549 3300013104 Bacteria 14145
206 Ga0157370_10006166 3300013104 Bacteria 13302
207 Ga0157369_10018091 3300013105 Bacteria 7904
208 Ga0157369_10018325 3300013105 Bacteria 7850
209 Ga0157369_10048639 3300013105 Bacteria 4601
210 Ga0157369_10199720 3300013105 Bacteria 2099
211 Ga0157374_10000013 3300013296 Bacteria 461240
212 Ga0157374_10001382 3300013296 Bacteria 20609
213 Ga0157374_10005457 3300013296 Bacteria 10682
214 Ga0157374_10034346 3300013296 Bacteria 4631
215 Ga0157374_10071846 3300013296 Bacteria 3264
216 Ga0157374_10136100 3300013296 Bacteria 2382
217 Ga0157378_10010274 3300013297 Bacteria 8174
218 Ga0157378_10020385 3300013297 Bacteria 5830
219 Ga0157378_10033322 3300013297 Unclassified 4553
220 Ga0157378_10047843 3300013297 Bacteria 3803
221 Ga0163162_10001183 3300013306 Bacteria 24333
222 Ga0163162_10001237 3300013306 Bacteria 23878
223 Ga0163162_10002547 3300013306 Bacteria 17248
224 Ga0163162_10005701 3300013306 Bacteria 12037
225 Ga0163162_10011444 3300013306 Bacteria 8651
226 Ga0163162_10048128 3300013306 Unclassified 4271
227 Ga0163162_10092675 3300013306 Unclassified 3105
228 Ga0163162_10101015 3300013306 Bacteria 2976
229 Ga0163162_10147076 3300013306 Bacteria 2473
230 Ga0157372_10000747 3300013307 Bacteria 35352
231 Ga0157372_10000965 3300013307 Bacteria 31343
232 Ga0157372_10004621 3300013307 Bacteria 14638
233 Ga0157372_10014315 3300013307 Bacteria 8481
234 Ga0157372_10016799 3300013307 Bacteria 7856
235 Ga0157372_10046038 3300013307 Bacteria 4841
236 Ga0157372_10189411 3300013307 Bacteria 2382
237 Ga0157375_10000656 3300013308 Bacteria 30555
238 Ga0157375_10003489 3300013308 Bacteria 13634
239 Ga0157375_10010375 3300013308 Bacteria 8203
240 Ga0157375_10038095 3300013308 Bacteria 4613
241 Ga0163163_10001087 3300014325 Bacteria 23055
242 Ga0163163_10002750 3300014325 Bacteria 14845
243 Ga0163163_10004992 3300014325 Bacteria 11427
244 Ga0163163_10004997 3300014325 Bacteria 11425
245 Ga0157380_10005348 3300014326 Bacteria 8972
246 Ga0157380_10014572 3300014326 Bacteria 5755
247 Ga0157380_10027078 3300014326 Bacteria 4357
248 Ga0157377_10037270 3300014745 Bacteria 2679
249 Ga0157379_10008567 3300014968 Bacteria 8899
250 Ga0157379_10070874 3300014968 Unclassified 3119
251 Ga0157376_10000238 3300014969 Bacteria 38500
252 Ga0157376_10013411 3300014969 Bacteria 6114
253 Ga0157376_10050309 3300014969 Bacteria 3457
254 Ga0157376_10070668 3300014969 Unclassified 2964
255 Ga0157376_10087624 3300014969 Bacteria 2687
256 Ga0157376_10101616 3300014969 Bacteria 2513
257 Ga0213876_10000389 3300021384 Bacteria 36929
258 Ga0213876_10002517 3300021384 Bacteria 10752
259 Ga0207426_1000026 3300025302 Bacteria 515228
260 Ga0207682_10008208 3300025893 Bacteria 4139
261 Ga0207710_10000326 3300025900 Bacteria 36470
262 Ga0207680_10000073 3300025903 Bacteria 44634
263 Ga0207680_10008926 3300025903 Bacteria 4944
264 Ga0207647_10035784 3300025904 Bacteria 3161
265 Ga0207647_10065624 3300025904 Bacteria 2203
266 Ga0207645_10001186 3300025907 Bacteria 21516
267 Ga0207645_10004130 3300025907 Bacteria 10801
268 Ga0207645_10005478 3300025907 Bacteria 9190
269 Ga0207643_10014805 3300025908 Unclassified 4242
270 Ga0207705_10001687 3300025909 Bacteria 17568
271 Ga0207705_10019662 3300025909 Bacteria 4829
272 Ga0207654_10002439 3300025911 Bacteria 9495
273 Ga0207654_10004172 3300025911 Bacteria 7289
274 Ga0207707_10004345 3300025912 Bacteria 12541
275 Ga0207707_10030612 3300025912 Bacteria 4708
276 Ga0207695_10000064 3300025913 Bacteria 346010
277 Ga0207695_10000209 3300025913 Bacteria 157802
278 Ga0207695_10002106 3300025913 Bacteria 30249
279 Ga0207695_10002258 3300025913 Bacteria 28855
280 Ga0207695_10002430 3300025913 Bacteria 27580
281 Ga0207695_10010801 3300025913 Bacteria 11132
282 Ga0207695_10013165 3300025913 Bacteria 9872
283 Ga0207671_10001116 3300025914 Bacteria 32351
284 Ga0207671_10001368 3300025914 Bacteria 28441
285 Ga0207671_10001764 3300025914 Bacteria 24323
286 Ga0207660_10014779 3300025917 Bacteria 5144
287 Ga0207660_10028368 3300025917 Bacteria 3827
288 Ga0207660_10031535 3300025917 Bacteria 3652
289 Ga0207662_10011750 3300025918 Unclassified 4866
290 Ga0207657_10001629 3300025919 Bacteria 24192
291 Ga0207657_10003056 3300025919 Bacteria 17905
292 Ga0207657_10020816 3300025919 Bacteria 6189
293 Ga0207657_10035108 3300025919 Bacteria 4500
294 Ga0207649_10035758 3300025920 Unclassified 2987
295 Ga0207652_10000160 3300025921 Bacteria 72867
296 Ga0207652_10000214 3300025921 Bacteria 61294
297 Ga0207652_10002096 3300025921 Bacteria 17145
298 Ga0207652_10003075 3300025921 Bacteria 13931
299 Ga0207652_10057758 3300025921 Bacteria 3342
300 Ga0207650_10007911 3300025925 Bacteria 7246
301 Ga0207650_10042620 3300025925 Bacteria 3329
302 Ga0207644_10035359 3300025931 Bacteria 3500
303 Ga0207706_10004276 3300025933 Bacteria 13433
304 Ga0207706_10008350 3300025933 Bacteria 9551
305 Ga0207706_10041716 3300025933 Bacteria 4067
306 Ga0207706_10054248 3300025933 Unclassified 3538
307 Ga0207686_10042396 3300025934 Bacteria 2782
308 Ga0207709_10000005 3300025935 Bacteria 806813
309 Ga0207669_10050949 3300025937 Bacteria 2478
310 Ga0207704_10007928 3300025938 Bacteria 5048
311 Ga0207691_10000753 3300025940 Bacteria 32051
312 Ga0207711_10001108 3300025941 Bacteria 25741
313 Ga0207689_10000401 3300025942 Bacteria 40564
314 Ga0207689_10002824 3300025942 Bacteria 16038
315 Ga0207689_10010739 3300025942 Bacteria 7880
316 Ga0207689_10014747 3300025942 Bacteria 6636
317 Ga0207689_10029364 3300025942 Bacteria 4593
318 Ga0207689_10031924 3300025942 Bacteria 4380
319 Ga0207689_10081048 3300025942 Bacteria 2668
320 Ga0207689_10102360 3300025942 Bacteria 2353
321 Ga0207661_10034220 3300025944 Bacteria 3949
322 Ga0207679_10001140 3300025945 Bacteria 16945
323 Ga0207679_10003711 3300025945 Bacteria 9468
324 Ga0207679_10039880 3300025945 Bacteria 3357
325 Ga0207679_10078182 3300025945 Unclassified 2520
326 Ga0207667_10001843 3300025949 Bacteria 26625
327 Ga0207667_10005177 3300025949 Bacteria 15928
328 Ga0207667_10032326 3300025949 Bacteria 5640
329 Ga0207667_10110696 3300025949 Bacteria 2833
330 Ga0207651_10010358 3300025960 Bacteria 5163
331 Ga0207712_10004285 3300025961 Bacteria 9002
332 Ga0207712_10005728 3300025961 Bacteria 7833
333 Ga0207712_10005829 3300025961 Bacteria 7765
334 Ga0207668_10010005 3300025972 Bacteria 5708
335 Ga0207658_10025520 3300025986 Bacteria 4138
336 Ga0207677_10005033 3300026023 Bacteria 7142
337 Ga0207677_10059887 3300026023 Unclassified 2628
338 Ga0207703_10001077 3300026035 Bacteria 25994
339 Ga0207703_10027672 3300026035 Bacteria 4464
340 Ga0207639_10002155 3300026041 Bacteria 13254
341 Ga0207639_10007062 3300026041 Bacteria 7658
342 Ga0207639_10037901 3300026041 Bacteria 3584
343 Ga0207639_10104618 3300026041 Bacteria 2295
344 Ga0207678_10018279 3300026067 Bacteria 6156
345 Ga0207678_10088577 3300026067 Bacteria 2645
346 Ga0207702_10090692 3300026078 Bacteria 2675
347 Ga0207702_10137367 3300026078 Bacteria 2207
348 Ga0207641_10000026 3300026088 Bacteria 245091
349 Ga0207641_10001198 3300026088 Bacteria 25980
350 Ga0207641_10032862 3300026088 Bacteria 4309
351 Ga0207641_10034891 3300026088 Bacteria 4187
352 Ga0207641_10041538 3300026088 Bacteria 3854
353 Ga0207648_10000768 3300026089 Bacteria 36105
354 Ga0207648_10002323 3300026089 Bacteria 20528
355 Ga0207648_10003536 3300026089 Bacteria 16339
356 Ga0207676_10025840 3300026095 Bacteria 4360
357 Ga0207674_10011558 3300026116 Bacteria 9916
358 Ga0207674_10012908 3300026116 Bacteria 9318
359 Ga0207674_10025362 3300026116 Bacteria 6324
360 Ga0207674_10052457 3300026116 Bacteria 4159
361 Ga0207675_100005621 3300026118 Bacteria 12002
362 Ga0207675_100005986 3300026118 Bacteria 11578
363 Ga0207675_100084586 3300026118 Unclassified 2977
364 Ga0207683_10005025 3300026121 Bacteria 11361
365 Ga0207698_10000497 3300026142 Bacteria 22930
366 Ga0207698_10007369 3300026142 Bacteria 6894
367 Ga0268266_10000169 3300028379 Bacteria 119437
368 Ga0268266_10015886 3300028379 Bacteria 6443
369 Ga0268265_10027453 3300028380 Bacteria 4064
370 Ga0268264_10000063 3300028381 Bacteria 301702
371 Ga0268264_10002827 3300028381 Bacteria 15156
372 Ga0268264_10005593 3300028381 Bacteria 10649
373 Ga0268264_10007051 3300028381 Bacteria 9425
374 Ga0268264_10008509 3300028381 Bacteria 8529
375 Ga0268264_10008670 3300028381 Bacteria 8449
376 Ga0307517_10000487 3300028786 Bacteria 68165
377 Ga0307515_10000001 3300028794 Bacteria 4259510
378 Ga0307515_10000031 3300028794 Bacteria 358648
379 Ga0307511_10021092 3300030521 Bacteria 6152
380 Ga0265327_10000024 3300031251 Bacteria 382499
381 Ga0265327_10000254 3300031251 Bacteria 106076
382 Ga0307513_10053287 3300031456 Bacteria 4350
383 Ga0307509_10091964 3300031507 Bacteria 3103
384 Ga0307508_10001223 3300031616 Bacteria 29382
385 Ga0307516_10000384 3300031730 Bacteria 57633
386 Ga0307414_10066408 3300032004 Bacteria 2579
387 Ga0307510_10000336 3300033180 Bacteria 43815
388 Ga0307510_10009957 3300033180 Bacteria 11298
389 Ga0373955_0026177 3300035172 Bacteria 3002
390 Ga0395899_0016942 3300037312 Bacteria 5554
391 Ga0395899_0018390 3300037312 Bacteria 5313
392 Ga0395900_0003963 3300037418 Bacteria 15800
393 Ga0395900_0062151 3300037418 Bacteria 3838
394 Ga0395900_0120534 3300037418 Bacteria 2692
395 Ga0395898_0001675 3300037466 Bacteria 29715
396 Ga0395898_0033339 3300037466 Bacteria 5140
397 Ga0395898_0034817 3300037466 Bacteria 5013
398 Ga0395898_0042813 3300037466 Bacteria 4465
399 Ga0395905_0000003 3300037471 Bacteria 1347396
400 Ga0395905_0108019 3300037471 Bacteria 2612
401 Ga0395901_0010576 3300038443 Bacteria 9349
402 Ga0436365_0444625 3300039437 Bacteria 12196
403 Ga0436365_1462221 3300039437 Bacteria 3446
404 Ga0436365_1933142 3300039437 Bacteria 64226
405 Ga0439436_0001458 3300041404 Bacteria 6861
406 Ga0439465_0007900 3300041413 Bacteria 3371
407 Ga0439457_000780 3300042014 Bacteria 9482
408 Ga0451577_0069327 3300042876 Bacteria 3145
409 Ga0466969_0000106 3300044656 Bacteria 44435
410 Ga0466972_0000001 3300044658 Bacteria 412457
411 Ga0466972_0000009 3300044658 Bacteria 256374
412 Ga0466972_0016306 3300044658 Bacteria 3713
413 Ga0466961_0012004 3300044693 Bacteria 5537
414 Ga0466964_0016720 3300044706 Bacteria 2803
415 Ga0453684_0026119 3300044712 Bacteria 8451
416 Ga0453684_0037403 3300044712 Bacteria 6662
417 Ga0453684_0087737 3300044712 Bacteria 3854
418 Ga0466971_0007525 3300044719 Bacteria 4745
419 Ga0466971_0023567 3300044719 Bacteria 2744
420 Ga0466968_0009117 3300044735 Bacteria 3814
421 Ga0466970_0000065 3300044765 Bacteria 41709
422 Ga0466957_0000378 3300044842 Bacteria 21778
423 Ga0466957_0034619 3300044842 Bacteria 3029
424 Ga0466959_0000003 3300045049 Bacteria 285164
425 Ga0466959_0000676 3300045049 Bacteria 19916
426 Ga0466958_0002924 3300045836 Bacteria 8729
427 Ga0466958_0011802 3300045836 Bacteria 4932
428 Ga0466967_0021125 3300045976 Bacteria 5277
429 Ga0466967_0117817 3300045976 Bacteria 2449
430 Ga0495668_0001094 3300046616 Bacteria 28120
431 Ga0495668_0007455 3300046616 Bacteria 6989
432 Ga0495611_0002532 3300046648 Bacteria 8310
433 Ga0495625_0027314 3300046660 Bacteria 4299
434 Ga0495672_0019283 3300047320 Bacteria 4504
435 Ga0495672_0022448 3300047320 Bacteria 4101
436 Ga0495687_005030 3300047443 Bacteria 8626
437 Ga0495686_0000010 3300047472 Bacteria 573229
438 Ga0495686_0016060 3300047472 Bacteria 5088
439 Ga0496104_0000315 3300048907 Bacteria 43085
440 Ga0496104_0171728 3300048907 Bacteria 2079
441 Ga0496108_0001635 3300048911 Bacteria 17753
442 Ga0496109_0000440 3300048912 Bacteria 35903
443 Ga0496110_0000032 3300048913 Bacteria 65830
444 Ga0496113_0016181 3300048916 Bacteria 5148
445 Ga0496114_0001438 3300048917 Bacteria 18050
446 Ga0496114_0008597 3300048917 Bacteria 8093
447 Ga0496115_0032496 3300048918 Bacteria 4116
448 Ga0496126_0116877 3300048929 Bacteria 2318
449 Ga0501298_000359 3300049521 Bacteria 6121
450 Ga0501031_0035867 3300049568 Bacteria 3235
451 Ga0501032_0039724 3300049569 Bacteria 3200
452 Ga0501033_0041082 3300049570 Bacteria 3452
453 Ga0501034_0000004 3300049571 Bacteria 382255
454 Ga0501034_0003809 3300049571 Bacteria 17002
455 Ga0501034_0016252 3300049571 Bacteria 7638
456 Ga0501036_0014675 3300049572 Bacteria 6529
457 Ga0501037_0006142 3300049573 Bacteria 8773
458 Ga0501037_0007206 3300049573 Bacteria 8126
459 Ga0501038_0006185 3300049574 Bacteria 11070
460 Ga0501039_0033890 3300049575 Bacteria 3940
461 Ga0501047_0009217 3300049581 Bacteria 9317
462 Ga0501047_0084366 3300049581 Bacteria 3053
463 Ga0501047_0120847 3300049581 Bacteria 2502
464 Ga0501073_0012400 3300049589 Bacteria 6220
465 Ga0501202_001243 3300049652 Bacteria 4026
466 Ga0501207_001076 3300049654 Bacteria 3335
467 Ga0501222_001758 3300049662 Bacteria 3006
468 Ga0501223_002521 3300049663 Bacteria 4055
469 Ga0501235_001820 3300049669 Bacteria 4575
470 Ga0501243_002673 3300049675 Bacteria 2626
471 Ga0501257_007008 3300049686 Bacteria 2511
472 Ga0501259_003744 3300049688 Bacteria 2415
473 Ga0501219_000179 3300049703 Bacteria 11698
474 Ga0501221_001149 3300049704 Bacteria 4365
475 Ga0501225_0000299 3300049705 Bacteria 15453
476 Ga0501225_0000690 3300049705 Bacteria 10562
477 Ga0501234_001304 3300049707 Bacteria 3901
478 Ga0501266_000496 3300049763 Bacteria 5200
479 Ga0501268_000823 3300049765 Bacteria 3590
480 Ga0501044_0005753 3300049823 Bacteria 13720
481 Ga0501044_0034627 3300049823 Bacteria 5295
482 Ga0501044_0035030 3300049823 Bacteria 5259
483 Ga0501044_0104848 3300049823 Bacteria 2840
484 Ga0501284_00001 3300050005 Bacteria 261916
485 nmdc:mga0k408_11492_c1 3300050493 Bacteria 4824
486 nmdc:mga05p37_89273_c1 3300050507 Unclassified 3798
487 nmdc:mga09592_4183_c1 3300050508 Bacteria 11657
488 nmdc:mga0qj67_8803_c1 3300050509 Bacteria 7489
489 nmdc:mga06r32_54822_c1 3300050510 Bacteria 3823
490 Ga0500578_0001100 3300053086 Bacteria 29178
491 Ga0500583_0000975 3300053092 Bacteria 8154
492 Ga0500583_0004563 3300053092 Bacteria 4533
493 Ga0500562_000024 3300053108 Bacteria 105996
494 Ga0500592_000010 3300053116 Bacteria 76714
495 Ga0500594_0009320 3300053118 Bacteria 2259
496 Ga0500652_025586 3300053131 Bacteria 2263
497 Ga0500616_0004541 3300053153 Bacteria 9835
498 Ga0500622_0000604 3300053156 Bacteria 32597
499 Ga0500622_0000630 3300053156 Bacteria 31753
500 Ga0500627_0000036 3300053158 Bacteria 79400
501 Ga0500637_0006666 3300053178 Bacteria 5711
502 Ga0500611_000001 3300053727 Bacteria 385744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0041082 Ga0501033_0041082_63_1937 605
2 3300013105 Ga0157369_10199720 Ga0157369_101997202 606
3 3300044706 Ga0466964_0016720 Ga0466964_0016720_17_1861 606
4 3300013307 Ga0157372_10014315 Ga0157372_100143158 614
5 3300045976 Ga0466967_0117817 Ga0466967_0117817_11_1888 614
6 3300048907 Ga0496104_0171728 Ga0496104_0171728_27_1964 629
7 3300013307 Ga0157372_10016799 Ga0157372_100167993 641
8 3300025909 Ga0207705_10019662 Ga0207705_100196622 641
9 3300013306 Ga0163162_10101015 Ga0163162_101010152 642
10 3300014969 Ga0157376_10101616 Ga0157376_101016162 643
11 3300044719 Ga0466971_0023567 Ga0466971_0023567_14_1978 643
12 3300047472 Ga0495686_0000010 Ga0495686_0000010_524601_526667 644
13 3300049703 Ga0501219_000179 Ga0501219_000179_470_2518 644
14 3300050005 Ga0501284_00001 Ga0501284_00001_34442_36490 644
15 3300005617 Ga0068859_100097766 Ga0068859_1000977661 645
16 3300006931 Ga0097620_100097767 Ga0097620_1000977671 645
17 3300033180 Ga0307510_10000336 Ga0307510_1000033619 655
18 3300025949 Ga0207667_10110696 Ga0207667_101106962 658
19 3300006237 Ga0097621_100027293 Ga0097621_1000272933 659
20 3300006358 Ga0068871_100020520 Ga0068871_1000205203 659
21 3300025934 Ga0207686_10042396 Ga0207686_100423962 659
22 3300037418 Ga0395900_0120534 Ga0395900_0120534_576_2636 659
23 3300005330 Ga0070690_100027439 Ga0070690_1000274393 660
24 3300005335 Ga0070666_10064692 Ga0070666_100646922 660
25 3300005456 Ga0070678_100085360 Ga0070678_1000853602 660
26 3300005983 Ga0081540_1004235 Ga0081540_10042357 662
27 3300048916 Ga0496113_0016181 Ga0496113_0016181_1454_3559 663
28 3300013102 Ga0157371_10056978 Ga0157371_100569782 664
29 3300013105 Ga0157369_10048639 Ga0157369_100486393 664
30 3300026041 Ga0207639_10104618 Ga0207639_101046181 664
31 3300026078 Ga0207702_10090692 Ga0207702_100906921 664
32 3300005539 Ga0068853_100004047 Ga0068853_10000404711 665
33 3300005617 Ga0068859_100000289 Ga0068859_1000002897 665
34 3300006931 Ga0097620_100000289 Ga0097620_10000028944 665
35 3300028794 Ga0307515_10000001 Ga0307515_100000012866 665
36 3300025921 Ga0207652_10057758 Ga0207652_100577582 666
37 3300003320 rootH2_10006463 rootH2_1000646333 667
38 iso_pu_bacteria 2738541278 2738725092 668
39 iso_pu_bacteria 2929154850 2929159260 668
40 3300013297 Ga0157378_10033322 Ga0157378_100333222 669
41 iso_pu_bacteria 2643221546 2643753321 669
42 3300005337 Ga0070682_100000012 Ga0070682_100000012180 670
43 3300005339 Ga0070660_100028417 Ga0070660_1000284172 670
44 3300005366 Ga0070659_100006546 Ga0070659_1000065467 670
45 3300005458 Ga0070681_10040021 Ga0070681_100400213 670
46 3300005841 Ga0068863_100005498 Ga0068863_1000054987 670
47 3300009093 Ga0105240_10035628 Ga0105240_100356286 670
48 3300013100 Ga0157373_10008395 Ga0157373_100083954 670
49 3300013102 Ga0157371_10002926 Ga0157371_1000292612 670
50 3300013102 Ga0157371_10003669 Ga0157371_1000366913 670
51 3300013102 Ga0157371_10013546 Ga0157371_100135462 670
52 3300013307 Ga0157372_10004621 Ga0157372_1000462111 670
53 3300014969 Ga0157376_10087624 Ga0157376_100876242 670
54 3300025919 Ga0207657_10020816 Ga0207657_100208165 670
55 3300025942 Ga0207689_10102360 Ga0207689_101023602 670
56 3300026088 Ga0207641_10001198 Ga0207641_1000119811 670
57 3300031507 Ga0307509_10091964 Ga0307509_100919642 670
58 3300037418 Ga0395900_0003963 Ga0395900_0003963_1973_4054 670
59 3300037418 Ga0395900_0062151 Ga0395900_0062151_1393_3462 670
60 3300037466 Ga0395898_0042813 Ga0395898_0042813_525_2594 670
61 3300037471 Ga0395905_0000003 Ga0395905_0000003_1013573_1015618 670
62 3300044719 Ga0466971_0007525 Ga0466971_0007525_2540_4564 670
63 3300044842 Ga0466957_0034619 Ga0466957_0034619_201_2225 670
64 3300045836 Ga0466958_0011802 Ga0466958_0011802_1548_3572 670
65 3300045976 Ga0466967_0021125 Ga0466967_0021125_2320_4344 670
66 3300046660 Ga0495625_0027314 Ga0495625_0027314_811_2856 670
67 3300049571 Ga0501034_0016252 Ga0501034_0016252_4381_6450 670
68 3300053153 Ga0500616_0004541 Ga0500616_0004541_7747_9792 670
69 3300053727 Ga0500611_000001 Ga0500611_000001_313726_315774 670
70 iso_pu_bacteria 2808606401 2809065526 670
71 iso_pu_bacteria 2808606404 2809081547 670
72 iso_pu_bacteria 2808606405 2809085916 670
73 iso_pu_bacteria 2880518877 2880523184 670
74 iso_pu_bacteria 2881955468 2881957400 670
75 3300005290 Ga0065712_10070884 Ga0065712_100708844 671
76 3300005295 Ga0065707_10086561 Ga0065707_100865616 671
77 3300005327 Ga0070658_10009105 Ga0070658_100091052 671
78 3300005327 Ga0070658_10062039 Ga0070658_100620391 671
79 3300005334 Ga0068869_100094155 Ga0068869_1000941551 671
80 3300005335 Ga0070666_10001692 Ga0070666_100016922 671
81 3300005336 Ga0070680_100003835 Ga0070680_10000383510 671
82 3300005339 Ga0070660_100000295 Ga0070660_10000029528 671
83 3300005340 Ga0070689_100014387 Ga0070689_1000143875 671
84 3300005340 Ga0070689_100046147 Ga0070689_1000461473 671
85 3300005340 Ga0070689_100048207 Ga0070689_1000482073 671
86 3300005354 Ga0070675_100017907 Ga0070675_1000179076 671
87 3300005365 Ga0070688_100004858 Ga0070688_1000048587 671
88 3300005459 Ga0068867_100006143 Ga0068867_1000061439 671
89 3300005471 Ga0070698_100002783 Ga0070698_10000278311 671
90 3300005471 Ga0070698_100006808 Ga0070698_1000068083 671
91 3300005530 Ga0070679_100000373 Ga0070679_10000037310 671
92 3300005530 Ga0070679_100016461 Ga0070679_1000164613 671
93 3300005543 Ga0070672_100002200 Ga0070672_1000022002 671
94 3300005563 Ga0068855_100000795 Ga0068855_10000079529 671
95 3300005563 Ga0068855_100020840 Ga0068855_1000208404 671
96 3300005564 Ga0070664_100055437 Ga0070664_1000554373 671
97 3300005577 Ga0068857_100031357 Ga0068857_1000313573 671
98 3300005616 Ga0068852_100009517 Ga0068852_1000095172 671
99 3300005617 Ga0068859_100068012 Ga0068859_1000680121 671
100 3300005618 Ga0068864_100039400 Ga0068864_1000394003 671
101 3300005718 Ga0068866_10011485 Ga0068866_100114854 671
102 3300005719 Ga0068861_100002293 Ga0068861_1000022935 671
103 3300005841 Ga0068863_100002737 Ga0068863_1000027372 671
104 3300005843 Ga0068860_100058691 Ga0068860_1000586912 671
105 3300005844 Ga0068862_100015255 Ga0068862_1000152554 671
106 3300006358 Ga0068871_100005215 Ga0068871_1000052158 671
107 3300006846 Ga0075430_100018743 Ga0075430_1000187435 671
108 3300006931 Ga0097620_100068014 Ga0097620_1000680143 671
109 3300009094 Ga0111539_10078829 Ga0111539_100788294 671
110 3300009147 Ga0114129_10083808 Ga0114129_100838083 671
111 3300009147 Ga0114129_10101053 Ga0114129_101010533 671
112 3300009553 Ga0105249_10002316 Ga0105249_100023163 671
113 3300009553 Ga0105249_10010160 Ga0105249_100101603 671
114 3300009553 Ga0105249_10015813 Ga0105249_100158134 671
115 3300013102 Ga0157371_10001264 Ga0157371_100012647 671
116 3300013102 Ga0157371_10001864 Ga0157371_1000186416 671
117 3300013102 Ga0157371_10006555 Ga0157371_100065554 671
118 3300013104 Ga0157370_10002079 Ga0157370_1000207922 671
119 3300013104 Ga0157370_10003185 Ga0157370_100031854 671
120 3300013104 Ga0157370_10005549 Ga0157370_100055499 671
121 3300013105 Ga0157369_10018325 Ga0157369_100183257 671
122 3300013296 Ga0157374_10071846 Ga0157374_100718463 671
123 3300013297 Ga0157378_10010274 Ga0157378_100102745 671
124 3300013306 Ga0163162_10092675 Ga0163162_100926753 671
125 3300014325 Ga0163163_10004992 Ga0163163_100049928 671
126 3300014326 Ga0157380_10005348 Ga0157380_100053484 671
127 3300014326 Ga0157380_10014572 Ga0157380_100145725 671
128 3300014326 Ga0157380_10027078 Ga0157380_100270783 671
129 3300014968 Ga0157379_10070874 Ga0157379_100708742 671
130 3300021384 Ga0213876_10000389 Ga0213876_1000038911 671
131 3300025893 Ga0207682_10008208 Ga0207682_100082084 671
132 3300025903 Ga0207680_10008926 Ga0207680_100089264 671
133 3300025907 Ga0207645_10001186 Ga0207645_100011863 671
134 3300025909 Ga0207705_10001687 Ga0207705_1000168711 671
135 3300025912 Ga0207707_10030612 Ga0207707_100306123 671
136 3300025917 Ga0207660_10014779 Ga0207660_100147795 671
137 3300025917 Ga0207660_10031535 Ga0207660_100315352 671
138 3300025918 Ga0207662_10011750 Ga0207662_100117503 671
139 3300025919 Ga0207657_10001629 Ga0207657_1000162928 671
140 3300025919 Ga0207657_10035108 Ga0207657_100351085 671
141 3300025921 Ga0207652_10000214 Ga0207652_1000021419 671
142 3300025921 Ga0207652_10003075 Ga0207652_100030752 671
143 3300025925 Ga0207650_10007911 Ga0207650_100079115 671
144 3300025933 Ga0207706_10041716 Ga0207706_100417163 671
145 3300025940 Ga0207691_10000753 Ga0207691_1000075322 671
146 3300025942 Ga0207689_10031924 Ga0207689_100319244 671
147 3300025945 Ga0207679_10039880 Ga0207679_100398803 671
148 3300025949 Ga0207667_10005177 Ga0207667_100051777 671
149 3300025961 Ga0207712_10004285 Ga0207712_100042859 671
150 3300025961 Ga0207712_10005728 Ga0207712_100057283 671
151 3300025961 Ga0207712_10005829 Ga0207712_100058296 671
152 3300025986 Ga0207658_10025520 Ga0207658_100255202 671
153 3300026035 Ga0207703_10027672 Ga0207703_100276722 671
154 3300026067 Ga0207678_10088577 Ga0207678_100885771 671
155 3300026088 Ga0207641_10032862 Ga0207641_100328624 671
156 3300026088 Ga0207641_10041538 Ga0207641_100415383 671
157 3300026089 Ga0207648_10000768 Ga0207648_100007687 671
158 3300026095 Ga0207676_10025840 Ga0207676_100258403 671
159 3300026116 Ga0207674_10011558 Ga0207674_100115589 671
160 3300026116 Ga0207674_10052457 Ga0207674_100524574 671
161 3300026118 Ga0207675_100005986 Ga0207675_1000059863 671
162 3300026142 Ga0207698_10007369 Ga0207698_100073696 671
163 3300031251 Ga0265327_10000024 Ga0265327_1000002471 671
164 3300031616 Ga0307508_10001223 Ga0307508_100012234 671
165 3300032004 Ga0307414_10066408 Ga0307414_100664082 671
166 3300037312 Ga0395899_0018390 Ga0395899_0018390_2689_4770 671
167 3300037466 Ga0395898_0033339 Ga0395898_0033339_463_2544 671
168 3300037466 Ga0395898_0034817 Ga0395898_0034817_2230_4302 671
169 3300038443 Ga0395901_0010576 Ga0395901_0010576_6893_8974 671
170 3300039437 Ga0436365_1933142 Ga0436365_1933142_35088_37136 671
171 3300041413 Ga0439465_0007900 Ga0439465_0007900_1087_3135 671
172 3300044712 Ga0453684_0026119 Ga0453684_0026119_4875_6923 671
173 3300047320 Ga0495672_0019283 Ga0495672_0019283_730_2778 671
174 3300049521 Ga0501298_000359 Ga0501298_000359_103_2151 671
175 3300049571 Ga0501034_0003809 Ga0501034_0003809_10677_12725 671
176 3300049652 Ga0501202_001243 Ga0501202_001243_88_2136 671
177 3300049654 Ga0501207_001076 Ga0501207_001076_439_2487 671
178 3300049662 Ga0501222_001758 Ga0501222_001758_458_2506 671
179 3300049663 Ga0501223_002521 Ga0501223_002521_137_2185 671
180 3300049669 Ga0501235_001820 Ga0501235_001820_2334_4382 671
181 3300049675 Ga0501243_002673 Ga0501243_002673_496_2544 671
182 3300049688 Ga0501259_003744 Ga0501259_003744_230_2278 671
183 3300049704 Ga0501221_001149 Ga0501221_001149_1745_3793 671
184 3300049705 Ga0501225_0000299 Ga0501225_0000299_7623_9671 671
185 3300049707 Ga0501234_001304 Ga0501234_001304_158_2206 671
186 3300049823 Ga0501044_0035030 Ga0501044_0035030_2138_4189 671
187 3300050493 nmdc:mga0k408_11492_c1 nmdc:mga0k408_11492_c1_507_2555 671
188 3300050509 nmdc:mga0qj67_8803_c1 nmdc:mga0qj67_8803_c1_1307_3400 671
189 3300050510 nmdc:mga06r32_54822_c1 nmdc:mga06r32_54822_c1_637_2730 671
190 iso_pu_bacteria 2643221605 2644040593 671
191 iso_pu_bacteria 2818991444 2819585970 671
192 3300003203 JGI25406J46586_10003399 JGI25406J46586_100033996 672
193 3300003320 rootH2_10012033 rootH2_1001203315 672
194 3300003322 rootL2_10010261 rootL2_100102617 672
195 3300003323 rootH1_10020501 rootH1_1002050119 672
196 3300003354 JGI25160J50197_1000539 JGI25160J50197_10005392 672
197 3300005328 Ga0070676_10015381 Ga0070676_100153812 672
198 3300005329 Ga0070683_100010274 Ga0070683_1000102746 672
199 3300005329 Ga0070683_100027291 Ga0070683_1000272914 672
200 3300005331 Ga0070670_100056284 Ga0070670_1000562841 672
201 3300005334 Ga0068869_100003043 Ga0068869_1000030437 672
202 3300005334 Ga0068869_100019937 Ga0068869_1000199374 672
203 3300005334 Ga0068869_100046514 Ga0068869_1000465142 672
204 3300005334 Ga0068869_100074640 Ga0068869_1000746401 672
205 3300005335 Ga0070666_10000180 Ga0070666_1000018028 672
206 3300005335 Ga0070666_10036589 Ga0070666_100365892 672
207 3300005336 Ga0070680_100000160 Ga0070680_10000016033 672
208 3300005337 Ga0070682_100000504 Ga0070682_1000005046 672
209 3300005338 Ga0068868_100004644 Ga0068868_1000046444 672
210 3300005338 Ga0068868_100058084 Ga0068868_1000580841 672
211 3300005340 Ga0070689_100017112 Ga0070689_1000171122 672
212 3300005341 Ga0070691_10002266 Ga0070691_100022667 672
213 3300005344 Ga0070661_100004288 Ga0070661_1000042886 672
214 3300005353 Ga0070669_100029342 Ga0070669_1000293422 672
215 3300005354 Ga0070675_100025666 Ga0070675_1000256663 672
216 3300005354 Ga0070675_100095767 Ga0070675_1000957672 672
217 3300005355 Ga0070671_100003764 Ga0070671_1000037644 672
218 3300005355 Ga0070671_100028086 Ga0070671_1000280863 672
219 3300005356 Ga0070674_100005144 Ga0070674_1000051448 672
220 3300005366 Ga0070659_100006147 Ga0070659_1000061474 672
221 3300005367 Ga0070667_100007424 Ga0070667_1000074244 672
222 3300005367 Ga0070667_100020042 Ga0070667_1000200423 672
223 3300005367 Ga0070667_100041155 Ga0070667_1000411551 672
224 3300005456 Ga0070678_100030700 Ga0070678_1000307003 672
225 3300005457 Ga0070662_100000209 Ga0070662_10000020914 672
226 3300005457 Ga0070662_100005589 Ga0070662_1000055894 672
227 3300005530 Ga0070679_100000789 Ga0070679_1000007894 672
228 3300005535 Ga0070684_100001647 Ga0070684_1000016477 672
229 3300005535 Ga0070684_100013550 Ga0070684_1000135508 672
230 3300005539 Ga0068853_100002923 Ga0068853_10000292310 672
231 3300005539 Ga0068853_100031752 Ga0068853_1000317524 672
232 3300005547 Ga0070693_100013776 Ga0070693_1000137762 672
233 3300005548 Ga0070665_100000002 Ga0070665_100000002695 672
234 3300005548 Ga0070665_100023765 Ga0070665_1000237652 672
235 3300005563 Ga0068855_100002019 Ga0068855_10000201921 672
236 3300005564 Ga0070664_100006035 Ga0070664_1000060357 672
237 3300005564 Ga0070664_100032071 Ga0070664_1000320715 672
238 3300005577 Ga0068857_100014246 Ga0068857_1000142466 672
239 3300005616 Ga0068852_100002613 Ga0068852_10000261310 672
240 3300005616 Ga0068852_100065186 Ga0068852_1000651863 672
241 3300005616 Ga0068852_100114834 Ga0068852_1001148342 672
242 3300005617 Ga0068859_100000003 Ga0068859_100000003173 672
243 3300005617 Ga0068859_100003424 Ga0068859_1000034246 672
244 3300005617 Ga0068859_100022800 Ga0068859_1000228004 672
245 3300005617 Ga0068859_100041644 Ga0068859_1000416444 672
246 3300005719 Ga0068861_100029501 Ga0068861_1000295013 672
247 3300005840 Ga0068870_10004265 Ga0068870_100042654 672
248 3300005841 Ga0068863_100005788 Ga0068863_1000057889 672
249 3300005841 Ga0068863_100017654 Ga0068863_1000176545 672
250 3300005841 Ga0068863_100043781 Ga0068863_1000437814 672
251 3300005841 Ga0068863_100046158 Ga0068863_1000461584 672
252 3300005843 Ga0068860_100000891 Ga0068860_10000089118 672
253 3300005843 Ga0068860_100003354 Ga0068860_1000033544 672
254 3300005843 Ga0068860_100003552 Ga0068860_10000355214 672
255 3300005985 Ga0081539_10000389 Ga0081539_1000038953 672
256 3300006237 Ga0097621_100003854 Ga0097621_1000038547 672
257 3300006358 Ga0068871_100004728 Ga0068871_1000047287 672
258 3300006358 Ga0068871_100006345 Ga0068871_1000063456 672
259 3300006844 Ga0075428_100056157 Ga0075428_1000561573 672
260 3300006847 Ga0075431_100003549 Ga0075431_10000354911 672
261 3300006880 Ga0075429_100007833 Ga0075429_1000078335 672
262 3300006931 Ga0097620_100000003 Ga0097620_100000003173 672
263 3300006931 Ga0097620_100003424 Ga0097620_1000034246 672
264 3300006931 Ga0097620_100022799 Ga0097620_1000227994 672
265 3300006931 Ga0097620_100041643 Ga0097620_1000416432 672
266 3300009093 Ga0105240_10003417 Ga0105240_1000341713 672
267 3300009093 Ga0105240_10005202 Ga0105240_1000520210 672
268 3300009093 Ga0105240_10007539 Ga0105240_100075397 672
269 3300009093 Ga0105240_10121311 Ga0105240_101213113 672
270 3300009101 Ga0105247_10002199 Ga0105247_100021999 672
271 3300009147 Ga0114129_10001630 Ga0114129_1000163026 672
272 3300009174 Ga0105241_10000439 Ga0105241_1000043913 672
273 3300009176 Ga0105242_10006916 Ga0105242_100069166 672
274 3300009176 Ga0105242_10007104 Ga0105242_100071045 672
275 3300009545 Ga0105237_10000144 Ga0105237_1000014477 672
276 3300009545 Ga0105237_10001848 Ga0105237_100018488 672
277 3300009551 Ga0105238_10010105 Ga0105238_100101059 672
278 3300009553 Ga0105249_10003201 Ga0105249_1000320112 672
279 3300010375 Ga0105239_10001785 Ga0105239_1000178513 672
280 3300010375 Ga0105239_10003647 Ga0105239_1000364712 672
281 3300010375 Ga0105239_10075623 Ga0105239_100756233 672
282 3300011119 Ga0105246_10009077 Ga0105246_100090775 672
283 3300013102 Ga0157371_10007523 Ga0157371_100075235 672
284 3300013104 Ga0157370_10006166 Ga0157370_100061667 672
285 3300013105 Ga0157369_10018091 Ga0157369_100180913 672
286 3300013296 Ga0157374_10000013 Ga0157374_10000013376 672
287 3300013296 Ga0157374_10005457 Ga0157374_100054573 672
288 3300013296 Ga0157374_10034346 Ga0157374_100343462 672
289 3300013296 Ga0157374_10136100 Ga0157374_101361001 672
290 3300013297 Ga0157378_10047843 Ga0157378_100478433 672
291 3300013306 Ga0163162_10001183 Ga0163162_1000118310 672
292 3300013306 Ga0163162_10001237 Ga0163162_100012376 672
293 3300013306 Ga0163162_10002547 Ga0163162_100025478 672
294 3300013306 Ga0163162_10005701 Ga0163162_100057019 672
295 3300013306 Ga0163162_10011444 Ga0163162_100114441 672
296 3300013306 Ga0163162_10048128 Ga0163162_100481282 672
297 3300013306 Ga0163162_10147076 Ga0163162_101470761 672
298 3300013307 Ga0157372_10000965 Ga0157372_100009654 672
299 3300013307 Ga0157372_10046038 Ga0157372_100460381 672
300 3300013307 Ga0157372_10189411 Ga0157372_101894112 672
301 3300013308 Ga0157375_10003489 Ga0157375_100034893 672
302 3300013308 Ga0157375_10010375 Ga0157375_100103759 672
303 3300014325 Ga0163163_10001087 Ga0163163_1000108711 672
304 3300014325 Ga0163163_10004997 Ga0163163_1000499712 672
305 3300014968 Ga0157379_10008567 Ga0157379_100085677 672
306 3300014969 Ga0157376_10013411 Ga0157376_100134113 672
307 3300014969 Ga0157376_10050309 Ga0157376_100503092 672
308 3300014969 Ga0157376_10070668 Ga0157376_100706683 672
309 3300021384 Ga0213876_10002517 Ga0213876_100025173 672
310 3300025302 Ga0207426_1000026 Ga0207426_100002692 672
311 3300025903 Ga0207680_10000073 Ga0207680_100000738 672
312 3300025904 Ga0207647_10065624 Ga0207647_100656242 672
313 3300025907 Ga0207645_10004130 Ga0207645_100041303 672
314 3300025907 Ga0207645_10005478 Ga0207645_100054785 672
315 3300025908 Ga0207643_10014805 Ga0207643_100148054 672
316 3300025911 Ga0207654_10002439 Ga0207654_100024399 672
317 3300025911 Ga0207654_10004172 Ga0207654_100041727 672
318 3300025912 Ga0207707_10004345 Ga0207707_100043457 672
319 3300025913 Ga0207695_10000064 Ga0207695_1000006430 672
320 3300025913 Ga0207695_10000209 Ga0207695_10000209114 672
321 3300025913 Ga0207695_10002106 Ga0207695_1000210613 672
322 3300025913 Ga0207695_10010801 Ga0207695_100108019 672
323 3300025914 Ga0207671_10001368 Ga0207671_1000136819 672
324 3300025917 Ga0207660_10028368 Ga0207660_100283682 672
325 3300025919 Ga0207657_10003056 Ga0207657_100030567 672
326 3300025920 Ga0207649_10035758 Ga0207649_100357581 672
327 3300025921 Ga0207652_10002096 Ga0207652_1000209612 672
328 3300025925 Ga0207650_10042620 Ga0207650_100426202 672
329 3300025933 Ga0207706_10004276 Ga0207706_100042769 672
330 3300025933 Ga0207706_10008350 Ga0207706_100083507 672
331 3300025933 Ga0207706_10054248 Ga0207706_100542482 672
332 3300025937 Ga0207669_10050949 Ga0207669_100509492 672
333 3300025942 Ga0207689_10000401 Ga0207689_1000040110 672
334 3300025942 Ga0207689_10002824 Ga0207689_1000282414 672
335 3300025942 Ga0207689_10010739 Ga0207689_100107395 672
336 3300025942 Ga0207689_10014747 Ga0207689_100147472 672
337 3300025942 Ga0207689_10029364 Ga0207689_100293644 672
338 3300025942 Ga0207689_10081048 Ga0207689_100810482 672
339 3300025944 Ga0207661_10034220 Ga0207661_100342203 672
340 3300025945 Ga0207679_10001140 Ga0207679_1000114010 672
341 3300025945 Ga0207679_10003711 Ga0207679_100037115 672
342 3300025949 Ga0207667_10032326 Ga0207667_100323264 672
343 3300025972 Ga0207668_10010005 Ga0207668_100100054 672
344 3300026023 Ga0207677_10005033 Ga0207677_100050333 672
345 3300026023 Ga0207677_10059887 Ga0207677_100598872 672
346 3300026041 Ga0207639_10002155 Ga0207639_100021557 672
347 3300026041 Ga0207639_10007062 Ga0207639_100070623 672
348 3300026041 Ga0207639_10037901 Ga0207639_100379013 672
349 3300026067 Ga0207678_10018279 Ga0207678_100182793 672
350 3300026088 Ga0207641_10000026 Ga0207641_10000026157 672
351 3300026088 Ga0207641_10034891 Ga0207641_100348912 672
352 3300026089 Ga0207648_10002323 Ga0207648_100023232 672
353 3300026089 Ga0207648_10003536 Ga0207648_1000353612 672
354 3300026116 Ga0207674_10012908 Ga0207674_100129086 672
355 3300026116 Ga0207674_10025362 Ga0207674_100253625 672
356 3300026118 Ga0207675_100005621 Ga0207675_1000056217 672
357 3300026118 Ga0207675_100084586 Ga0207675_1000845862 672
358 3300026121 Ga0207683_10005025 Ga0207683_100050258 672
359 3300026142 Ga0207698_10000497 Ga0207698_1000049713 672
360 3300028379 Ga0268266_10000169 Ga0268266_1000016956 672
361 3300028380 Ga0268265_10027453 Ga0268265_100274532 672
362 3300028381 Ga0268264_10002827 Ga0268264_1000282712 672
363 3300028381 Ga0268264_10005593 Ga0268264_100055936 672
364 3300028381 Ga0268264_10007051 Ga0268264_100070516 672
365 3300028381 Ga0268264_10008670 Ga0268264_100086706 672
366 3300028786 Ga0307517_10000487 Ga0307517_1000048723 672
367 3300028794 Ga0307515_10000031 Ga0307515_1000003163 672
368 3300030521 Ga0307511_10021092 Ga0307511_100210924 672
369 3300031251 Ga0265327_10000254 Ga0265327_1000025413 672
370 3300031456 Ga0307513_10053287 Ga0307513_100532873 672
371 3300031730 Ga0307516_10000384 Ga0307516_1000038431 672
372 3300035172 Ga0373955_0026177 Ga0373955_0026177_638_2719 672
373 3300037471 Ga0395905_0108019 Ga0395905_0108019_196_2319 672
374 3300039437 Ga0436365_0444625 Ga0436365_0444625_2075_4156 672
375 3300039437 Ga0436365_1462221 Ga0436365_1462221_121_2169 672
376 3300041404 Ga0439436_0001458 Ga0439436_0001458_532_2577 672
377 3300042014 Ga0439457_000780 Ga0439457_000780_3923_5968 672
378 3300042876 Ga0451577_0069327 Ga0451577_0069327_132_2183 672
379 3300044656 Ga0466969_0000106 Ga0466969_0000106_15126_17174 672
380 3300044658 Ga0466972_0000009 Ga0466972_0000009_214098_216143 672
381 3300044693 Ga0466961_0012004 Ga0466961_0012004_3367_5418 672
382 3300044712 Ga0453684_0037403 Ga0453684_0037403_366_2462 672
383 3300044712 Ga0453684_0087737 Ga0453684_0087737_298_2346 672
384 3300044842 Ga0466957_0000378 Ga0466957_0000378_330_2372 672
385 3300045049 Ga0466959_0000003 Ga0466959_0000003_241145_243193 672
386 3300045049 Ga0466959_0000676 Ga0466959_0000676_16439_18490 672
387 3300045836 Ga0466958_0002924 Ga0466958_0002924_1518_3569 672
388 3300046616 Ga0495668_0001094 Ga0495668_0001094_7891_9945 672
389 3300046616 Ga0495668_0007455 Ga0495668_0007455_1263_3305 672
390 3300046648 Ga0495611_0002532 Ga0495611_0002532_2174_4222 672
391 3300047320 Ga0495672_0022448 Ga0495672_0022448_1458_3503 672
392 3300047472 Ga0495686_0016060 Ga0495686_0016060_1315_3381 672
393 3300048917 Ga0496114_0001438 Ga0496114_0001438_15218_17272 672
394 3300049568 Ga0501031_0035867 Ga0501031_0035867_819_2864 672
395 3300049569 Ga0501032_0039724 Ga0501032_0039724_67_2112 672
396 3300049571 Ga0501034_0000004 Ga0501034_0000004_134447_136528 672
397 3300049572 Ga0501036_0014675 Ga0501036_0014675_976_3021 672
398 3300049573 Ga0501037_0006142 Ga0501037_0006142_1885_3927 672
399 3300049573 Ga0501037_0007206 Ga0501037_0007206_2607_4652 672
400 3300049574 Ga0501038_0006185 Ga0501038_0006185_1871_3913 672
401 3300049575 Ga0501039_0033890 Ga0501039_0033890_1112_3157 672
402 3300049581 Ga0501047_0009217 Ga0501047_0009217_6190_8232 672
403 3300049581 Ga0501047_0120847 Ga0501047_0120847_85_2130 672
404 3300049589 Ga0501073_0012400 Ga0501073_0012400_525_2570 672
405 3300049686 Ga0501257_007008 Ga0501257_007008_245_2290 672
406 3300049705 Ga0501225_0000690 Ga0501225_0000690_8233_10278 672
407 3300049763 Ga0501266_000496 Ga0501266_000496_2660_4705 672
408 3300049765 Ga0501268_000823 Ga0501268_000823_1048_3093 672
409 3300049823 Ga0501044_0005753 Ga0501044_0005753_2377_4419 672
410 3300049823 Ga0501044_0034627 Ga0501044_0034627_1545_3590 672
411 3300049823 Ga0501044_0104848 Ga0501044_0104848_226_2271 672
412 3300050507 nmdc:mga05p37_89273_c1 nmdc:mga05p37_89273_c1_1093_3135 672
413 3300050508 nmdc:mga09592_4183_c1 nmdc:mga09592_4183_c1_8844_10928 672
414 3300053086 Ga0500578_0001100 Ga0500578_0001100_144_2189 672
415 3300053092 Ga0500583_0004563 Ga0500583_0004563_2157_4202 672
416 3300053108 Ga0500562_000024 Ga0500562_000024_51096_53144 672
417 3300053118 Ga0500594_0009320 Ga0500594_0009320_141_2189 672
418 3300053131 Ga0500652_025586 Ga0500652_025586_156_2201 672
419 3300053156 Ga0500622_0000604 Ga0500622_0000604_8269_10317 672
420 3300003322 rootL2_10101088 rootL2_101010882 673
421 3300003323 rootH1_10052994 rootH1_100529947 673
422 3300005262 Ga0065165_1001114 Ga0065165_100111413 673
423 3300005335 Ga0070666_10000842 Ga0070666_1000084212 673
424 3300005340 Ga0070689_100043867 Ga0070689_1000438673 673
425 3300005343 Ga0070687_100005317 Ga0070687_1000053173 673
426 3300005367 Ga0070667_100001665 Ga0070667_10000166513 673
427 3300005467 Ga0070706_100048635 Ga0070706_1000486352 673
428 3300005544 Ga0070686_100023472 Ga0070686_1000234723 673
429 3300005548 Ga0070665_100013088 Ga0070665_1000130885 673
430 3300005563 Ga0068855_100004845 Ga0068855_10000484512 673
431 3300005564 Ga0070664_100108050 Ga0070664_1001080502 673
432 3300005577 Ga0068857_100002333 Ga0068857_1000023334 673
433 3300005615 Ga0070702_100027918 Ga0070702_1000279181 673
434 3300005616 Ga0068852_100000391 Ga0068852_10000039117 673
435 3300005841 Ga0068863_100002952 Ga0068863_10000295212 673
436 3300005842 Ga0068858_100002818 Ga0068858_1000028185 673
437 3300005843 Ga0068860_100000003 Ga0068860_100000003310 673
438 3300005843 Ga0068860_100000453 Ga0068860_10000045332 673
439 3300005843 Ga0068860_100003470 Ga0068860_10000347011 673
440 3300006237 Ga0097621_100001274 Ga0097621_10000127415 673
441 3300006358 Ga0068871_100001455 Ga0068871_10000145512 673
442 3300006881 Ga0068865_100058278 Ga0068865_1000582781 673
443 3300009093 Ga0105240_10000664 Ga0105240_1000066424 673
444 3300009093 Ga0105240_10013672 Ga0105240_100136722 673
445 3300009093 Ga0105240_10021183 Ga0105240_100211833 673
446 3300009093 Ga0105240_10029564 Ga0105240_100295646 673
447 3300009098 Ga0105245_10001226 Ga0105245_100012265 673
448 3300009174 Ga0105241_10015312 Ga0105241_100153124 673
449 3300009174 Ga0105241_10026137 Ga0105241_100261373 673
450 3300009176 Ga0105242_10014808 Ga0105242_100148082 673
451 3300009176 Ga0105242_10117752 Ga0105242_101177521 673
452 3300009177 Ga0105248_10000478 Ga0105248_1000047814 673
453 3300009545 Ga0105237_10001444 Ga0105237_1000144411 673
454 3300009545 Ga0105237_10011031 Ga0105237_100110319 673
455 3300009545 Ga0105237_10030374 Ga0105237_100303742 673
456 3300009551 Ga0105238_10017671 Ga0105238_100176714 673
457 3300009551 Ga0105238_10045249 Ga0105238_100452493 673
458 3300010375 Ga0105239_10003970 Ga0105239_1000397017 673
459 3300010375 Ga0105239_10026020 Ga0105239_100260206 673
460 3300013100 Ga0157373_10068516 Ga0157373_100685161 673
461 3300013296 Ga0157374_10001382 Ga0157374_1000138211 673
462 3300013297 Ga0157378_10020385 Ga0157378_100203853 673
463 3300013307 Ga0157372_10000747 Ga0157372_1000074726 673
464 3300013308 Ga0157375_10000656 Ga0157375_1000065617 673
465 3300013308 Ga0157375_10038095 Ga0157375_100380953 673
466 3300014325 Ga0163163_10002750 Ga0163163_100027506 673
467 3300014745 Ga0157377_10037270 Ga0157377_100372702 673
468 3300014969 Ga0157376_10000238 Ga0157376_1000023820 673
469 3300025900 Ga0207710_10000326 Ga0207710_100003269 673
470 3300025904 Ga0207647_10035784 Ga0207647_100357841 673
471 3300025913 Ga0207695_10002258 Ga0207695_100022582 673
472 3300025913 Ga0207695_10002430 Ga0207695_1000243016 673
473 3300025913 Ga0207695_10013165 Ga0207695_100131656 673
474 3300025914 Ga0207671_10001116 Ga0207671_1000111626 673
475 3300025914 Ga0207671_10001764 Ga0207671_100017643 673
476 3300025921 Ga0207652_10000160 Ga0207652_100001609 673
477 3300025931 Ga0207644_10035359 Ga0207644_100353593 673
478 3300025938 Ga0207704_10007928 Ga0207704_100079285 673
479 3300025941 Ga0207711_10001108 Ga0207711_1000110821 673
480 3300025945 Ga0207679_10078182 Ga0207679_100781822 673
481 3300025949 Ga0207667_10001843 Ga0207667_100018434 673
482 3300025960 Ga0207651_10010358 Ga0207651_100103583 673
483 3300026035 Ga0207703_10001077 Ga0207703_100010774 673
484 3300026078 Ga0207702_10137367 Ga0207702_101373671 673
485 3300028379 Ga0268266_10015886 Ga0268266_100158863 673
486 3300028381 Ga0268264_10000063 Ga0268264_10000063227 673
487 3300028381 Ga0268264_10008509 Ga0268264_100085097 673
488 3300037312 Ga0395899_0016942 Ga0395899_0016942_506_2602 673
489 3300037466 Ga0395898_0001675 Ga0395898_0001675_17127_19223 673
490 3300044658 Ga0466972_0000001 Ga0466972_0000001_158913_160976 673
491 3300044658 Ga0466972_0016306 Ga0466972_0016306_258_2306 673
492 3300044735 Ga0466968_0009117 Ga0466968_0009117_956_3004 673
493 3300044765 Ga0466970_0000065 Ga0466970_0000065_7316_9379 673
494 3300047443 Ga0495687_005030 Ga0495687_005030_2785_4920 673
495 3300048907 Ga0496104_0000315 Ga0496104_0000315_17804_19858 673
496 3300048911 Ga0496108_0001635 Ga0496108_0001635_13779_15833 673
497 3300048912 Ga0496109_0000440 Ga0496109_0000440_11517_13571 673
498 3300048913 Ga0496110_0000032 Ga0496110_0000032_13892_15946 673
499 3300048917 Ga0496114_0008597 Ga0496114_0008597_4216_6270 673
500 3300048918 Ga0496115_0032496 Ga0496115_0032496_1573_3624 673
501 3300048929 Ga0496126_0116877 Ga0496126_0116877_207_2258 673
502 3300053092 Ga0500583_0000975 Ga0500583_0000975_2957_5161 673
503 3300053156 Ga0500622_0000630 Ga0500622_0000630_1899_4103 673
504 3300053178 Ga0500637_0006666 Ga0500637_0006666_148_2286 673
505 iso_pu_bacteria 2791355094 2792641796 673
506 3300009148 Ga0105243_10000150 Ga0105243_1000015043 674
507 3300025935 Ga0207709_10000005 Ga0207709_1000000573 674
508 3300049581 Ga0501047_0084366 Ga0501047_0084366_861_2918 674
509 3300053116 Ga0500592_000010 Ga0500592_000010_10321_12345 674
510 3300053158 Ga0500627_0000036 Ga0500627_0000036_49659_51683 674
511 3300001979 JGI24740J21852_10001692 JGI24740J21852_100016925 675
512 3300001989 JGI24739J22299_10009431 JGI24739J22299_100094312 675
513 3300033180 Ga0307510_10009957 Ga0307510_1000995710 675

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

589

705

0.93

PF00171

Aldedh

Aldehyde dehydrogenase family

67

556

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y51-assembly1.cif.gz_A crystal structure of e167a mutant of the box pathway encoded aldh from burkholderia xenovorans lb400 0.9735 1 517
2y5d-assembly1.cif.gz_B crystal structure of c296a mutant of the box pathway encoded aldh from burkholderia xenovorans lb400 0.9734 1 517
2y5d-assembly1.cif.gz_A crystal structure of c296a mutant of the box pathway encoded aldh from burkholderia xenovorans lb400 0.973 1 514
2vro-assembly1.cif.gz_B crystal structure of aldehyde dehydrogenase from burkholderia xenovorans lb400 0.9729 1 517
2y52-assembly1.cif.gz_A crystal structure of e496a mutant of the box pathway encoded aldh from burkholderia xenovorans lb400 0.9729 1 512
ID Description Score Start End Superfamily
af_P77455_1_261_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.988 2 262 3.40.605.10
af_P77455_1_261_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9843 2 262 3.40.605.10
af_P77455_262_467_3.40.309.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9682 264 473 3.40.309.10
2y52B01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9635 1 261 3.40.605.10
2y51B02 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 2;Aldehyde Dehydrogenase; Chain A, domain 2 0.9603 260 473 3.40.309.10
ID Description Score Start End GO Terms
AF-A0A535D537-F1-model_v4 Aldehyde dehydrogenase family protein 0.991 1 362 GO:0016620
AF-A0A485CU62-F1-model_v4 3,4-dehydroadipyl-CoA semialdehyde dehydrogenase (EC 1.2.1.77) 0.9893 2 209 GO:0016491
AF-A0A535D537-F1-model_v4 Aldehyde dehydrogenase family protein 0.9882 1 362 GO:0016620
AF-A0A447RIR2-F1-model_v4 Bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase (EC 1.2.1.77) 0.9879 165 338 GO:0016620
AF-A0A382HC56-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.9855 83 554 GO:0016620

Feature Viewer

pLDDT pTM Quality
91.62 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map