F457400

General Info

Members Datasets Scaffolds Average Seq Length
512 255 1024 152

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100828108|Ga0070708_1008281081
Length 165
Sequence VNYTRSEIVVGFFVLIGIVCLGYLAIKLGKLEVMGSSGYTVYADFSSVAGLKVGDPVEIAGVKIGRVEGLQLVDDRARVELRLQDGVKLQEDVIASVRSRGLIGDKFVLISPGASDKFIAAGGKIRETDSPPDITDLIGKFVGGDLTSKGEKKDESQKTKDETQK

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
89 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
142 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
143 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
158 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
159 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
160 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
166 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
167 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
181 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
182 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
183 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
184 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
185 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
186 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
187 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
188 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
233 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
253 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.95
Rhizosphere 95.31
Stem 0
Stem Tuber 0
Unclassified 23.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100828108 3300005445 Unclassified 870
2 JGI25407J50210_10114581 3300003373 Unclassified 665
3 Ga0065714_10154398 3300005288 Unclassified 1087
4 Ga0065712_10067961 3300005290 Bacteria 18984
5 Ga0065712_10072278 3300005290 Bacteria 4822
6 Ga0065715_10005113 3300005293 Bacteria 3288
7 Ga0065715_10089289 3300005293 Bacteria 11516
8 Ga0065707_10012209 3300005295 Bacteria 2570
9 Ga0070676_10011072 3300005328 Bacteria 4900
10 Ga0070690_100029352 3300005330 Bacteria 3410
11 Ga0070670_100002060 3300005331 Bacteria 16463
12 Ga0070670_100452246 3300005331 Bacteria 1138
13 Ga0070677_10009449 3300005333 Bacteria 3305
14 Ga0068869_100391041 3300005334 Bacteria 1142
15 Ga0068869_100510638 3300005334 Unclassified 1005
16 Ga0070666_10047588 3300005335 Bacteria 2879
17 Ga0070680_100062037 3300005336 Bacteria 3060
18 Ga0070680_100115279 3300005336 Bacteria 2239
19 Ga0070680_101267757 3300005336 Unclassified 638
20 Ga0070682_100052370 3300005337 Bacteria 2554
21 Ga0068868_100077387 3300005338 Bacteria 2661
22 Ga0070660_100035637 3300005339 Bacteria 3767
23 Ga0070660_100242681 3300005339 Unclassified 1468
24 Ga0070689_101006783 3300005340 Unclassified 741
25 Ga0070691_10021725 3300005341 Bacteria 2972
26 Ga0070687_100037141 3300005343 Bacteria 2433
27 Ga0070661_100027345 3300005344 Bacteria 4106
28 Ga0070692_10157059 3300005345 Bacteria 1300
29 Ga0070692_10306525 3300005345 Bacteria 971
30 Ga0070692_10316471 3300005345 Bacteria 958
31 Ga0070669_100027583 3300005353 Bacteria 4087
32 Ga0070671_100013890 3300005355 Bacteria 6496
33 Ga0070671_100417231 3300005355 Bacteria 1149
34 Ga0070674_100075376 3300005356 Bacteria 2396
35 Ga0070674_100236727 3300005356 Bacteria 1427
36 Ga0070674_100503123 3300005356 Bacteria 1009
37 Ga0070673_100043446 3300005364 Bacteria 3473
38 Ga0070659_100046990 3300005366 Bacteria 3384
39 Ga0070659_101380280 3300005366 Unclassified 626
40 Ga0070667_100018086 3300005367 Bacteria 5842
41 Ga0070711_100035845 3300005439 Unclassified 3320
42 Ga0070705_100034426 3300005440 Bacteria 2832
43 Ga0070700_100193115 3300005441 Unclassified 1425
44 Ga0070694_100041969 3300005444 Bacteria 3054
45 Ga0070708_100049637 3300005445 Bacteria 3713
46 Ga0070708_100344109 3300005445 Bacteria 1405
47 Ga0070708_100791000 3300005445 Unclassified 892
48 Ga0070663_100121043 3300005455 Bacteria 1977
49 Ga0070678_100107129 3300005456 Bacteria 2179
50 Ga0070678_101710415 3300005456 Unclassified 592
51 Ga0070681_10022388 3300005458 Bacteria 6345
52 Ga0070681_10038593 3300005458 Bacteria 4788
53 Ga0068867_100048915 3300005459 Bacteria 3112
54 Ga0070706_100001496 3300005467 Bacteria 24528
55 Ga0070706_100011290 3300005467 Bacteria 8298
56 Ga0070706_100208325 3300005467 Bacteria 1825
57 Ga0070706_100826846 3300005467 Unclassified 857
58 Ga0070707_100002307 3300005468 Bacteria 18238
59 Ga0070707_101162544 3300005468 Unclassified 738
60 Ga0070698_100128025 3300005471 Bacteria 2496
61 Ga0070698_100301900 3300005471 Unclassified 1532
62 Ga0070698_100388531 3300005471 Bacteria 1328
63 Ga0070698_100429229 3300005471 Bacteria 1256
64 Ga0070699_100186481 3300005518 Bacteria 1842
65 Ga0070699_100199510 3300005518 Bacteria 1779
66 Ga0070699_100566111 3300005518 Unclassified 1035
67 Ga0070699_100574579 3300005518 Bacteria 1027
68 Ga0070699_101626793 3300005518 Unclassified 592
69 Ga0070679_100004386 3300005530 Bacteria 13043
70 Ga0070679_100221325 3300005530 Bacteria 1854
71 Ga0070684_100383824 3300005535 Unclassified 1294
72 Ga0070697_100003118 3300005536 Bacteria 12741
73 Ga0070697_100011067 3300005536 Bacteria 7050
74 Ga0070697_100137419 3300005536 Bacteria 2053
75 Ga0070697_100171925 3300005536 Bacteria 1834
76 Ga0070697_100183206 3300005536 Bacteria 1775
77 Ga0070697_100638787 3300005536 Bacteria 937
78 Ga0070697_100645931 3300005536 Bacteria 932
79 Ga0068853_100386425 3300005539 Bacteria 1308
80 Ga0070672_100030241 3300005543 Bacteria 4067
81 Ga0070686_100024387 3300005544 Bacteria 3625
82 Ga0070686_100226284 3300005544 Unclassified 1354
83 Ga0070695_100047304 3300005545 Bacteria 2747
84 Ga0070695_100082921 3300005545 Bacteria 2123
85 Ga0070695_100948876 3300005545 Unclassified 697
86 Ga0070696_100055114 3300005546 Bacteria 2772
87 Ga0070696_100073634 3300005546 Unclassified 2407
88 Ga0070696_100411378 3300005546 Bacteria 1060
89 Ga0070693_100028728 3300005547 Bacteria 3026
90 Ga0070693_100151017 3300005547 Bacteria 1471
91 Ga0070693_100859031 3300005547 Unclassified 677
92 Ga0070665_100093985 3300005548 Bacteria 3003
93 Ga0070704_100126408 3300005549 Bacteria 1974
94 Ga0070664_100014707 3300005564 Bacteria 6390
95 Ga0070664_100784235 3300005564 Unclassified 890
96 Ga0068857_100233461 3300005577 Unclassified 1683
97 Ga0068854_100027425 3300005578 Bacteria 3926
98 Ga0068856_100018318 3300005614 Bacteria 6788
99 Ga0070702_100035276 3300005615 Bacteria 2763
100 Ga0070702_100520678 3300005615 Unclassified 877
101 Ga0070702_100830003 3300005615 Unclassified 717
102 Ga0068859_100069285 3300005617 Bacteria 3562
103 Ga0068864_100152550 3300005618 Unclassified 2094
104 Ga0068866_10050253 3300005718 Bacteria 2117
105 Ga0068866_10311351 3300005718 Unclassified 987
106 Ga0068870_10609629 3300005840 Unclassified 743
107 Ga0068860_100079711 3300005843 Bacteria 3114
108 Ga0081455_10000672 3300005937 Bacteria 44265
109 Ga0081455_10031419 3300005937 Bacteria 4806
110 Ga0081455_10074770 3300005937 Bacteria 2797
111 Ga0081538_10005506 3300005981 Bacteria 11374
112 Ga0081538_10007518 3300005981 Bacteria 9417
113 Ga0081538_10036415 3300005981 Bacteria 3211
114 Ga0081538_10112456 3300005981 Bacteria 1333
115 Ga0070716_100563567 3300006173 Bacteria 851
116 Ga0070712_100032922 3300006175 Bacteria 3503
117 Ga0068871_100218083 3300006358 Bacteria 1652
118 Ga0075428_100594987 3300006844 Unclassified 1181
119 Ga0075428_101281372 3300006844 Bacteria 771
120 Ga0075428_101512431 3300006844 Unclassified 703
121 Ga0075430_100049641 3300006846 Bacteria 3541
122 Ga0075430_100054727 3300006846 Unclassified 3357
123 Ga0075430_100061501 3300006846 Unclassified 3155
124 Ga0075430_100820211 3300006846 Bacteria 767
125 Ga0075431_100000620 3300006847 Bacteria 29968
126 Ga0075431_100075441 3300006847 Unclassified 3480
127 Ga0075431_100423915 3300006847 Bacteria 1329
128 Ga0075433_10016122 3300006852 Bacteria 6148
129 Ga0075433_10017613 3300006852 Bacteria 5924
130 Ga0075433_10115125 3300006852 Unclassified 2386
131 Ga0075433_10161457 3300006852 Bacteria 1995
132 Ga0075433_10177859 3300006852 Unclassified 1893
133 Ga0075433_10364909 3300006852 Unclassified 1275
134 Ga0075434_100007676 3300006871 Bacteria 9983
135 Ga0075434_100042930 3300006871 Bacteria 4484
136 Ga0075434_100108284 3300006871 Bacteria 2789
137 Ga0075434_100137972 3300006871 Bacteria 2458
138 Ga0075434_100185526 3300006871 Bacteria 2100
139 Ga0075434_100295593 3300006871 Bacteria 1639
140 Ga0075429_100075404 3300006880 Bacteria 2938
141 Ga0075429_100085986 3300006880 Unclassified 2741
142 Ga0075429_100130163 3300006880 Unclassified 2201
143 Ga0075429_100337132 3300006880 Bacteria 1320
144 Ga0075429_100349425 3300006880 Bacteria 1294
145 Ga0075429_100520791 3300006880 Bacteria 1042
146 Ga0068865_100192120 3300006881 Bacteria 1580
147 Ga0068865_100272151 3300006881 Bacteria 1345
148 Ga0075436_100043609 3300006914 Bacteria 3093
149 Ga0075436_100085506 3300006914 Bacteria 2190
150 Ga0075436_100467066 3300006914 Unclassified 920
151 Ga0097620_100069286 3300006931 Bacteria 3562
152 Ga0075435_100030298 3300007076 Bacteria 4252
153 Ga0075435_100042752 3300007076 Bacteria 3626
154 Ga0075435_100094730 3300007076 Bacteria 2468
155 Ga0075435_100114202 3300007076 Bacteria 2248
156 Ga0075435_100359994 3300007076 Bacteria 1248
157 Ga0075435_101347865 3300007076 Unclassified 625
158 Ga0105240_10123226 3300009093 Bacteria 3119
159 Ga0111539_10067104 3300009094 Unclassified 4237
160 Ga0111539_10104494 3300009094 Bacteria 3323
161 Ga0111539_10220650 3300009094 Bacteria 2208
162 Ga0105245_10546646 3300009098 Unclassified 1180
163 Ga0114129_10026028 3300009147 Bacteria 8284
164 Ga0114129_10028100 3300009147 Bacteria 7969
165 Ga0114129_10047504 3300009147 Bacteria 6031
166 Ga0114129_10147177 3300009147 Bacteria 3226
167 Ga0114129_10667635 3300009147 Unclassified 1340
168 Ga0105243_10173852 3300009148 Bacteria 1868
169 Ga0105241_10009657 3300009174 Bacteria 7090
170 Ga0105242_10131152 3300009176 Bacteria 2164
171 Ga0105248_10160600 3300009177 Bacteria 2535
172 Ga0105237_10634400 3300009545 Unclassified 1075
173 Ga0105249_10093044 3300009553 Bacteria 2823
174 Ga0105249_10236428 3300009553 Bacteria 1804
175 Ga0105249_10768155 3300009553 Bacteria 1026
176 Ga0105239_10020639 3300010375 Bacteria 7269
177 Ga0105246_10025799 3300011119 Unclassified 3832
178 Ga0157346_1004936 3300012480 Unclassified 808
179 Ga0157324_1008416 3300012506 Unclassified 829
180 Ga0157373_10069807 3300013100 Bacteria 2483
181 Ga0157374_10067248 3300013296 Bacteria 3369
182 Ga0157374_11386834 3300013296 Unclassified 725
183 Ga0157378_10007068 3300013297 Bacteria 9801
184 Ga0157378_10017847 3300013297 Bacteria 6229
185 Ga0157378_10191134 3300013297 Bacteria 1931
186 Ga0163162_10014520 3300013306 Bacteria 7695
187 Ga0163162_10024085 3300013306 Bacteria 6008
188 Ga0157372_10200214 3300013307 Bacteria 2313
189 Ga0163163_10341544 3300014325 Bacteria 1553
190 Ga0157376_10024330 3300014969 Unclassified 4752
191 Ga0157376_10287643 3300014969 Bacteria 1551
192 Ga0207697_10175633 3300025315 Unclassified 938
193 Ga0207682_10012618 3300025893 Bacteria 3294
194 Ga0207688_10101519 3300025901 Bacteria 1662
195 Ga0207680_10055311 3300025903 Bacteria 2391
196 Ga0207647_10307441 3300025904 Bacteria 902
197 Ga0207685_10235942 3300025905 Bacteria 877
198 Ga0207645_10000938 3300025907 Bacteria 24220
199 Ga0207684_10000439 3300025910 Bacteria 55252
200 Ga0207684_10000505 3300025910 Bacteria 48898
201 Ga0207707_10009573 3300025912 Bacteria 8406
202 Ga0207707_10045917 3300025912 Bacteria 3804
203 Ga0207693_10150616 3300025915 Bacteria 1829
204 Ga0207663_10761096 3300025916 Unclassified 770
205 Ga0207660_10007810 3300025917 Bacteria 6925
206 Ga0207660_10981714 3300025917 Unclassified 689
207 Ga0207662_10073803 3300025918 Bacteria 2070
208 Ga0207657_10005277 3300025919 Bacteria 13540
209 Ga0207657_10277175 3300025919 Unclassified 1332
210 Ga0207649_10043232 3300025920 Bacteria 2753
211 Ga0207652_10140362 3300025921 Bacteria 2160
212 Ga0207652_10189795 3300025921 Bacteria 1848
213 Ga0207646_10000252 3300025922 Bacteria 72709
214 Ga0207646_10253698 3300025922 Bacteria 1589
215 Ga0207646_10530397 3300025922 Unclassified 1059
216 Ga0207650_10039759 3300025925 Bacteria 3438
217 Ga0207650_10165500 3300025925 Unclassified 1755
218 Ga0207650_10399347 3300025925 Bacteria 1138
219 Ga0207659_10150842 3300025926 Bacteria 1815
220 Ga0207690_10043242 3300025932 Bacteria 2963
221 Ga0207706_10004414 3300025933 Bacteria 13216
222 Ga0207706_10033794 3300025933 Bacteria 4551
223 Ga0207706_10101637 3300025933 Unclassified 2530
224 Ga0207670_10620034 3300025936 Unclassified 890
225 Ga0207704_10138106 3300025938 Bacteria 1700
226 Ga0207704_11077301 3300025938 Unclassified 682
227 Ga0207691_10005407 3300025940 Bacteria 12326
228 Ga0207689_10031098 3300025942 Bacteria 4446
229 Ga0207679_10002958 3300025945 Bacteria 10532
230 Ga0207679_10257977 3300025945 Unclassified 1485
231 Ga0207640_11632374 3300025981 Unclassified 581
232 Ga0207658_10061607 3300025986 Bacteria 2804
233 Ga0207708_10808551 3300026075 Unclassified 807
234 Ga0207702_10052067 3300026078 Bacteria 3462
235 Ga0207648_10056585 3300026089 Bacteria 3422
236 Ga0207676_10434793 3300026095 Unclassified 1234
237 Ga0207674_10140250 3300026116 Unclassified 2377
238 Ga0207674_10341565 3300026116 Bacteria 1448
239 Ga0207683_10000522 3300026121 Bacteria 35582
240 Ga0209973_1056522 3300027252 Unclassified 598
241 Ga0209982_1001496 3300027552 Bacteria 3204
242 Ga0210002_1030137 3300027617 Unclassified 900
243 Ga0209983_1021676 3300027665 Bacteria 1344
244 Ga0209966_1002477 3300027695 Unclassified 3080
245 Ga0209998_10004309 3300027717 Unclassified 3030
246 Ga0209974_10073957 3300027876 Unclassified 1165
247 Ga0209974_10163016 3300027876 Bacteria 810
248 Ga0207428_10426107 3300027907 Bacteria 969
249 Ga0207428_10713253 3300027907 Unclassified 717
250 Ga0268266_11274024 3300028379 Unclassified 710
251 Ga0307408_100013947 3300031548 Bacteria 5337
252 Ga0316575_10002585 3300031665 Bacteria 6095
253 Ga0316575_10025567 3300031665 Bacteria 2290
254 Ga0316575_10035668 3300031665 Bacteria 1955
255 Ga0316579_10009093 3300031691 Bacteria 4169
256 Ga0316579_10181477 3300031691 Unclassified 1017
257 Ga0316579_10187074 3300031691 Bacteria 1001
258 Ga0316576_10007420 3300031727 Bacteria 6905
259 Ga0316576_10018234 3300031727 Bacteria 4788
260 Ga0316576_10040334 3300031727 Bacteria 3356
261 Ga0316576_10371411 3300031727 Bacteria 1063
262 Ga0316576_10562256 3300031727 Unclassified 835
263 Ga0316576_10872934 3300031727 Unclassified 645
264 Ga0316578_10003086 3300031728 Bacteria 7524
265 Ga0316578_10006808 3300031728 Bacteria 5675
266 Ga0316578_10008128 3300031728 Bacteria 5315
267 Ga0316578_10059427 3300031728 Bacteria 2249
268 Ga0316578_10069924 3300031728 Bacteria 2077
269 Ga0307405_10043366 3300031731 Bacteria 2744
270 Ga0307405_10300437 3300031731 Bacteria 1217
271 Ga0316577_10006824 3300031733 Bacteria 6060
272 Ga0316577_10016004 3300031733 Bacteria 4128
273 Ga0316577_10070433 3300031733 Bacteria 1952
274 Ga0316577_10121327 3300031733 Bacteria 1469
275 Ga0316577_10207456 3300031733 Bacteria 1107
276 Ga0316577_10229844 3300031733 Bacteria 1049
277 Ga0307413_10001482 3300031824 Bacteria 8942
278 Ga0307413_10276659 3300031824 Bacteria 1260
279 Ga0307410_10003756 3300031852 Bacteria 7695
280 Ga0307406_10045309 3300031901 Bacteria 2761
281 Ga0307406_10068107 3300031901 Bacteria 2323
282 Ga0307406_10094275 3300031901 Bacteria 2023
283 Ga0307407_10164425 3300031903 Unclassified 1455
284 Ga0307412_10011528 3300031911 Bacteria 5126
285 Ga0307412_10147274 3300031911 Unclassified 1732
286 Ga0307409_100003950 3300031995 Bacteria 8215
287 Ga0307416_100011040 3300032002 Bacteria 6001
288 Ga0307416_100230047 3300032002 Bacteria 1786
289 Ga0307414_10008285 3300032004 Bacteria 5885
290 Ga0307411_10003952 3300032005 Bacteria 7000
291 Ga0307411_10121964 3300032005 Bacteria 1888
292 Ga0307415_100013880 3300032126 Bacteria 4717
293 Ga0307415_100015941 3300032126 Bacteria 4463
294 Ga0316583_10005856 3300032133 Bacteria 4421
295 Ga0316583_10009726 3300032133 Bacteria 3465
296 Ga0316583_10014955 3300032133 Unclassified 2794
297 Ga0316583_10016660 3300032133 Bacteria 2643
298 Ga0316583_10062576 3300032133 Bacteria 1303
299 Ga0316585_10004365 3300032137 Bacteria 3934
300 Ga0316585_10023138 3300032137 Bacteria 1915
301 Ga0316585_10044837 3300032137 Bacteria 1413
302 Ga0316580_10002159 3300032139 Bacteria 5354
303 Ga0316580_10009512 3300032139 Bacteria 2922
304 Ga0316593_10008289 3300032168 Bacteria 2891
305 Ga0316593_10009407 3300032168 Bacteria 2758
306 Ga0316592_1015934 3300033524 Bacteria 1568
307 Ga0316586_1003068 3300033527 Bacteria 2155
308 Ga0316588_1094349 3300033528 Unclassified 747
309 Ga0316596_1098779 3300033541 Bacteria 789
310 Ga0373938_0080620 3300034957 Unclassified 792
311 Ga0373926_0027138 3300035083 Bacteria 2005
312 Ga0373949_0157946 3300035090 Unclassified 660
313 Ga0373939_0149419 3300035114 Bacteria 849
314 Ga0373945_0022867 3300035116 Unclassified 2157
315 Ga0373943_0033995 3300035170 Bacteria 2431
316 Ga0373946_0013506 3300035171 Bacteria 3072
317 Ga0316574_0004424 3300035398 Bacteria 7362
318 Ga0316574_0008918 3300035398 Bacteria 5596
319 Ga0316574_0036674 3300035398 Bacteria 3002
320 Ga0316574_0037496 3300035398 Bacteria 2973
321 Ga0316574_0239690 3300035398 Bacteria 1159
322 Ga0373931_0005086 3300035691 Bacteria 6051
323 Ga0373935_0027751 3300035692 Bacteria 3498
324 Ga0373933_0674209 3300035724 Bacteria 680
325 Ga0373947_0065257 3300035725 Bacteria 2220
326 Ga0316582_0002638 3300036647 Bacteria 8489
327 Ga0316582_0037354 3300036647 Unclassified 3010
328 Ga0316582_0124525 3300036647 Bacteria 1727
329 Ga0316582_0278536 3300036647 Bacteria 1148
330 Ga0316582_0671526 3300036647 Bacteria 712
331 Ga0316582_0938201 3300036647 Unclassified 591
332 Ga0316584_0028234 3300036712 Bacteria 4135
333 Ga0316584_0069065 3300036712 Bacteria 2648
334 Ga0316584_0160644 3300036712 Bacteria 1669
335 Ga0316584_0203112 3300036712 Unclassified 1461
336 Ga0316584_0206986 3300036712 Bacteria 1445
337 Ga0316584_0417518 3300036712 Bacteria 953
338 Ga0373925_0084529 3300037068 Bacteria 2418
339 Ga0316581_0020371 3300037588 Bacteria 1942
340 Ga0400484_07356 3300038725 Bacteria 3035
341 Ga0400484_17229 3300038725 Bacteria 1427
342 Ga0400491_21420 3300038727 Bacteria 5319
343 Ga0400485_16981 3300038735 Bacteria 20735
344 Ga0400488_08573 3300038741 Bacteria 1467
345 Ga0400488_33230 3300038741 Bacteria 5995
346 Ga0400486_04193 3300038742 Bacteria 5688
347 Ga0400486_18890 3300038742 Bacteria 7068
348 Ga0400483_073445 3300039062 Bacteria 5100
349 Ga0400483_209336 3300039062 Bacteria 3231
350 Ga0400489_51756 3300039093 Bacteria 3160
351 Ga0400489_56304 3300039093 Bacteria 7813
352 Ga0400489_83943 3300039093 Bacteria 10306
353 Ga0400487_64279 3300039110 Bacteria 29873
354 Ga0439464_0026379 3300042439 Bacteria 1612
355 Ga0451577_0079993 3300042876 Bacteria 2914
356 Ga0451577_0217818 3300042876 Bacteria 1725
357 Ga0453683_0022619 3300044673 Bacteria 4009
358 Ga0453683_0063990 3300044673 Unclassified 2299
359 Ga0453684_0014397 3300044712 Bacteria 12661
360 Ga0453684_0256247 3300044712 Unclassified 2006
361 Ga0451576_0088532 3300045051 Unclassified 3220
362 Ga0451576_0134488 3300045051 Bacteria 2578
363 Ga0451576_0152446 3300045051 Bacteria 2410
364 Ga0495580_0000808 3300046472 Bacteria 27100
365 Ga0495580_0062954 3300046472 Bacteria 2602
366 Ga0495580_0125834 3300046472 Bacteria 1779
367 Ga0495607_0363988 3300046501 Unclassified 665
368 Ga0495586_0139089 3300046535 Bacteria 1362
369 Ga0495647_0083018 3300046681 Bacteria 1302
370 Ga0495669_0303071 3300046684 Unclassified 770
371 Ga0495581_0502837 3300047315 Unclassified 705
372 Ga0495677_0299285 3300047445 Unclassified 633
373 Ga0496100_0211183 3300048903 Bacteria 1420
374 Ga0496101_0072210 3300048904 Bacteria 2533
375 Ga0496102_0135759 3300048905 Bacteria 2305
376 Ga0496103_0993645 3300048906 Unclassified 523
377 Ga0496104_0308465 3300048907 Bacteria 1495
378 Ga0496106_0979262 3300048909 Bacteria 666
379 Ga0496107_0169531 3300048910 Unclassified 1620
380 Ga0496112_0031676 3300048915 Bacteria 5130
381 Ga0496112_0060560 3300048915 Bacteria 3731
382 Ga0496113_0164907 3300048916 Bacteria 1753
383 Ga0501031_0004007 3300049568 Bacteria 9501
384 Ga0501031_0024780 3300049568 Bacteria 3911
385 Ga0501032_0007628 3300049569 Bacteria 7890
386 Ga0501032_0077923 3300049569 Bacteria 2206
387 Ga0501033_0047766 3300049570 Bacteria 3182
388 Ga0501034_1094570 3300049571 Bacteria 678
389 Ga0501036_0003853 3300049572 Bacteria 12036
390 Ga0501036_0016390 3300049572 Bacteria 6190
391 Ga0501037_0022346 3300049573 Bacteria 4679
392 Ga0501037_0035677 3300049573 Bacteria 3666
393 Ga0501037_0049553 3300049573 Bacteria 3075
394 Ga0501038_0001775 3300049574 Bacteria 20032
395 Ga0501038_0007057 3300049574 Bacteria 10372
396 Ga0501038_0369073 3300049574 Bacteria 1115
397 Ga0501038_0792755 3300049574 Bacteria 704
398 Ga0501038_0934303 3300049574 Bacteria 639
399 Ga0501039_0000497 3300049575 Bacteria 28501
400 Ga0501039_0000747 3300049575 Bacteria 23375
401 Ga0501039_0806920 3300049575 Unclassified 732
402 Ga0501040_0003120 3300049576 Bacteria 10747
403 Ga0501040_0055480 3300049576 Bacteria 2717
404 Ga0501041_0000099 3300049577 Bacteria 35733
405 Ga0501041_0001308 3300049577 Bacteria 13699
406 Ga0501041_0003906 3300049577 Bacteria 8591
407 Ga0501042_0000105 3300049578 Bacteria 34410
408 Ga0501042_0000526 3300049578 Bacteria 19980
409 Ga0501042_0005325 3300049578 Bacteria 8268
410 Ga0501042_0681162 3300049578 Unclassified 748
411 Ga0501043_0055542 3300049579 Unclassified 3111
412 Ga0501043_0061396 3300049579 Bacteria 2952
413 Ga0501046_0002289 3300049580 Bacteria 18056
414 Ga0501046_0009913 3300049580 Bacteria 8208
415 Ga0501046_0009953 3300049580 Bacteria 8191
416 Ga0501046_0172705 3300049580 Unclassified 1621
417 Ga0501048_0047967 3300049582 Bacteria 3046
418 Ga0501048_1303088 3300049582 Unclassified 522
419 Ga0501068_0012412 3300049584 Unclassified 4831
420 Ga0501071_0000575 3300049587 Bacteria 19031
421 Ga0501071_0110017 3300049587 Bacteria 2036
422 Ga0501071_0146751 3300049587 Unclassified 1759
423 Ga0501072_0000109 3300049588 Bacteria 61031
424 Ga0501073_0427055 3300049589 Bacteria 916
425 Ga0501074_0005533 3300049590 Bacteria 9086
426 Ga0501074_0273348 3300049590 Bacteria 1201
427 Ga0501075_0000256 3300049591 Bacteria 28898
428 Ga0501075_0034250 3300049591 Unclassified 3781
429 Ga0501075_0190705 3300049591 Bacteria 1563
430 Ga0501075_0498348 3300049591 Unclassified 929
431 Ga0501076_0000635 3300049592 Bacteria 22398
432 Ga0501076_0031276 3300049592 Bacteria 4150
433 Ga0501076_0570552 3300049592 Bacteria 933
434 Ga0501076_0831044 3300049592 Unclassified 762
435 Ga0501077_0001225 3300049593 Bacteria 15495
436 Ga0501077_0005415 3300049593 Bacteria 7761
437 Ga0501077_0103516 3300049593 Bacteria 1804
438 Ga0501077_0167660 3300049593 Unclassified 1395
439 Ga0501235_071968 3300049669 Unclassified 819
440 Ga0501221_036981 3300049704 Unclassified 1048
441 Ga0501079_0000395 3300049741 Bacteria 28073
442 Ga0501079_0392878 3300049741 Bacteria 1088
443 Ga0501080_0001737 3300049742 Bacteria 18656
444 Ga0501081_0008749 3300049743 Bacteria 6579
445 Ga0501081_0602940 3300049743 Bacteria 822
446 Ga0501083_0025085 3300049744 Bacteria 4129
447 Ga0501271_045360 3300049768 Unclassified 583
448 Ga0501035_0012757 3300049822 Bacteria 7765
449 Ga0501035_0064159 3300049822 Bacteria 3265
450 Ga0501044_0874147 3300049823 Bacteria 775
451 Ga0501045_0000209 3300049824 Bacteria 33671
452 Ga0501045_0289494 3300049824 Bacteria 1219
453 Ga0501045_0984418 3300049824 Bacteria 619
454 nmdc:mga05p37_114539_c1 3300050507 Bacteria 3314
455 nmdc:mga05p37_128801_c1 3300050507 Unclassified 3107
456 nmdc:mga05p37_141120_c1 3300050507 Bacteria 2952
457 nmdc:mga05p37_1657495_c1 3300050507 Unclassified 626
458 nmdc:mga05p37_18108_c1 3300050507 Bacteria 8509
459 nmdc:mga05p37_43075_c1 3300050507 Bacteria 5551
460 nmdc:mga05p37_82683_c1 3300050507 Bacteria 3957
461 nmdc:mga09592_254474_c1 3300050508 Unclassified 1522
462 nmdc:mga09592_723062_c1 3300050508 Bacteria 846
463 nmdc:mga0qj67_308506_c1 3300050509 Unclassified 1282
464 nmdc:mga0qj67_38321_c1 3300050509 Bacteria 3760
465 nmdc:mga0qj67_515126_c1 3300050509 Bacteria 961
466 nmdc:mga0qj67_731169_c1 3300050509 Unclassified 786
467 nmdc:mga0qj67_92534_c1 3300050509 Unclassified 2431
468 nmdc:mga06r32_112120_c1 3300050510 Unclassified 2684
469 nmdc:mga06r32_273646_c1 3300050510 Bacteria 1676
470 nmdc:mga06r32_297017_c1 3300050510 Bacteria 1601
471 nmdc:mga06r32_535698_c1 3300050510 Bacteria 1146
472 nmdc:mga06r32_772554_c1 3300050510 Bacteria 923
473 nmdc:mga06r32_77748_c1 3300050510 Bacteria 3224
474 nmdc:mga08y16_115975_c1 3300050511 Bacteria 2788
475 nmdc:mga08y16_120032_c1 3300050511 Bacteria 2736
476 nmdc:mga08y16_57297_c1 3300050511 Bacteria 4072
477 nmdc:mga08y16_92660_c1 3300050511 Unclassified 3148
478 nmdc:mga0n895_134085_c1 3300050512 Bacteria 2502
479 nmdc:mga0n895_193316_c1 3300050512 Bacteria 2066
480 nmdc:mga0n895_4874_c1 3300050512 Bacteria 11115
481 nmdc:mga0n895_51067_c1 3300050512 Bacteria 4056
482 nmdc:mga0n895_66797_c1 3300050512 Bacteria 3560
483 nmdc:mga0n895_77963_c1 3300050512 Unclassified 3297
484 nmdc:mga0rr50_114826_c1 3300050513 Bacteria 2136
485 nmdc:mga0rr50_118394_c1 3300050513 Bacteria 2104
486 nmdc:mga0rr50_14755_c1 3300050513 Bacteria 5137
487 nmdc:mga0rr50_272675_c1 3300050513 Bacteria 1410
488 nmdc:mga0rr50_413942_c1 3300050513 Bacteria 1140
489 nmdc:mga0rr50_7247_c1 3300050513 Bacteria 6821
490 nmdc:mga0rr50_79155_c1 3300050513 Bacteria 2531
491 nmdc:mga08x19_325552_c1 3300050514 Unclassified 1070
492 nmdc:mga08x19_671932_c1 3300050514 Unclassified 735
493 nmdc:mga08x19_7774_c1 3300050514 Bacteria 6369
494 nmdc:mga0a205_114134_c1 3300050515 Unclassified 2600
495 nmdc:mga0a205_128613_c1 3300050515 Bacteria 2433
496 nmdc:mga0a205_1857_c1 3300050515 Bacteria 18274
497 nmdc:mga0a205_512644_c1 3300050515 Unclassified 1056
498 nmdc:mga0a205_698_c1 3300050515 Bacteria 26929
499 nmdc:mga0a205_75120_c1 3300050515 Bacteria 3265
500 nmdc:mga0a205_8256_c1 3300050515 Bacteria 9466
501 Ga0501084_0000143 3300054114 Bacteria 54042
502 Ga0501084_0156328 3300054114 Bacteria 1923
503 Ga0590071_008200 3300059421 Bacteria 2463
504 Ga0590077_004732 3300059426 Bacteria 2786
505 Ga0501082_0002378 3300060353 Bacteria 16483
506 Ga0501082_0157954 3300060353 Bacteria 1970
507 Ga0501082_0230740 3300060353 Bacteria 1611
508 Ga0530510_0000992 3300061734 Bacteria 18829
509 Ga0530510_0100360 3300061734 Bacteria 2116
510 Ga0530510_0170547 3300061734 Bacteria 1612
511 Ga0530510_0333608 3300061734 Bacteria 1138
512 Ga0530510_0592016 3300061734 Bacteria 843
513 Ga0070708_100828108
514 JGI25407J50210_10114581
515 Ga0065714_10154398
516 Ga0065712_10067961
517 Ga0065712_10072278
518 Ga0065715_10005113
519 Ga0065715_10089289
520 Ga0065707_10012209
521 Ga0070676_10011072
522 Ga0070690_100029352
523 Ga0070670_100002060
524 Ga0070670_100452246
525 Ga0070677_10009449
526 Ga0068869_100391041
527 Ga0068869_100510638
528 Ga0070666_10047588
529 Ga0070680_100062037
530 Ga0070680_100115279
531 Ga0070680_101267757
532 Ga0070682_100052370
533 Ga0068868_100077387
534 Ga0070660_100035637
535 Ga0070660_100242681
536 Ga0070689_101006783
537 Ga0070691_10021725
538 Ga0070687_100037141
539 Ga0070661_100027345
540 Ga0070692_10157059
541 Ga0070692_10306525
542 Ga0070692_10316471
543 Ga0070669_100027583
544 Ga0070671_100013890
545 Ga0070671_100417231
546 Ga0070674_100075376
547 Ga0070674_100236727
548 Ga0070674_100503123
549 Ga0070673_100043446
550 Ga0070659_100046990
551 Ga0070659_101380280
552 Ga0070667_100018086
553 Ga0070711_100035845
554 Ga0070705_100034426
555 Ga0070700_100193115
556 Ga0070694_100041969
557 Ga0070708_100049637
558 Ga0070708_100344109
559 Ga0070708_100791000
560 Ga0070663_100121043
561 Ga0070678_100107129
562 Ga0070678_101710415
563 Ga0070681_10022388
564 Ga0070681_10038593
565 Ga0068867_100048915
566 Ga0070706_100001496
567 Ga0070706_100011290
568 Ga0070706_100208325
569 Ga0070706_100826846
570 Ga0070707_100002307
571 Ga0070707_101162544
572 Ga0070698_100128025
573 Ga0070698_100301900
574 Ga0070698_100388531
575 Ga0070698_100429229
576 Ga0070699_100186481
577 Ga0070699_100199510
578 Ga0070699_100566111
579 Ga0070699_100574579
580 Ga0070699_101626793
581 Ga0070679_100004386
582 Ga0070679_100221325
583 Ga0070684_100383824
584 Ga0070697_100003118
585 Ga0070697_100011067
586 Ga0070697_100137419
587 Ga0070697_100171925
588 Ga0070697_100183206
589 Ga0070697_100638787
590 Ga0070697_100645931
591 Ga0068853_100386425
592 Ga0070672_100030241
593 Ga0070686_100024387
594 Ga0070686_100226284
595 Ga0070695_100047304
596 Ga0070695_100082921
597 Ga0070695_100948876
598 Ga0070696_100055114
599 Ga0070696_100073634
600 Ga0070696_100411378
601 Ga0070693_100028728
602 Ga0070693_100151017
603 Ga0070693_100859031
604 Ga0070665_100093985
605 Ga0070704_100126408
606 Ga0070664_100014707
607 Ga0070664_100784235
608 Ga0068857_100233461
609 Ga0068854_100027425
610 Ga0068856_100018318
611 Ga0070702_100035276
612 Ga0070702_100520678
613 Ga0070702_100830003
614 Ga0068859_100069285
615 Ga0068864_100152550
616 Ga0068866_10050253
617 Ga0068866_10311351
618 Ga0068870_10609629
619 Ga0068860_100079711
620 Ga0081455_10000672
621 Ga0081455_10031419
622 Ga0081455_10074770
623 Ga0081538_10005506
624 Ga0081538_10007518
625 Ga0081538_10036415
626 Ga0081538_10112456
627 Ga0070716_100563567
628 Ga0070712_100032922
629 Ga0068871_100218083
630 Ga0075428_100594987
631 Ga0075428_101281372
632 Ga0075428_101512431
633 Ga0075430_100049641
634 Ga0075430_100054727
635 Ga0075430_100061501
636 Ga0075430_100820211
637 Ga0075431_100000620
638 Ga0075431_100075441
639 Ga0075431_100423915
640 Ga0075433_10016122
641 Ga0075433_10017613
642 Ga0075433_10115125
643 Ga0075433_10161457
644 Ga0075433_10177859
645 Ga0075433_10364909
646 Ga0075434_100007676
647 Ga0075434_100042930
648 Ga0075434_100108284
649 Ga0075434_100137972
650 Ga0075434_100185526
651 Ga0075434_100295593
652 Ga0075429_100075404
653 Ga0075429_100085986
654 Ga0075429_100130163
655 Ga0075429_100337132
656 Ga0075429_100349425
657 Ga0075429_100520791
658 Ga0068865_100192120
659 Ga0068865_100272151
660 Ga0075436_100043609
661 Ga0075436_100085506
662 Ga0075436_100467066
663 Ga0097620_100069286
664 Ga0075435_100030298
665 Ga0075435_100042752
666 Ga0075435_100094730
667 Ga0075435_100114202
668 Ga0075435_100359994
669 Ga0075435_101347865
670 Ga0105240_10123226
671 Ga0111539_10067104
672 Ga0111539_10104494
673 Ga0111539_10220650
674 Ga0105245_10546646
675 Ga0114129_10026028
676 Ga0114129_10028100
677 Ga0114129_10047504
678 Ga0114129_10147177
679 Ga0114129_10667635
680 Ga0105243_10173852
681 Ga0105241_10009657
682 Ga0105242_10131152
683 Ga0105248_10160600
684 Ga0105237_10634400
685 Ga0105249_10093044
686 Ga0105249_10236428
687 Ga0105249_10768155
688 Ga0105239_10020639
689 Ga0105246_10025799
690 Ga0157346_1004936
691 Ga0157324_1008416
692 Ga0157373_10069807
693 Ga0157374_10067248
694 Ga0157374_11386834
695 Ga0157378_10007068
696 Ga0157378_10017847
697 Ga0157378_10191134
698 Ga0163162_10014520
699 Ga0163162_10024085
700 Ga0157372_10200214
701 Ga0163163_10341544
702 Ga0157376_10024330
703 Ga0157376_10287643
704 Ga0207697_10175633
705 Ga0207682_10012618
706 Ga0207688_10101519
707 Ga0207680_10055311
708 Ga0207647_10307441
709 Ga0207685_10235942
710 Ga0207645_10000938
711 Ga0207684_10000439
712 Ga0207684_10000505
713 Ga0207707_10009573
714 Ga0207707_10045917
715 Ga0207693_10150616
716 Ga0207663_10761096
717 Ga0207660_10007810
718 Ga0207660_10981714
719 Ga0207662_10073803
720 Ga0207657_10005277
721 Ga0207657_10277175
722 Ga0207649_10043232
723 Ga0207652_10140362
724 Ga0207652_10189795
725 Ga0207646_10000252
726 Ga0207646_10253698
727 Ga0207646_10530397
728 Ga0207650_10039759
729 Ga0207650_10165500
730 Ga0207650_10399347
731 Ga0207659_10150842
732 Ga0207690_10043242
733 Ga0207706_10004414
734 Ga0207706_10033794
735 Ga0207706_10101637
736 Ga0207670_10620034
737 Ga0207704_10138106
738 Ga0207704_11077301
739 Ga0207691_10005407
740 Ga0207689_10031098
741 Ga0207679_10002958
742 Ga0207679_10257977
743 Ga0207640_11632374
744 Ga0207658_10061607
745 Ga0207708_10808551
746 Ga0207702_10052067
747 Ga0207648_10056585
748 Ga0207676_10434793
749 Ga0207674_10140250
750 Ga0207674_10341565
751 Ga0207683_10000522
752 Ga0209973_1056522
753 Ga0209982_1001496
754 Ga0210002_1030137
755 Ga0209983_1021676
756 Ga0209966_1002477
757 Ga0209998_10004309
758 Ga0209974_10073957
759 Ga0209974_10163016
760 Ga0207428_10426107
761 Ga0207428_10713253
762 Ga0268266_11274024
763 Ga0307408_100013947
764 Ga0316575_10002585
765 Ga0316575_10025567
766 Ga0316575_10035668
767 Ga0316579_10009093
768 Ga0316579_10181477
769 Ga0316579_10187074
770 Ga0316576_10007420
771 Ga0316576_10018234
772 Ga0316576_10040334
773 Ga0316576_10371411
774 Ga0316576_10562256
775 Ga0316576_10872934
776 Ga0316578_10003086
777 Ga0316578_10006808
778 Ga0316578_10008128
779 Ga0316578_10059427
780 Ga0316578_10069924
781 Ga0307405_10043366
782 Ga0307405_10300437
783 Ga0316577_10006824
784 Ga0316577_10016004
785 Ga0316577_10070433
786 Ga0316577_10121327
787 Ga0316577_10207456
788 Ga0316577_10229844
789 Ga0307413_10001482
790 Ga0307413_10276659
791 Ga0307410_10003756
792 Ga0307406_10045309
793 Ga0307406_10068107
794 Ga0307406_10094275
795 Ga0307407_10164425
796 Ga0307412_10011528
797 Ga0307412_10147274
798 Ga0307409_100003950
799 Ga0307416_100011040
800 Ga0307416_100230047
801 Ga0307414_10008285
802 Ga0307411_10003952
803 Ga0307411_10121964
804 Ga0307415_100013880
805 Ga0307415_100015941
806 Ga0316583_10005856
807 Ga0316583_10009726
808 Ga0316583_10014955
809 Ga0316583_10016660
810 Ga0316583_10062576
811 Ga0316585_10004365
812 Ga0316585_10023138
813 Ga0316585_10044837
814 Ga0316580_10002159
815 Ga0316580_10009512
816 Ga0316593_10008289
817 Ga0316593_10009407
818 Ga0316592_1015934
819 Ga0316586_1003068
820 Ga0316588_1094349
821 Ga0316596_1098779
822 Ga0373938_0080620
823 Ga0373926_0027138
824 Ga0373949_0157946
825 Ga0373939_0149419
826 Ga0373945_0022867
827 Ga0373943_0033995
828 Ga0373946_0013506
829 Ga0316574_0004424
830 Ga0316574_0008918
831 Ga0316574_0036674
832 Ga0316574_0037496
833 Ga0316574_0239690
834 Ga0373931_0005086
835 Ga0373935_0027751
836 Ga0373933_0674209
837 Ga0373947_0065257
838 Ga0316582_0002638
839 Ga0316582_0037354
840 Ga0316582_0124525
841 Ga0316582_0278536
842 Ga0316582_0671526
843 Ga0316582_0938201
844 Ga0316584_0028234
845 Ga0316584_0069065
846 Ga0316584_0160644
847 Ga0316584_0203112
848 Ga0316584_0206986
849 Ga0316584_0417518
850 Ga0373925_0084529
851 Ga0316581_0020371
852 Ga0400484_07356
853 Ga0400484_17229
854 Ga0400491_21420
855 Ga0400485_16981
856 Ga0400488_08573
857 Ga0400488_33230
858 Ga0400486_04193
859 Ga0400486_18890
860 Ga0400483_073445
861 Ga0400483_209336
862 Ga0400489_51756
863 Ga0400489_56304
864 Ga0400489_83943
865 Ga0400487_64279
866 Ga0439464_0026379
867 Ga0451577_0079993
868 Ga0451577_0217818
869 Ga0453683_0022619
870 Ga0453683_0063990
871 Ga0453684_0014397
872 Ga0453684_0256247
873 Ga0451576_0088532
874 Ga0451576_0134488
875 Ga0451576_0152446
876 Ga0495580_0000808
877 Ga0495580_0062954
878 Ga0495580_0125834
879 Ga0495607_0363988
880 Ga0495586_0139089
881 Ga0495647_0083018
882 Ga0495669_0303071
883 Ga0495581_0502837
884 Ga0495677_0299285
885 Ga0496100_0211183
886 Ga0496101_0072210
887 Ga0496102_0135759
888 Ga0496103_0993645
889 Ga0496104_0308465
890 Ga0496106_0979262
891 Ga0496107_0169531
892 Ga0496112_0031676
893 Ga0496112_0060560
894 Ga0496113_0164907
895 Ga0501031_0004007
896 Ga0501031_0024780
897 Ga0501032_0007628
898 Ga0501032_0077923
899 Ga0501033_0047766
900 Ga0501034_1094570
901 Ga0501036_0003853
902 Ga0501036_0016390
903 Ga0501037_0022346
904 Ga0501037_0035677
905 Ga0501037_0049553
906 Ga0501038_0001775
907 Ga0501038_0007057
908 Ga0501038_0369073
909 Ga0501038_0792755
910 Ga0501038_0934303
911 Ga0501039_0000497
912 Ga0501039_0000747
913 Ga0501039_0806920
914 Ga0501040_0003120
915 Ga0501040_0055480
916 Ga0501041_0000099
917 Ga0501041_0001308
918 Ga0501041_0003906
919 Ga0501042_0000105
920 Ga0501042_0000526
921 Ga0501042_0005325
922 Ga0501042_0681162
923 Ga0501043_0055542
924 Ga0501043_0061396
925 Ga0501046_0002289
926 Ga0501046_0009913
927 Ga0501046_0009953
928 Ga0501046_0172705
929 Ga0501048_0047967
930 Ga0501048_1303088
931 Ga0501068_0012412
932 Ga0501071_0000575
933 Ga0501071_0110017
934 Ga0501071_0146751
935 Ga0501072_0000109
936 Ga0501073_0427055
937 Ga0501074_0005533
938 Ga0501074_0273348
939 Ga0501075_0000256
940 Ga0501075_0034250
941 Ga0501075_0190705
942 Ga0501075_0498348
943 Ga0501076_0000635
944 Ga0501076_0031276
945 Ga0501076_0570552
946 Ga0501076_0831044
947 Ga0501077_0001225
948 Ga0501077_0005415
949 Ga0501077_0103516
950 Ga0501077_0167660
951 Ga0501235_071968
952 Ga0501221_036981
953 Ga0501079_0000395
954 Ga0501079_0392878
955 Ga0501080_0001737
956 Ga0501081_0008749
957 Ga0501081_0602940
958 Ga0501083_0025085
959 Ga0501271_045360
960 Ga0501035_0012757
961 Ga0501035_0064159
962 Ga0501044_0874147
963 Ga0501045_0000209
964 Ga0501045_0289494
965 Ga0501045_0984418
966 nmdc:mga05p37_114539_c1
967 nmdc:mga05p37_128801_c1
968 nmdc:mga05p37_141120_c1
969 nmdc:mga05p37_1657495_c1
970 nmdc:mga05p37_18108_c1
971 nmdc:mga05p37_43075_c1
972 nmdc:mga05p37_82683_c1
973 nmdc:mga09592_254474_c1
974 nmdc:mga09592_723062_c1
975 nmdc:mga0qj67_308506_c1
976 nmdc:mga0qj67_38321_c1
977 nmdc:mga0qj67_515126_c1
978 nmdc:mga0qj67_731169_c1
979 nmdc:mga0qj67_92534_c1
980 nmdc:mga06r32_112120_c1
981 nmdc:mga06r32_273646_c1
982 nmdc:mga06r32_297017_c1
983 nmdc:mga06r32_535698_c1
984 nmdc:mga06r32_772554_c1
985 nmdc:mga06r32_77748_c1
986 nmdc:mga08y16_115975_c1
987 nmdc:mga08y16_120032_c1
988 nmdc:mga08y16_57297_c1
989 nmdc:mga08y16_92660_c1
990 nmdc:mga0n895_134085_c1
991 nmdc:mga0n895_193316_c1
992 nmdc:mga0n895_4874_c1
993 nmdc:mga0n895_51067_c1
994 nmdc:mga0n895_66797_c1
995 nmdc:mga0n895_77963_c1
996 nmdc:mga0rr50_114826_c1
997 nmdc:mga0rr50_118394_c1
998 nmdc:mga0rr50_14755_c1
999 nmdc:mga0rr50_272675_c1
1000 nmdc:mga0rr50_413942_c1
1001 nmdc:mga0rr50_7247_c1
1002 nmdc:mga0rr50_79155_c1
1003 nmdc:mga08x19_325552_c1
1004 nmdc:mga08x19_671932_c1
1005 nmdc:mga08x19_7774_c1
1006 nmdc:mga0a205_114134_c1
1007 nmdc:mga0a205_128613_c1
1008 nmdc:mga0a205_1857_c1
1009 nmdc:mga0a205_512644_c1
1010 nmdc:mga0a205_698_c1
1011 nmdc:mga0a205_75120_c1
1012 nmdc:mga0a205_8256_c1
1013 Ga0501084_0000143
1014 Ga0501084_0156328
1015 Ga0590071_008200
1016 Ga0590077_004732
1017 Ga0501082_0002378
1018 Ga0501082_0157954
1019 Ga0501082_0230740
1020 Ga0530510_0000992
1021 Ga0530510_0100360
1022 Ga0530510_0170547
1023 Ga0530510_0333608
1024 Ga0530510_0592016

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02470

MlaD

MlaD protein

37

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uw2-assembly1.cif.gz_A-2 structure of e. coli mce protein mlad, periplasmic domain 0.9625 38 141
5uw2-assembly1.cif.gz_B structure of e. coli mce protein mlad, periplasmic domain 0.9583 36 141
5uw8-assembly1.cif.gz_G structure of e. coli mce protein mlad, core mce domain 0.9555 37 129
5uw8-assembly1.cif.gz_D structure of e. coli mce protein mlad, core mce domain 0.9507 36 129
5uw8-assembly1.cif.gz_B structure of e. coli mce protein mlad, core mce domain 0.9479 36 128
ID Description Score Start End Superfamily
af_P64604_38_117_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.98 38 112 2.30.30.60
af_O53969_38_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9547 37 112 2.40.50.140
af_I6YGB1_43_119_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9412 37 112 2.40.50.140
af_O53968_37_114_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9355 37 112 2.40.50.140
af_I6X7G8_41_118_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9332 40 112 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7Z9Z8S0-F1-model_v4 MCE family protein 0.9499 36 143
AF-A0A1A0TNT2-F1-model_v4 Mammalian cell entry protein 0.9395 36 141 GO:0005576
AF-A0A5M7BWR1-F1-model_v4 MCE family protein 0.9371 35 142 GO:0005576
AF-A0A8B4DPR5-F1-model_v4 deleted 0.9364 35 141
AF-A0A542TBI4-F1-model_v4 deleted 0.9345 35 141

Map