F457160

General Info

Members Datasets Scaffolds Average Seq Length
510 235 1020 191

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10984775|Ga0268265_109847752
Length 181
Sequence MKQAIVLTSVLLGSGFLVLNTSPSSSGEFKKLSKRANAAEGPSGNVSIVIDKSDYELSVYDAKGWYATYPVVFGNSSLDDKKVAGDKNTPEGSFRIISKRVHDKWDRFMCLDYPRKRKQRGEIPASASIGGGIGIHGTWPHEDFVVDKYKNWTLGCISMKCKDVEEIYTFTPVGTKVTIQK

Samples

Sample ID Description Type Environment
1 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
147 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
151 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
152 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
179 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
195 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
196 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
197 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
198 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
199 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
200 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
201 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
202 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
203 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
204 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
205 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
206 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
207 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
208 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
211 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
212 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
213 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
214 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
215 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
218 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
219 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
220 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
221 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
222 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
223 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 0.98
Rhizosphere 98.63
Stem 0
Stem Tuber 0
Unclassified 13.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268265_10984775 3300028380 Bacteria 832
2 ARcpr5yngRDRAFT_c008188 3300000043 Bacteria 906
3 ARSoilOldRDRAFT_c008055 3300000044 Bacteria 877
4 Ga0065712_10239420 3300005290 Bacteria 988
5 Ga0070676_10925151 3300005328 Unclassified 651
6 Ga0070683_100010830 3300005329 Bacteria 7849
7 Ga0070683_100180789 3300005329 Bacteria 2002
8 Ga0070683_100472122 3300005329 Bacteria 1198
9 Ga0070690_100161408 3300005330 Bacteria 1536
10 Ga0070670_100125290 3300005331 Bacteria 2217
11 Ga0070670_100332363 3300005331 Unclassified 1333
12 Ga0070670_100373877 3300005331 Bacteria 1255
13 Ga0070677_10003429 3300005333 Bacteria 5113
14 Ga0070677_10204025 3300005333 Unclassified 956
15 Ga0068869_100002336 3300005334 Bacteria 11408
16 Ga0068869_100005420 3300005334 Bacteria 8023
17 Ga0068869_100015414 3300005334 Bacteria 5126
18 Ga0068869_100072957 3300005334 Bacteria 2544
19 Ga0068869_100076319 3300005334 Bacteria 2491
20 Ga0068869_100264173 3300005334 Bacteria 1379
21 Ga0068869_100540176 3300005334 Bacteria 978
22 Ga0070666_10014254 3300005335 Bacteria 5059
23 Ga0068868_100002287 3300005338 Bacteria 13245
24 Ga0068868_100005303 3300005338 Bacteria 9057
25 Ga0068868_100343681 3300005338 Bacteria 1276
26 Ga0070660_100040458 3300005339 Bacteria 3548
27 Ga0070660_100593296 3300005339 Unclassified 926
28 Ga0070689_100003896 3300005340 Bacteria 10000
29 Ga0070689_100090837 3300005340 Bacteria 2407
30 Ga0070689_100195329 3300005340 Bacteria 1649
31 Ga0070689_100442874 3300005340 Unclassified 1104
32 Ga0070691_10137504 3300005341 Unclassified 1242
33 Ga0070661_100001257 3300005344 Bacteria 17801
34 Ga0070661_100001981 3300005344 Bacteria 14161
35 Ga0070661_100343499 3300005344 Bacteria 1170
36 Ga0070661_100344682 3300005344 Bacteria 1168
37 Ga0070661_100589957 3300005344 Unclassified 897
38 Ga0070661_100845341 3300005344 Unclassified 753
39 Ga0070668_100032720 3300005347 Bacteria 3956
40 Ga0070668_100123207 3300005347 Bacteria 2074
41 Ga0070668_100365131 3300005347 Bacteria 1225
42 Ga0070669_100066640 3300005353 Bacteria 2654
43 Ga0070675_100071215 3300005354 Bacteria 2883
44 Ga0070675_100092395 3300005354 Bacteria 2537
45 Ga0070675_100098987 3300005354 Bacteria 2454
46 Ga0070675_100372311 3300005354 Bacteria 1270
47 Ga0070675_100705921 3300005354 Unclassified 919
48 Ga0070671_100061899 3300005355 Bacteria 3117
49 Ga0070671_100249700 3300005355 Bacteria 1507
50 Ga0070671_100309866 3300005355 Bacteria 1344
51 Ga0070671_100327906 3300005355 Bacteria 1305
52 Ga0070671_100394163 3300005355 Bacteria 1184
53 Ga0070671_100669100 3300005355 Bacteria 899
54 Ga0070674_100186381 3300005356 Bacteria 1593
55 Ga0070674_100670479 3300005356 Viruses 883
56 Ga0070673_100143155 3300005364 Bacteria 2019
57 Ga0070673_100395472 3300005364 Bacteria 1235
58 Ga0070673_101026405 3300005364 Unclassified 768
59 Ga0070688_100026399 3300005365 Bacteria 3451
60 Ga0070688_100043754 3300005365 Bacteria 2760
61 Ga0070688_100082924 3300005365 Bacteria 2079
62 Ga0070659_100004169 3300005366 Bacteria 10305
63 Ga0070659_100032061 3300005366 Bacteria 4074
64 Ga0070667_100007776 3300005367 Bacteria 8886
65 Ga0070667_100014267 3300005367 Bacteria 6562
66 Ga0070667_100065695 3300005367 Unclassified 3080
67 Ga0070667_100113790 3300005367 Bacteria 2349
68 Ga0070667_100817986 3300005367 Bacteria 865
69 Ga0070694_100902539 3300005444 Bacteria 729
70 Ga0070663_100272796 3300005455 Bacteria 1345
71 Ga0070678_100002325 3300005456 Bacteria 10378
72 Ga0070662_100017002 3300005457 Bacteria 4892
73 Ga0070662_100017707 3300005457 Bacteria 4807
74 Ga0070662_100098102 3300005457 Bacteria 2212
75 Ga0068867_100031445 3300005459 Bacteria 3833
76 Ga0068867_100170703 3300005459 Bacteria 1722
77 Ga0070685_10019831 3300005466 Unclassified 3633
78 Ga0070698_100001781 3300005471 Bacteria 23961
79 Ga0070698_100041436 3300005471 Bacteria 4727
80 Ga0070684_100000042 3300005535 Bacteria 89896
81 Ga0070684_100011749 3300005535 Bacteria 6984
82 Ga0070684_100192726 3300005535 Bacteria 1855
83 Ga0070684_101312877 3300005535 Bacteria 681
84 Ga0068853_100008513 3300005539 Bacteria 8244
85 Ga0068853_100011907 3300005539 Bacteria 7074
86 Ga0068853_100561098 3300005539 Bacteria 1082
87 Ga0068853_100857623 3300005539 Bacteria 871
88 Ga0068853_100992631 3300005539 Bacteria 808
89 Ga0068853_101491647 3300005539 Unclassified 655
90 Ga0070672_100041133 3300005543 Bacteria 3551
91 Ga0070672_100085120 3300005543 Bacteria 2540
92 Ga0070672_100101040 3300005543 Bacteria 2339
93 Ga0070672_100250257 3300005543 Bacteria 1492
94 Ga0070672_100771431 3300005543 Bacteria 845
95 Ga0070672_100986283 3300005543 Unclassified 746
96 Ga0070686_100610265 3300005544 Unclassified 861
97 Ga0070665_100326615 3300005548 Bacteria 1538
98 Ga0070704_100775905 3300005549 Bacteria 855
99 Ga0070664_100000266 3300005564 Bacteria 37671
100 Ga0070664_100072304 3300005564 Bacteria 2957
101 Ga0070664_100126246 3300005564 Bacteria 2244
102 Ga0070664_100144875 3300005564 Bacteria 2094
103 Ga0070664_100165214 3300005564 Bacteria 1961
104 Ga0070664_100650146 3300005564 Bacteria 980
105 Ga0068857_100007376 3300005577 Bacteria 9467
106 Ga0068857_100010552 3300005577 Bacteria 8032
107 Ga0068857_100076601 3300005577 Bacteria 2983
108 Ga0068857_101259020 3300005577 Bacteria 717
109 Ga0068854_100067225 3300005578 Bacteria 2611
110 Ga0068854_100538208 3300005578 Unclassified 989
111 Ga0068856_100192689 3300005614 Bacteria 2052
112 Ga0068852_100005933 3300005616 Bacteria 8783
113 Ga0068852_100074638 3300005616 Bacteria 2988
114 Ga0068852_100740549 3300005616 Bacteria 995
115 Ga0068859_100029578 3300005617 Bacteria 5497
116 Ga0068859_100036517 3300005617 Bacteria 4933
117 Ga0068859_100072191 3300005617 Bacteria 3488
118 Ga0068859_100086967 3300005617 Bacteria 3173
119 Ga0068859_100124085 3300005617 Bacteria 2650
120 Ga0068859_100367716 3300005617 Bacteria 1533
121 Ga0068859_101546123 3300005617 Unclassified 732
122 Ga0068864_100049507 3300005618 Bacteria 3615
123 Ga0068864_100070453 3300005618 Bacteria 3042
124 Ga0068864_100077367 3300005618 Bacteria 2909
125 Ga0068864_100121113 3300005618 Bacteria 2339
126 Ga0068866_10063514 3300005718 Bacteria 1925
127 Ga0068866_10097835 3300005718 Bacteria 1612
128 Ga0068861_100019988 3300005719 Bacteria 4789
129 Ga0068861_100337679 3300005719 Bacteria 1317
130 Ga0068861_100791224 3300005719 Unclassified 889
131 Ga0068851_10122512 3300005834 Bacteria 1399
132 Ga0068851_10168190 3300005834 Bacteria 1208
133 Ga0068851_10312015 3300005834 Bacteria 907
134 Ga0068863_100010664 3300005841 Bacteria 8921
135 Ga0068863_100363032 3300005841 Bacteria 1412
136 Ga0068863_100875889 3300005841 Bacteria 898
137 Ga0068858_100061881 3300005842 Unclassified 3461
138 Ga0068858_100216383 3300005842 Bacteria 1814
139 Ga0068858_100460852 3300005842 Unclassified 1226
140 Ga0068860_100007998 3300005843 Bacteria 10541
141 Ga0068860_100095943 3300005843 Bacteria 2827
142 Ga0068860_100153932 3300005843 Bacteria 2215
143 Ga0068860_100368546 3300005843 Bacteria 1416
144 Ga0068860_100519264 3300005843 Bacteria 1191
145 Ga0068862_100020453 3300005844 Bacteria 5530
146 Ga0068862_100081074 3300005844 Bacteria 2815
147 Ga0097621_100048454 3300006237 Bacteria 3447
148 Ga0097621_100076230 3300006237 Bacteria 2781
149 Ga0097621_100371224 3300006237 Bacteria 1276
150 Ga0097621_100835722 3300006237 Bacteria 855
151 Ga0068871_100011151 3300006358 Bacteria 6590
152 Ga0068871_100086344 3300006358 Bacteria 2607
153 Ga0068871_100097557 3300006358 Bacteria 2457
154 Ga0068871_100229998 3300006358 Unclassified 1609
155 Ga0075428_100055659 3300006844 Bacteria 4334
156 Ga0075428_100118070 3300006844 Bacteria 2889
157 Ga0075428_100164301 3300006844 Bacteria 2408
158 Ga0075428_100355074 3300006844 Bacteria 1573
159 Ga0075428_100626649 3300006844 Bacteria 1148
160 Ga0075430_100010460 3300006846 Bacteria 7856
161 Ga0075430_100148975 3300006846 Bacteria 1949
162 Ga0075431_100018368 3300006847 Bacteria 7121
163 Ga0075431_100584340 3300006847 Unclassified 1102
164 Ga0075429_100036206 3300006880 Bacteria 4292
165 Ga0075429_100986679 3300006880 Bacteria 736
166 Ga0068865_100025614 3300006881 Bacteria 3882
167 Ga0068865_100074846 3300006881 Bacteria 2413
168 Ga0068865_100342749 3300006881 Bacteria 1208
169 Ga0068865_100778601 3300006881 Unclassified 824
170 Ga0097620_100029580 3300006931 Bacteria 5497
171 Ga0097620_100036518 3300006931 Bacteria 4933
172 Ga0097620_100041583 3300006931 Bacteria 4616
173 Ga0097620_100072194 3300006931 Bacteria 3488
174 Ga0097620_100086962 3300006931 Bacteria 3173
175 Ga0097620_100124085 3300006931 Bacteria 2650
176 Ga0097620_100367733 3300006931 Bacteria 1533
177 Ga0097620_101546105 3300006931 Unclassified 732
178 Ga0111539_11031223 3300009094 Bacteria 956
179 Ga0105247_10001775 3300009101 Bacteria 15179
180 Ga0114129_10173502 3300009147 Bacteria 2938
181 Ga0105243_10343673 3300009148 Unclassified 1368
182 Ga0105241_10563279 3300009174 Unclassified 1025
183 Ga0105241_10889451 3300009174 Bacteria 826
184 Ga0105241_11160170 3300009174 Unclassified 730
185 Ga0105242_10012485 3300009176 Bacteria 6541
186 Ga0105242_10047456 3300009176 Bacteria 3487
187 Ga0105242_10055338 3300009176 Bacteria 3245
188 Ga0105242_10059110 3300009176 Bacteria 3144
189 Ga0105242_10630585 3300009176 Bacteria 1040
190 Ga0105238_11310126 3300009551 Unclassified 750
191 Ga0105249_10046549 3300009553 Bacteria 3947
192 Ga0105249_10127459 3300009553 Bacteria 2425
193 Ga0105249_10309987 3300009553 Bacteria 1586
194 Ga0105249_10636670 3300009553 Bacteria 1123
195 Ga0105249_10643176 3300009553 Unclassified 1118
196 Ga0105249_11982578 3300009553 Bacteria 655
197 Ga0105246_10075900 3300011119 Bacteria 2381
198 Ga0105246_10328293 3300011119 Bacteria 1246
199 Ga0105246_10339120 3300011119 Unclassified 1228
200 Ga0157373_10060269 3300013100 Bacteria 2689
201 Ga0157373_10698830 3300013100 Unclassified 743
202 Ga0157371_10054267 3300013102 Bacteria 2846
203 Ga0157371_10148973 3300013102 Unclassified 1668
204 Ga0157369_10093279 3300013105 Bacteria 3214
205 Ga0157374_10352352 3300013296 Bacteria 1463
206 Ga0157374_10912475 3300013296 Bacteria 896
207 Ga0157378_10039712 3300013297 Bacteria 4175
208 Ga0157378_10273996 3300013297 Unclassified 1624
209 Ga0163162_10003499 3300013306 Bacteria 15012
210 Ga0163162_10045040 3300013306 Bacteria 4420
211 Ga0163162_10210732 3300013306 Bacteria 2073
212 Ga0163162_10471292 3300013306 Bacteria 1387
213 Ga0157372_10042163 3300013307 Bacteria 5046
214 Ga0157372_10156083 3300013307 Bacteria 2636
215 Ga0157372_10356056 3300013307 Bacteria 1705
216 Ga0157372_10459677 3300013307 Bacteria 1484
217 Ga0157372_11192247 3300013307 Unclassified 880
218 Ga0157372_11409033 3300013307 Bacteria 803
219 Ga0157375_10021567 3300013308 Bacteria 5910
220 Ga0157375_10073055 3300013308 Unclassified 3448
221 Ga0157375_10077152 3300013308 Bacteria 3361
222 Ga0157375_10484556 3300013308 Bacteria 1402
223 Ga0157375_11923884 3300013308 Bacteria 702
224 Ga0163163_10000858 3300014325 Bacteria 25873
225 Ga0163163_10023042 3300014325 Bacteria 5905
226 Ga0163163_10043069 3300014325 Bacteria 4424
227 Ga0163163_10062728 3300014325 Bacteria 3683
228 Ga0163163_10291925 3300014325 Bacteria 1683
229 Ga0163163_10961295 3300014325 Unclassified 917
230 Ga0157380_10016227 3300014326 Bacteria 5488
231 Ga0157380_10365510 3300014326 Bacteria 1356
232 Ga0157380_10849739 3300014326 Bacteria 934
233 Ga0157377_10004365 3300014745 Bacteria 6500
234 Ga0157377_10227710 3300014745 Bacteria 1197
235 Ga0157377_10492289 3300014745 Bacteria 855
236 Ga0157379_10034170 3300014968 Bacteria 4532
237 Ga0157379_10092915 3300014968 Bacteria 2706
238 Ga0157379_10096257 3300014968 Bacteria 2657
239 Ga0157379_10346479 3300014968 Bacteria 1359
240 Ga0157379_10722982 3300014968 Bacteria 936
241 Ga0157376_10062543 3300014969 Bacteria 3132
242 Ga0157376_10077143 3300014969 Bacteria 2849
243 Ga0157376_10201234 3300014969 Bacteria 1833
244 Ga0182007_10186050 3300015262 Bacteria 720
245 Ga0163161_10049531 3300017792 Bacteria 3036
246 Ga0163161_10292303 3300017792 Bacteria 1281
247 Ga0207697_10025833 3300025315 Bacteria 2401
248 Ga0207682_10007981 3300025893 Bacteria 4203
249 Ga0207682_10015276 3300025893 Bacteria 2988
250 Ga0207682_10117335 3300025893 Bacteria 1177
251 Ga0207642_10450983 3300025899 Unclassified 779
252 Ga0207710_10001595 3300025900 Bacteria 11111
253 Ga0207710_10453561 3300025900 Bacteria 662
254 Ga0207688_10007812 3300025901 Bacteria 5820
255 Ga0207688_10172845 3300025901 Bacteria 1285
256 Ga0207680_10046999 3300025903 Bacteria 2555
257 Ga0207647_10000040 3300025904 Bacteria 93526
258 Ga0207645_10000357 3300025907 Bacteria 37837
259 Ga0207645_10005620 3300025907 Bacteria 9063
260 Ga0207645_10077242 3300025907 Bacteria 2133
261 Ga0207643_10016138 3300025908 Bacteria 4071
262 Ga0207705_10585453 3300025909 Bacteria 867
263 Ga0207654_10486581 3300025911 Bacteria 870
264 Ga0207662_10165338 3300025918 Bacteria 1416
265 Ga0207662_10277335 3300025918 Bacteria 1108
266 Ga0207657_10073251 3300025919 Bacteria 2895
267 Ga0207657_10179297 3300025919 Bacteria 1713
268 Ga0207649_10001251 3300025920 Bacteria 15197
269 Ga0207649_10140625 3300025920 Bacteria 1651
270 Ga0207649_10215422 3300025920 Bacteria 1365
271 Ga0207649_10216352 3300025920 Bacteria 1362
272 Ga0207649_10303308 3300025920 Bacteria 1168
273 Ga0207649_10306245 3300025920 Unclassified 1163
274 Ga0207649_10716402 3300025920 Bacteria 777
275 Ga0207649_10833995 3300025920 Unclassified 721
276 Ga0207681_10590252 3300025923 Bacteria 917
277 Ga0207681_10893136 3300025923 Bacteria 744
278 Ga0207650_10004039 3300025925 Bacteria 10031
279 Ga0207650_10198648 3300025925 Unclassified 1605
280 Ga0207650_10235179 3300025925 Archaea 1479
281 Ga0207650_10401702 3300025925 Bacteria 1134
282 Ga0207659_10250787 3300025926 Bacteria 1436
283 Ga0207659_10302689 3300025926 Bacteria 1314
284 Ga0207659_10337101 3300025926 Bacteria 1248
285 Ga0207659_10888755 3300025926 Unclassified 766
286 Ga0207644_10092374 3300025931 Bacteria 2258
287 Ga0207644_10458865 3300025931 Bacteria 1047
288 Ga0207644_11149655 3300025931 Unclassified 652
289 Ga0207690_10003517 3300025932 Bacteria 9333
290 Ga0207690_10041989 3300025932 Bacteria 3001
291 Ga0207690_10072285 3300025932 Bacteria 2382
292 Ga0207706_10017070 3300025933 Bacteria 6546
293 Ga0207706_10049249 3300025933 Bacteria 3724
294 Ga0207706_10743183 3300025933 Bacteria 836
295 Ga0207686_10034496 3300025934 Bacteria 3028
296 Ga0207686_10078878 3300025934 Bacteria 2142
297 Ga0207670_10035150 3300025936 Bacteria 3247
298 Ga0207670_10088322 3300025936 Bacteria 2186
299 Ga0207670_10322727 3300025936 Unclassified 1215
300 Ga0207670_10440173 3300025936 Bacteria 1049
301 Ga0207670_11130794 3300025936 Unclassified 662
302 Ga0207704_10947700 3300025938 Bacteria 726
303 Ga0207704_11028750 3300025938 Bacteria 698
304 Ga0207704_11281298 3300025938 Unclassified 626
305 Ga0207691_10014046 3300025940 Bacteria 7641
306 Ga0207691_10018595 3300025940 Bacteria 6586
307 Ga0207691_10226145 3300025940 Bacteria 1621
308 Ga0207691_10628124 3300025940 Bacteria 908
309 Ga0207689_10001227 3300025942 Bacteria 24647
310 Ga0207689_10001306 3300025942 Bacteria 24017
311 Ga0207689_10002424 3300025942 Bacteria 17357
312 Ga0207689_10030457 3300025942 Bacteria 4496
313 Ga0207689_10053140 3300025942 Bacteria 3338
314 Ga0207689_10117417 3300025942 Bacteria 2187
315 Ga0207689_10175531 3300025942 Bacteria 1767
316 Ga0207689_10270731 3300025942 Bacteria 1406
317 Ga0207661_10002324 3300025944 Bacteria 13098
318 Ga0207661_10009635 3300025944 Bacteria 6935
319 Ga0207661_10081025 3300025944 Bacteria 2680
320 Ga0207661_10575413 3300025944 Bacteria 1033
321 Ga0207661_10598316 3300025944 Bacteria 1012
322 Ga0207679_10000304 3300025945 Bacteria 36952
323 Ga0207679_10010575 3300025945 Bacteria 5946
324 Ga0207679_10033687 3300025945 Unclassified 3607
325 Ga0207679_10323770 3300025945 Bacteria 1335
326 Ga0207651_10112237 3300025960 Unclassified 2049
327 Ga0207651_10278221 3300025960 Bacteria 1382
328 Ga0207712_10002944 3300025961 Bacteria 10879
329 Ga0207712_10074818 3300025961 Bacteria 2446
330 Ga0207712_10101918 3300025961 Bacteria 2136
331 Ga0207712_10245639 3300025961 Bacteria 1444
332 Ga0207668_10209673 3300025972 Bacteria 1557
333 Ga0207640_10067893 3300025981 Bacteria 2387
334 Ga0207658_10027332 3300025986 Bacteria 4007
335 Ga0207658_10146206 3300025986 Bacteria 1920
336 Ga0207658_10352766 3300025986 Bacteria 1281
337 Ga0207677_10010678 3300026023 Bacteria 5203
338 Ga0207677_10283130 3300026023 Bacteria 1362
339 Ga0207677_11059602 3300026023 Bacteria 737
340 Ga0207703_10207092 3300026035 Bacteria 1746
341 Ga0207703_11315011 3300026035 Bacteria 695
342 Ga0207639_10016737 3300026041 Bacteria 5194
343 Ga0207639_10116047 3300026041 Bacteria 2191
344 Ga0207639_10694935 3300026041 Bacteria 943
345 Ga0207639_10975558 3300026041 Bacteria 793
346 Ga0207678_10041544 3300026067 Bacteria 3987
347 Ga0207678_10517509 3300026067 Bacteria 1041
348 Ga0207641_10004126 3300026088 Bacteria 12658
349 Ga0207641_10104343 3300026088 Bacteria 2502
350 Ga0207641_10301920 3300026088 Bacteria 1513
351 Ga0207648_10006587 3300026089 Bacteria 11528
352 Ga0207648_10037731 3300026089 Bacteria 4255
353 Ga0207648_10054588 3300026089 Bacteria 3489
354 Ga0207648_10098381 3300026089 Bacteria 2561
355 Ga0207676_10005907 3300026095 Bacteria 8647
356 Ga0207676_10029293 3300026095 Bacteria 4120
357 Ga0207676_10067801 3300026095 Bacteria 2851
358 Ga0207676_10116384 3300026095 Bacteria 2246
359 Ga0207676_11082598 3300026095 Bacteria 792
360 Ga0207674_10004112 3300026116 Bacteria 17616
361 Ga0207674_10005133 3300026116 Bacteria 15625
362 Ga0207674_10083621 3300026116 Bacteria 3191
363 Ga0207675_100001811 3300026118 Bacteria 21421
364 Ga0207675_100033833 3300026118 Unclassified 4763
365 Ga0207675_100070734 3300026118 Bacteria 3261
366 Ga0207675_100209597 3300026118 Bacteria 1874
367 Ga0207683_10000651 3300026121 Bacteria 31796
368 Ga0207698_10013280 3300026142 Bacteria 5427
369 Ga0207698_10917269 3300026142 Bacteria 884
370 Ga0207698_11423761 3300026142 Bacteria 708
371 Ga0209995_1010312 3300027471 Unclassified 1514
372 Ga0209968_1014439 3300027526 Unclassified 1243
373 Ga0209974_10020830 3300027876 Bacteria 2173
374 Ga0207428_10478421 3300027907 Unclassified 906
375 Ga0207428_10657687 3300027907 Bacteria 752
376 Ga0268266_10058290 3300028379 Bacteria 3325
377 Ga0268266_10323222 3300028379 Bacteria 1444
378 Ga0268265_10487619 3300028380 Bacteria 1159
379 Ga0268264_10009709 3300028381 Bacteria 7968
380 Ga0268264_10049739 3300028381 Bacteria 3488
381 Ga0268264_10178316 3300028381 Bacteria 1927
382 Ga0268264_10654099 3300028381 Unclassified 1040
383 Ga0268264_10762220 3300028381 Bacteria 965
384 Ga0307410_10122293 3300031852 Bacteria 1900
385 Ga0307406_10288436 3300031901 Bacteria 1255
386 Ga0307414_10202187 3300032004 Unclassified 1617
387 Ga0307414_10536966 3300032004 Bacteria 1040
388 Ga0373934_0017619 3300035086 Unclassified 2729
389 Ga0373956_0189798 3300035119 Bacteria 973
390 Ga0373955_0002268 3300035172 Bacteria 8345
391 Ga0373924_0009777 3300035410 Bacteria 3524
392 Ga0373933_0034528 3300035724 Bacteria 2947
393 Ga0373947_0297883 3300035725 Bacteria 1075
394 Ga0373937_0002819 3300036401 Bacteria 14528
395 Ga0373937_0091169 3300036401 Bacteria 2824
396 Ga0395905_0002863 3300037471 Bacteria 18845
397 Ga0395901_0596112 3300038443 Bacteria 1115
398 Ga0451789_1301606 3300041443 Unclassified 1008
399 Ga0451793_1396517 3300041452 Bacteria 903
400 Ga0451807_0215022 3300041486 Bacteria 1236
401 Ga0439431_0045880 3300041997 Bacteria 1123
402 Ga0439445_0053873 3300042004 Bacteria 1090
403 Ga0439445_0088242 3300042004 Bacteria 872
404 Ga0439445_0094240 3300042004 Bacteria 845
405 Ga0439432_042973 3300042006 Bacteria 1428
406 Ga0439449_0015063 3300042007 Bacteria 2906
407 Ga0439449_0066968 3300042007 Bacteria 1325
408 Ga0439446_0098886 3300042156 Bacteria 921
409 Ga0439435_0038402 3300042436 Bacteria 1331
410 Ga0439460_0155312 3300042461 Unclassified 765
411 Ga0451577_0226641 3300042876 Bacteria 1690
412 Ga0451577_0590327 3300042876 Unclassified 1008
413 Ga0453683_0056859 3300044673 Bacteria 2448
414 Ga0453683_0583833 3300044673 Unclassified 728
415 Ga0453684_0059826 3300044712 Bacteria 4907
416 Ga0453684_0168762 3300044712 Unclassified 2581
417 Ga0466959_0318529 3300045049 Bacteria 1063
418 Ga0451576_0166333 3300045051 Unclassified 2302
419 Ga0466967_0689642 3300045976 Unclassified 1011
420 Ga0495629_0376285 3300046459 Bacteria 967
421 Ga0495608_0084170 3300046511 Bacteria 2064
422 Ga0495618_0178712 3300046514 Bacteria 1349
423 Ga0495630_0003764 3300046517 Bacteria 10592
424 Ga0495643_0112976 3300046522 Unclassified 1379
425 Ga0495598_0113638 3300046537 Bacteria 910
426 Ga0495667_0449419 3300046559 Bacteria 810
427 Ga0495634_0031410 3300046642 Unclassified 3659
428 Ga0495625_0212506 3300046660 Bacteria 1271
429 Ga0495635_0085707 3300046663 Bacteria 2155
430 Ga0495674_0393901 3300047319 Bacteria 1119
431 Ga0495672_0008804 3300047320 Bacteria 7390
432 Ga0495672_0028970 3300047320 Bacteria 3494
433 Ga0495675_0172287 3300047444 Bacteria 1329
434 Ga0495686_0252956 3300047472 Bacteria 989
435 Ga0496109_0136900 3300048912 Bacteria 2289
436 Ga0496110_0031614 3300048913 Bacteria 4568
437 Ga0501296_011769 3300049519 Bacteria 1050
438 Ga0501298_015102 3300049521 Bacteria 1387
439 Ga0501031_0014556 3300049568 Bacteria 5115
440 Ga0501031_0313316 3300049568 Unclassified 1017
441 Ga0501032_0003107 3300049569 Bacteria 12808
442 Ga0501032_0299184 3300049569 Bacteria 1040
443 Ga0501036_0008754 3300049572 Bacteria 8306
444 Ga0501037_0011108 3300049573 Bacteria 6627
445 Ga0501038_0006357 3300049574 Bacteria 10936
446 Ga0501038_0017336 3300049574 Bacteria 6510
447 Ga0501039_0009186 3300049575 Bacteria 7533
448 Ga0501043_0017549 3300049579 Bacteria 5611
449 Ga0501043_0063173 3300049579 Unclassified 2907
450 Ga0501046_0004991 3300049580 Bacteria 11916
451 Ga0501046_0015510 3300049580 Bacteria 6401
452 Ga0501047_0046456 3300049581 Bacteria 4196
453 Ga0501047_0173182 3300049581 Bacteria 2027
454 Ga0501067_0030034 3300049583 Bacteria 3013
455 Ga0501068_0087629 3300049584 Unclassified 1917
456 Ga0501070_0020630 3300049586 Bacteria 5527
457 Ga0501073_0001997 3300049589 Bacteria 15220
458 Ga0501074_0000538 3300049590 Bacteria 23300
459 Ga0501201_000100 3300049651 Bacteria 6743
460 Ga0501202_000380 3300049652 Bacteria 6154
461 Ga0501206_004130 3300049653 Bacteria 1844
462 Ga0501207_005484 3300049654 Bacteria 1758
463 Ga0501217_004364 3300049661 Bacteria 2901
464 Ga0501222_005605 3300049662 Bacteria 1690
465 Ga0501223_006139 3300049663 Bacteria 2497
466 Ga0501224_000179 3300049664 Bacteria 7113
467 Ga0501230_023731 3300049667 Bacteria 1094
468 Ga0501235_001483 3300049669 Bacteria 5022
469 Ga0501240_049148 3300049673 Bacteria 720
470 Ga0501243_009624 3300049675 Bacteria 1502
471 Ga0501249_097183 3300049679 Unclassified 703
472 Ga0501253_036629 3300049683 Bacteria 967
473 Ga0501256_003916 3300049685 Bacteria 1259
474 Ga0501257_034275 3300049686 Bacteria 1232
475 Ga0501259_000852 3300049688 Bacteria 5013
476 Ga0501259_004603 3300049688 Bacteria 2190
477 Ga0501261_001224 3300049690 Bacteria 3153
478 Ga0501221_008926 3300049704 Bacteria 1751
479 Ga0501225_0021375 3300049705 Bacteria 1787
480 Ga0501234_004024 3300049707 Bacteria 2308
481 Ga0501234_050506 3300049707 Bacteria 692
482 Ga0501245_002355 3300049708 Bacteria 2521
483 Ga0501245_004514 3300049708 Bacteria 1912
484 Ga0501083_0027369 3300049744 Bacteria 3934
485 Ga0501083_0056553 3300049744 Bacteria 2629
486 Ga0501232_000420 3300049757 Bacteria 2802
487 Ga0501241_014478 3300049758 Bacteria 1432
488 Ga0501266_004682 3300049763 Bacteria 1699
489 Ga0501267_006863 3300049764 Bacteria 1099
490 Ga0501268_005214 3300049765 Bacteria 1861
491 Ga0501268_082211 3300049765 Bacteria 667
492 Ga0501270_011637 3300049767 Bacteria 1184
493 Ga0501279_007695 3300049775 Bacteria 1430
494 Ga0501035_0003691 3300049822 Bacteria 14592
495 Ga0501035_0011102 3300049822 Bacteria 8341
496 Ga0501044_0010522 3300049823 Bacteria 10039
497 Ga0501044_0038310 3300049823 Bacteria 5006
498 Ga0501045_0215591 3300049824 Bacteria 1429
499 Ga0501212_005504 3300049851 Bacteria 1673
500 nmdc:mga09592_15552_c1 3300050508 Bacteria 6219
501 nmdc:mga0qj67_148965_c1 3300050509 Unclassified 1898
502 nmdc:mga0qj67_376750_c1 3300050509 Unclassified 1146
503 nmdc:mga0qj67_7556_c1 3300050509 Bacteria 8034
504 nmdc:mga06r32_304335_c1 3300050510 Bacteria 1580
505 nmdc:mga08y16_1301200_c1 3300050511 Bacteria 694
506 nmdc:mga08y16_95702_c1 3300050511 Bacteria 3093
507 nmdc:mga0n895_196207_c1 3300050512 Bacteria 2050
508 Ga0495619_0155911 3300053085 Unclassified 1576
509 Ga0500568_0001088 3300053139 Bacteria 18287
510 Ga0500611_000008 3300053727 Bacteria 198346
511 Ga0268265_10984775
512 ARcpr5yngRDRAFT_c008188
513 ARSoilOldRDRAFT_c008055
514 Ga0065712_10239420
515 Ga0070676_10925151
516 Ga0070683_100010830
517 Ga0070683_100180789
518 Ga0070683_100472122
519 Ga0070690_100161408
520 Ga0070670_100125290
521 Ga0070670_100332363
522 Ga0070670_100373877
523 Ga0070677_10003429
524 Ga0070677_10204025
525 Ga0068869_100002336
526 Ga0068869_100005420
527 Ga0068869_100015414
528 Ga0068869_100072957
529 Ga0068869_100076319
530 Ga0068869_100264173
531 Ga0068869_100540176
532 Ga0070666_10014254
533 Ga0068868_100002287
534 Ga0068868_100005303
535 Ga0068868_100343681
536 Ga0070660_100040458
537 Ga0070660_100593296
538 Ga0070689_100003896
539 Ga0070689_100090837
540 Ga0070689_100195329
541 Ga0070689_100442874
542 Ga0070691_10137504
543 Ga0070661_100001257
544 Ga0070661_100001981
545 Ga0070661_100343499
546 Ga0070661_100344682
547 Ga0070661_100589957
548 Ga0070661_100845341
549 Ga0070668_100032720
550 Ga0070668_100123207
551 Ga0070668_100365131
552 Ga0070669_100066640
553 Ga0070675_100071215
554 Ga0070675_100092395
555 Ga0070675_100098987
556 Ga0070675_100372311
557 Ga0070675_100705921
558 Ga0070671_100061899
559 Ga0070671_100249700
560 Ga0070671_100309866
561 Ga0070671_100327906
562 Ga0070671_100394163
563 Ga0070671_100669100
564 Ga0070674_100186381
565 Ga0070674_100670479
566 Ga0070673_100143155
567 Ga0070673_100395472
568 Ga0070673_101026405
569 Ga0070688_100026399
570 Ga0070688_100043754
571 Ga0070688_100082924
572 Ga0070659_100004169
573 Ga0070659_100032061
574 Ga0070667_100007776
575 Ga0070667_100014267
576 Ga0070667_100065695
577 Ga0070667_100113790
578 Ga0070667_100817986
579 Ga0070694_100902539
580 Ga0070663_100272796
581 Ga0070678_100002325
582 Ga0070662_100017002
583 Ga0070662_100017707
584 Ga0070662_100098102
585 Ga0068867_100031445
586 Ga0068867_100170703
587 Ga0070685_10019831
588 Ga0070698_100001781
589 Ga0070698_100041436
590 Ga0070684_100000042
591 Ga0070684_100011749
592 Ga0070684_100192726
593 Ga0070684_101312877
594 Ga0068853_100008513
595 Ga0068853_100011907
596 Ga0068853_100561098
597 Ga0068853_100857623
598 Ga0068853_100992631
599 Ga0068853_101491647
600 Ga0070672_100041133
601 Ga0070672_100085120
602 Ga0070672_100101040
603 Ga0070672_100250257
604 Ga0070672_100771431
605 Ga0070672_100986283
606 Ga0070686_100610265
607 Ga0070665_100326615
608 Ga0070704_100775905
609 Ga0070664_100000266
610 Ga0070664_100072304
611 Ga0070664_100126246
612 Ga0070664_100144875
613 Ga0070664_100165214
614 Ga0070664_100650146
615 Ga0068857_100007376
616 Ga0068857_100010552
617 Ga0068857_100076601
618 Ga0068857_101259020
619 Ga0068854_100067225
620 Ga0068854_100538208
621 Ga0068856_100192689
622 Ga0068852_100005933
623 Ga0068852_100074638
624 Ga0068852_100740549
625 Ga0068859_100029578
626 Ga0068859_100036517
627 Ga0068859_100072191
628 Ga0068859_100086967
629 Ga0068859_100124085
630 Ga0068859_100367716
631 Ga0068859_101546123
632 Ga0068864_100049507
633 Ga0068864_100070453
634 Ga0068864_100077367
635 Ga0068864_100121113
636 Ga0068866_10063514
637 Ga0068866_10097835
638 Ga0068861_100019988
639 Ga0068861_100337679
640 Ga0068861_100791224
641 Ga0068851_10122512
642 Ga0068851_10168190
643 Ga0068851_10312015
644 Ga0068863_100010664
645 Ga0068863_100363032
646 Ga0068863_100875889
647 Ga0068858_100061881
648 Ga0068858_100216383
649 Ga0068858_100460852
650 Ga0068860_100007998
651 Ga0068860_100095943
652 Ga0068860_100153932
653 Ga0068860_100368546
654 Ga0068860_100519264
655 Ga0068862_100020453
656 Ga0068862_100081074
657 Ga0097621_100048454
658 Ga0097621_100076230
659 Ga0097621_100371224
660 Ga0097621_100835722
661 Ga0068871_100011151
662 Ga0068871_100086344
663 Ga0068871_100097557
664 Ga0068871_100229998
665 Ga0075428_100055659
666 Ga0075428_100118070
667 Ga0075428_100164301
668 Ga0075428_100355074
669 Ga0075428_100626649
670 Ga0075430_100010460
671 Ga0075430_100148975
672 Ga0075431_100018368
673 Ga0075431_100584340
674 Ga0075429_100036206
675 Ga0075429_100986679
676 Ga0068865_100025614
677 Ga0068865_100074846
678 Ga0068865_100342749
679 Ga0068865_100778601
680 Ga0097620_100029580
681 Ga0097620_100036518
682 Ga0097620_100041583
683 Ga0097620_100072194
684 Ga0097620_100086962
685 Ga0097620_100124085
686 Ga0097620_100367733
687 Ga0097620_101546105
688 Ga0111539_11031223
689 Ga0105247_10001775
690 Ga0114129_10173502
691 Ga0105243_10343673
692 Ga0105241_10563279
693 Ga0105241_10889451
694 Ga0105241_11160170
695 Ga0105242_10012485
696 Ga0105242_10047456
697 Ga0105242_10055338
698 Ga0105242_10059110
699 Ga0105242_10630585
700 Ga0105238_11310126
701 Ga0105249_10046549
702 Ga0105249_10127459
703 Ga0105249_10309987
704 Ga0105249_10636670
705 Ga0105249_10643176
706 Ga0105249_11982578
707 Ga0105246_10075900
708 Ga0105246_10328293
709 Ga0105246_10339120
710 Ga0157373_10060269
711 Ga0157373_10698830
712 Ga0157371_10054267
713 Ga0157371_10148973
714 Ga0157369_10093279
715 Ga0157374_10352352
716 Ga0157374_10912475
717 Ga0157378_10039712
718 Ga0157378_10273996
719 Ga0163162_10003499
720 Ga0163162_10045040
721 Ga0163162_10210732
722 Ga0163162_10471292
723 Ga0157372_10042163
724 Ga0157372_10156083
725 Ga0157372_10356056
726 Ga0157372_10459677
727 Ga0157372_11192247
728 Ga0157372_11409033
729 Ga0157375_10021567
730 Ga0157375_10073055
731 Ga0157375_10077152
732 Ga0157375_10484556
733 Ga0157375_11923884
734 Ga0163163_10000858
735 Ga0163163_10023042
736 Ga0163163_10043069
737 Ga0163163_10062728
738 Ga0163163_10291925
739 Ga0163163_10961295
740 Ga0157380_10016227
741 Ga0157380_10365510
742 Ga0157380_10849739
743 Ga0157377_10004365
744 Ga0157377_10227710
745 Ga0157377_10492289
746 Ga0157379_10034170
747 Ga0157379_10092915
748 Ga0157379_10096257
749 Ga0157379_10346479
750 Ga0157379_10722982
751 Ga0157376_10062543
752 Ga0157376_10077143
753 Ga0157376_10201234
754 Ga0182007_10186050
755 Ga0163161_10049531
756 Ga0163161_10292303
757 Ga0207697_10025833
758 Ga0207682_10007981
759 Ga0207682_10015276
760 Ga0207682_10117335
761 Ga0207642_10450983
762 Ga0207710_10001595
763 Ga0207710_10453561
764 Ga0207688_10007812
765 Ga0207688_10172845
766 Ga0207680_10046999
767 Ga0207647_10000040
768 Ga0207645_10000357
769 Ga0207645_10005620
770 Ga0207645_10077242
771 Ga0207643_10016138
772 Ga0207705_10585453
773 Ga0207654_10486581
774 Ga0207662_10165338
775 Ga0207662_10277335
776 Ga0207657_10073251
777 Ga0207657_10179297
778 Ga0207649_10001251
779 Ga0207649_10140625
780 Ga0207649_10215422
781 Ga0207649_10216352
782 Ga0207649_10303308
783 Ga0207649_10306245
784 Ga0207649_10716402
785 Ga0207649_10833995
786 Ga0207681_10590252
787 Ga0207681_10893136
788 Ga0207650_10004039
789 Ga0207650_10198648
790 Ga0207650_10235179
791 Ga0207650_10401702
792 Ga0207659_10250787
793 Ga0207659_10302689
794 Ga0207659_10337101
795 Ga0207659_10888755
796 Ga0207644_10092374
797 Ga0207644_10458865
798 Ga0207644_11149655
799 Ga0207690_10003517
800 Ga0207690_10041989
801 Ga0207690_10072285
802 Ga0207706_10017070
803 Ga0207706_10049249
804 Ga0207706_10743183
805 Ga0207686_10034496
806 Ga0207686_10078878
807 Ga0207670_10035150
808 Ga0207670_10088322
809 Ga0207670_10322727
810 Ga0207670_10440173
811 Ga0207670_11130794
812 Ga0207704_10947700
813 Ga0207704_11028750
814 Ga0207704_11281298
815 Ga0207691_10014046
816 Ga0207691_10018595
817 Ga0207691_10226145
818 Ga0207691_10628124
819 Ga0207689_10001227
820 Ga0207689_10001306
821 Ga0207689_10002424
822 Ga0207689_10030457
823 Ga0207689_10053140
824 Ga0207689_10117417
825 Ga0207689_10175531
826 Ga0207689_10270731
827 Ga0207661_10002324
828 Ga0207661_10009635
829 Ga0207661_10081025
830 Ga0207661_10575413
831 Ga0207661_10598316
832 Ga0207679_10000304
833 Ga0207679_10010575
834 Ga0207679_10033687
835 Ga0207679_10323770
836 Ga0207651_10112237
837 Ga0207651_10278221
838 Ga0207712_10002944
839 Ga0207712_10074818
840 Ga0207712_10101918
841 Ga0207712_10245639
842 Ga0207668_10209673
843 Ga0207640_10067893
844 Ga0207658_10027332
845 Ga0207658_10146206
846 Ga0207658_10352766
847 Ga0207677_10010678
848 Ga0207677_10283130
849 Ga0207677_11059602
850 Ga0207703_10207092
851 Ga0207703_11315011
852 Ga0207639_10016737
853 Ga0207639_10116047
854 Ga0207639_10694935
855 Ga0207639_10975558
856 Ga0207678_10041544
857 Ga0207678_10517509
858 Ga0207641_10004126
859 Ga0207641_10104343
860 Ga0207641_10301920
861 Ga0207648_10006587
862 Ga0207648_10037731
863 Ga0207648_10054588
864 Ga0207648_10098381
865 Ga0207676_10005907
866 Ga0207676_10029293
867 Ga0207676_10067801
868 Ga0207676_10116384
869 Ga0207676_11082598
870 Ga0207674_10004112
871 Ga0207674_10005133
872 Ga0207674_10083621
873 Ga0207675_100001811
874 Ga0207675_100033833
875 Ga0207675_100070734
876 Ga0207675_100209597
877 Ga0207683_10000651
878 Ga0207698_10013280
879 Ga0207698_10917269
880 Ga0207698_11423761
881 Ga0209995_1010312
882 Ga0209968_1014439
883 Ga0209974_10020830
884 Ga0207428_10478421
885 Ga0207428_10657687
886 Ga0268266_10058290
887 Ga0268266_10323222
888 Ga0268265_10487619
889 Ga0268264_10009709
890 Ga0268264_10049739
891 Ga0268264_10178316
892 Ga0268264_10654099
893 Ga0268264_10762220
894 Ga0307410_10122293
895 Ga0307406_10288436
896 Ga0307414_10202187
897 Ga0307414_10536966
898 Ga0373934_0017619
899 Ga0373956_0189798
900 Ga0373955_0002268
901 Ga0373924_0009777
902 Ga0373933_0034528
903 Ga0373947_0297883
904 Ga0373937_0002819
905 Ga0373937_0091169
906 Ga0395905_0002863
907 Ga0395901_0596112
908 Ga0451789_1301606
909 Ga0451793_1396517
910 Ga0451807_0215022
911 Ga0439431_0045880
912 Ga0439445_0053873
913 Ga0439445_0088242
914 Ga0439445_0094240
915 Ga0439432_042973
916 Ga0439449_0015063
917 Ga0439449_0066968
918 Ga0439446_0098886
919 Ga0439435_0038402
920 Ga0439460_0155312
921 Ga0451577_0226641
922 Ga0451577_0590327
923 Ga0453683_0056859
924 Ga0453683_0583833
925 Ga0453684_0059826
926 Ga0453684_0168762
927 Ga0466959_0318529
928 Ga0451576_0166333
929 Ga0466967_0689642
930 Ga0495629_0376285
931 Ga0495608_0084170
932 Ga0495618_0178712
933 Ga0495630_0003764
934 Ga0495643_0112976
935 Ga0495598_0113638
936 Ga0495667_0449419
937 Ga0495634_0031410
938 Ga0495625_0212506
939 Ga0495635_0085707
940 Ga0495674_0393901
941 Ga0495672_0008804
942 Ga0495672_0028970
943 Ga0495675_0172287
944 Ga0495686_0252956
945 Ga0496109_0136900
946 Ga0496110_0031614
947 Ga0501296_011769
948 Ga0501298_015102
949 Ga0501031_0014556
950 Ga0501031_0313316
951 Ga0501032_0003107
952 Ga0501032_0299184
953 Ga0501036_0008754
954 Ga0501037_0011108
955 Ga0501038_0006357
956 Ga0501038_0017336
957 Ga0501039_0009186
958 Ga0501043_0017549
959 Ga0501043_0063173
960 Ga0501046_0004991
961 Ga0501046_0015510
962 Ga0501047_0046456
963 Ga0501047_0173182
964 Ga0501067_0030034
965 Ga0501068_0087629
966 Ga0501070_0020630
967 Ga0501073_0001997
968 Ga0501074_0000538
969 Ga0501201_000100
970 Ga0501202_000380
971 Ga0501206_004130
972 Ga0501207_005484
973 Ga0501217_004364
974 Ga0501222_005605
975 Ga0501223_006139
976 Ga0501224_000179
977 Ga0501230_023731
978 Ga0501235_001483
979 Ga0501240_049148
980 Ga0501243_009624
981 Ga0501249_097183
982 Ga0501253_036629
983 Ga0501256_003916
984 Ga0501257_034275
985 Ga0501259_000852
986 Ga0501259_004603
987 Ga0501261_001224
988 Ga0501221_008926
989 Ga0501225_0021375
990 Ga0501234_004024
991 Ga0501234_050506
992 Ga0501245_002355
993 Ga0501245_004514
994 Ga0501083_0027369
995 Ga0501083_0056553
996 Ga0501232_000420
997 Ga0501241_014478
998 Ga0501266_004682
999 Ga0501267_006863
1000 Ga0501268_005214
1001 Ga0501268_082211
1002 Ga0501270_011637
1003 Ga0501279_007695
1004 Ga0501035_0003691
1005 Ga0501035_0011102
1006 Ga0501044_0010522
1007 Ga0501044_0038310
1008 Ga0501045_0215591
1009 Ga0501212_005504
1010 nmdc:mga09592_15552_c1
1011 nmdc:mga0qj67_148965_c1
1012 nmdc:mga0qj67_376750_c1
1013 nmdc:mga0qj67_7556_c1
1014 nmdc:mga06r32_304335_c1
1015 nmdc:mga08y16_1301200_c1
1016 nmdc:mga08y16_95702_c1
1017 nmdc:mga0n895_196207_c1
1018 Ga0495619_0155911
1019 Ga0500568_0001088
1020 Ga0500611_000008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

45

179

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mtz-assembly1.cif.gz_A haddock model of bacillus subtilis l,d-transpeptidase in complex with a peptidoglycan hexamuropeptide 0.7919 47 187
7o21-assembly1.cif.gz_A structure of bdellovibrio bacteriovorus bd1075 0.7771 45 189
5bmq-assembly1.cif.gz_A crystal structure of l,d-transpeptidase (yku) from stackebrandtia nassauensis 0.7709 46 190
7o21-assembly1.cif.gz_B structure of bdellovibrio bacteriovorus bd1075 0.7695 45 190
4qrb-assembly1.cif.gz_A structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation 0.7671 46 190
ID Description Score Start End Superfamily
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.8397 45 190 2.40.440.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7923 45 190 2.40.440.10
2ychA03 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7599 46 69 3.30.420.40
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7349 47 190 2.40.440.10
4lpqA02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7075 45 189 2.40.440.10
ID Description Score Start End GO Terms
AF-A0A6P0NNP3-F1-model_v4 L,D-transpeptidase 0.9346 95 184 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A563W2V1-F1-model_v4 L,D-TPase catalytic domain-containing protein 0.9082 86 190 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A7C5HNA5-F1-model_v4 Murein L,D-transpeptidase 0.8987 46 190 GO:0008360
GO:0009252
GO:0016020
GO:0016740
GO:0071555
AF-A0A136NBJ5-F1-model_v4 ErfK/YbiS/YcfS/YnhG family protein 0.8985 86 190 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A1Z4T8D9-F1-model_v4 deleted 0.8978 95 184

Map