F457054

General Info

Members Datasets Scaffolds Average Seq Length
509 286 505 398

Family's Representative Sequence

Representative Sequence 3300053092|Ga0500583_0000042|Ga0500583_0000042_30865_32271
Length 468
Sequence MPHFAKKSANFLLYEGVLLPIDALQPATLNPKLVPTRRDKPQFRYDRVQILEILQFQINYFCGTKNYQLKISMQLSSRLQLFNEPETLKMAKLGRELRAKGIDVIDLSLGEPDFDTPEHIKEAAKKAIDDNFSHYTPVAGYPELREAVCTKLKRDNNLSYKPENIIASTGAKHSLANVVFATVSKGDEVVIPTPYWVTYSEIVKLGEGVVKLVSTSIENKYKLTPQQLEAALSDKTRLFIFSSPCNPSGSVYSKQELEGLAGVFRKFPNVYILSDEIYEYINFVGKHESIAQFEDLKDRVIVLNGLSKGFAMTGYRLGYIAASPEVVKACEKLQGQFTSGTNSITQRAAITALTTDLKPSLEMTKEFERRKKRVIEIMNGIEGLKFPEPDGAFYVFPTVTAFFGKSDGEETIKDADDLCMYLLNKAHVSTVTGRAFGEPTAIRISFANSMEKIEEAWKRIIAALAKLK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
5 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
6 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
152 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
179 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
199 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
242 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
243 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
244 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
245 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
246 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
247 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
248 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
249 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
250 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
251 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
252 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
253 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
254 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
255 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
256 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
257 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
258 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
259 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
263 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
264 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
268 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
273 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
274 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
275 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
276 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
277 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
278 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
279 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
280 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
281 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
282 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
283 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0.79
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 0.2
Rhizosphere 93.32
Stem 0
Stem Tuber 0
Unclassified 3.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1887178 2162886007 Bacteria 121938
2 MRS1b_contig_3767459 2162886011 Bacteria 1738
3 JGI24751J29686_10000860 3300002459 Bacteria 6999
4 rootH1_10145707 3300003316 Bacteria 1907
5 rootH2_10028215 3300003320 Bacteria 14081
6 rootH2_10040915 3300003320 Bacteria 17003
7 rootH1_10002414 3300003323 Bacteria 26587
8 Ga0065704_10070136 3300005289 Bacteria 560402
9 Ga0065712_10008552 3300005290 Bacteria 3558
10 Ga0065707_10005297 3300005295 Bacteria 2875
11 Ga0070676_10037268 3300005328 Bacteria 2804
12 Ga0070683_100015154 3300005329 Bacteria 6767
13 Ga0070690_100124352 3300005330 Bacteria 1735
14 Ga0070670_100098970 3300005331 Bacteria 2509
15 Ga0070677_10007114 3300005333 Bacteria 3728
16 Ga0068869_100006543 3300005334 Bacteria 7390
17 Ga0068869_100139763 3300005334 Bacteria 1869
18 Ga0070666_10197000 3300005335 Bacteria 1417
19 Ga0070682_100020945 3300005337 Bacteria 3853
20 Ga0068868_100090800 3300005338 Unclassified 2460
21 Ga0070660_100041423 3300005339 Bacteria 3511
22 Ga0070689_100019284 3300005340 Bacteria 5041
23 Ga0070689_100200381 3300005340 Bacteria 1630
24 Ga0070691_10004393 3300005341 Bacteria 6405
25 Ga0070691_10014565 3300005341 Unclassified 3609
26 Ga0070687_100048141 3300005343 Bacteria 2191
27 Ga0070687_100049704 3300005343 Bacteria 2162
28 Ga0070661_100010597 3300005344 Bacteria 6412
29 Ga0070661_100169319 3300005344 Bacteria 1658
30 Ga0070668_100014629 3300005347 Bacteria 5864
31 Ga0070668_100125294 3300005347 Bacteria 2057
32 Ga0070668_100129439 3300005347 Bacteria 2025
33 Ga0070668_100202102 3300005347 Bacteria 1631
34 Ga0070669_100025859 3300005353 Bacteria 4219
35 Ga0070669_100086674 3300005353 Bacteria 2340
36 Ga0070675_100035168 3300005354 Unclassified 4069
37 Ga0070675_100243578 3300005354 Bacteria 1571
38 Ga0070671_100001403 3300005355 Bacteria 17993
39 Ga0070671_100018804 3300005355 Bacteria 5616
40 Ga0070674_100036811 3300005356 Bacteria 3288
41 Ga0070673_100025202 3300005364 Unclassified 4373
42 Ga0070673_100082386 3300005364 Bacteria 2611
43 Ga0070673_100119326 3300005364 Bacteria 2197
44 Ga0070688_100001085 3300005365 Bacteria 13603
45 Ga0070688_100033192 3300005365 Unclassified 3118
46 Ga0070688_100091978 3300005365 Bacteria 1983
47 Ga0070667_100245479 3300005367 Bacteria 1600
48 Ga0070713_100091538 3300005436 Bacteria 2617
49 Ga0070708_100213033 3300005445 Bacteria 1810
50 Ga0070678_100076009 3300005456 Bacteria 2528
51 Ga0070678_100099909 3300005456 Bacteria 2246
52 Ga0070662_100029061 3300005457 Bacteria 3855
53 Ga0070662_100058517 3300005457 Bacteria 2805
54 Ga0070662_100122349 3300005457 Unclassified 1996
55 Ga0068867_100153288 3300005459 Bacteria 1812
56 Ga0070685_10032880 3300005466 Bacteria 2908
57 Ga0070685_10051461 3300005466 Unclassified 2381
58 Ga0070707_100052453 3300005468 Bacteria 3910
59 Ga0070679_100006080 3300005530 Bacteria 11230
60 Ga0068853_100003134 3300005539 Bacteria 12639
61 Ga0068853_100088478 3300005539 Bacteria 2719
62 Ga0068853_100094908 3300005539 Bacteria 2629
63 Ga0070672_100027883 3300005543 Unclassified 4217
64 Ga0070672_100072997 3300005543 Bacteria 2734
65 Ga0068855_100001225 3300005563 Bacteria 31850
66 Ga0068855_100005467 3300005563 Bacteria 15499
67 Ga0068855_100009366 3300005563 Bacteria 11826
68 Ga0068855_100044949 3300005563 Bacteria 5225
69 Ga0068855_100099025 3300005563 Bacteria 3358
70 Ga0070664_100017898 3300005564 Bacteria 5818
71 Ga0070664_100206832 3300005564 Bacteria 1753
72 Ga0070664_100231903 3300005564 Bacteria 1655
73 Ga0068857_100001841 3300005577 Bacteria 17068
74 Ga0068854_100173839 3300005578 Bacteria 1678
75 Ga0068856_100022841 3300005614 Bacteria 6084
76 Ga0068856_100120012 3300005614 Bacteria 2631
77 Ga0068856_100181466 3300005614 Unclassified 2118
78 Ga0068856_100301569 3300005614 Bacteria 1620
79 Ga0070702_100022600 3300005615 Bacteria 3328
80 Ga0068852_100000370 3300005616 Bacteria 30365
81 Ga0068852_100000882 3300005616 Bacteria 19855
82 Ga0068852_100152566 3300005616 Bacteria 2150
83 Ga0068859_100008213 3300005617 Bacteria 10591
84 Ga0068864_100015077 3300005618 Bacteria 6424
85 Ga0068861_100044275 3300005719 Bacteria 3346
86 Ga0068861_100183866 3300005719 Bacteria 1742
87 Ga0068870_10097153 3300005840 Bacteria 1657
88 Ga0068863_100092411 3300005841 Bacteria 2870
89 Ga0068863_100105692 3300005841 Unclassified 2678
90 Ga0068860_100003184 3300005843 Bacteria 16934
91 Ga0068860_100009277 3300005843 Bacteria 9778
92 Ga0068860_100028533 3300005843 Bacteria 5373
93 Ga0068860_100061298 3300005843 Bacteria 3574
94 Ga0068860_100267503 3300005843 Bacteria 1668
95 Ga0068862_100027789 3300005844 Bacteria 4764
96 Ga0081540_1009550 3300005983 Bacteria 6675
97 Ga0075366_10132995 3300006195 Bacteria 1502
98 Ga0068871_100002027 3300006358 Bacteria 13721
99 Ga0068871_100046445 3300006358 Bacteria 3498
100 Ga0068871_100073741 3300006358 Unclassified 2814
101 Ga0075428_100044684 3300006844 Bacteria 4867
102 Ga0075430_100051789 3300006846 Bacteria 3458
103 Ga0075431_100018158 3300006847 Bacteria 7156
104 Ga0075429_100017731 3300006880 Bacteria 6157
105 Ga0068865_100013759 3300006881 Bacteria 5126
106 Ga0068865_100202297 3300006881 Bacteria 1542
107 Ga0097620_100008213 3300006931 Bacteria 10591
108 Ga0099794_10002420 3300007265 Bacteria 6877
109 Ga0105240_10001174 3300009093 Bacteria 45878
110 Ga0105240_10002434 3300009093 Bacteria 29930
111 Ga0105240_10038996 3300009093 Bacteria 6088
112 Ga0105240_10049649 3300009093 Bacteria 5294
113 Ga0105240_10067525 3300009093 Bacteria 4432
114 Ga0105240_10071507 3300009093 Bacteria 4290
115 Ga0111539_10004167 3300009094 Bacteria 18959
116 Ga0111539_10012572 3300009094 Bacteria 10607
117 Ga0105245_10008937 3300009098 Bacteria 8740
118 Ga0105245_10332481 3300009098 Bacteria 1500
119 Ga0105247_10003867 3300009101 Bacteria 9691
120 Ga0105247_10081713 3300009101 Bacteria 2038
121 Ga0114129_10012470 3300009147 Bacteria 12100
122 Ga0114129_10143226 3300009147 Bacteria 3275
123 Ga0105241_10000160 3300009174 Bacteria 48902
124 Ga0105241_10000532 3300009174 Bacteria 28684
125 Ga0105241_10028686 3300009174 Bacteria 4148
126 Ga0105241_10095034 3300009174 Bacteria 2359
127 Ga0105241_10129615 3300009174 Bacteria 2040
128 Ga0105242_10074918 3300009176 Bacteria 2817
129 Ga0105242_10087108 3300009176 Bacteria 2622
130 Ga0105248_10278605 3300009177 Bacteria 1883
131 Ga0105237_10000113 3300009545 Bacteria 114034
132 Ga0105237_10007983 3300009545 Bacteria 11525
133 Ga0105237_10018964 3300009545 Bacteria 7108
134 Ga0105237_10055898 3300009545 Bacteria 3952
135 Ga0105237_10194839 3300009545 Bacteria 2026
136 Ga0105237_10369405 3300009545 Bacteria 1439
137 Ga0105238_10002162 3300009551 Bacteria 19861
138 Ga0105238_10106039 3300009551 Bacteria 2792
139 Ga0105249_10001952 3300009553 Bacteria 17885
140 Ga0105249_10003264 3300009553 Bacteria 14053
141 Ga0105249_10025376 3300009553 Bacteria 5335
142 Ga0105239_10000797 3300010375 Bacteria 44708
143 Ga0105239_10000852 3300010375 Bacteria 43369
144 Ga0105239_10009145 3300010375 Bacteria 11206
145 Ga0105239_10021864 3300010375 Bacteria 7051
146 Ga0105239_10023373 3300010375 Bacteria 6807
147 Ga0105246_10025359 3300011119 Bacteria 3864
148 Ga0157371_10072963 3300013102 Bacteria 2431
149 Ga0157370_10000878 3300013104 Bacteria 38164
150 Ga0157370_10013833 3300013104 Bacteria 8290
151 Ga0157370_10138338 3300013104 Bacteria 2269
152 Ga0157369_10022345 3300013105 Bacteria 7060
153 Ga0157369_10103744 3300013105 Bacteria 3029
154 Ga0157369_10144783 3300013105 Bacteria 2513
155 Ga0157369_10212910 3300013105 Bacteria 2025
156 Ga0157374_10000002 3300013296 Bacteria 1054226
157 Ga0157374_10114455 3300013296 Bacteria 2597
158 Ga0157378_10002969 3300013297 Bacteria 15088
159 Ga0157378_10011050 3300013297 Bacteria 7902
160 Ga0157378_10051298 3300013297 Bacteria 3671
161 Ga0157378_10158713 3300013297 Bacteria 2113
162 Ga0157378_10419199 3300013297 Bacteria 1323
163 Ga0163162_10000871 3300013306 Bacteria 28126
164 Ga0163162_10001660 3300013306 Bacteria 20855
165 Ga0163162_10002043 3300013306 Bacteria 18983
166 Ga0163162_10002520 3300013306 Bacteria 17318
167 Ga0163162_10024259 3300013306 Bacteria 5986
168 Ga0163162_10030395 3300013306 Bacteria 5352
169 Ga0163162_10041585 3300013306 Bacteria 4600
170 Ga0163162_10101792 3300013306 Unclassified 2965
171 Ga0157372_10000838 3300013307 Bacteria 33401
172 Ga0157372_10001435 3300013307 Bacteria 25757
173 Ga0157372_10019994 3300013307 Bacteria 7218
174 Ga0157372_10104075 3300013307 Unclassified 3244
175 Ga0157372_10106112 3300013307 Bacteria 3213
176 Ga0157372_10127012 3300013307 Bacteria 2932
177 Ga0157372_10218673 3300013307 Bacteria 2208
178 Ga0157372_10241636 3300013307 Bacteria 2095
179 Ga0157375_10004609 3300013308 Bacteria 11983
180 Ga0157375_10071768 3300013308 Bacteria 3477
181 Ga0157375_10079329 3300013308 Bacteria 3318
182 Ga0163163_10001564 3300014325 Bacteria 19316
183 Ga0163163_10264521 3300014325 Bacteria 1771
184 Ga0157380_10003169 3300014326 Bacteria 11226
185 Ga0157380_10009352 3300014326 Bacteria 7019
186 Ga0157380_10022050 3300014326 Bacteria 4786
187 Ga0157380_10402899 3300014326 Bacteria 1298
188 Ga0157377_10000795 3300014745 Bacteria 13035
189 Ga0157379_10006681 3300014968 Bacteria 9961
190 Ga0157379_10010182 3300014968 Bacteria 8192
191 Ga0157379_10063590 3300014968 Bacteria 3299
192 Ga0157379_10102527 3300014968 Unclassified 2568
193 Ga0157379_10350439 3300014968 Bacteria 1352
194 Ga0157376_10007536 3300014969 Bacteria 7778
195 Ga0157376_10029493 3300014969 Bacteria 4370
196 Ga0157376_10061569 3300014969 Bacteria 3155
197 Ga0157376_10109215 3300014969 Bacteria 2431
198 Ga0163161_10002691 3300017792 Bacteria 12637
199 Ga0163161_10095553 3300017792 Bacteria 2205
200 Ga0213872_10015546 3300021361 Bacteria 3536
201 Ga0213876_10007409 3300021384 Bacteria 5966
202 Ga0213875_10000214 3300021388 Bacteria 58646
203 Ga0224712_10008164 3300022467 Bacteria 3086
204 Ga0209646_1002521 3300025246 Bacteria 4007
205 Ga0207710_10002479 3300025900 Bacteria 8546
206 Ga0207688_10064652 3300025901 Bacteria 2066
207 Ga0207647_10000094 3300025904 Bacteria 68043
208 Ga0207647_10016204 3300025904 Bacteria 5089
209 Ga0207647_10041207 3300025904 Bacteria 2905
210 Ga0207645_10004029 3300025907 Bacteria 10953
211 Ga0207645_10095859 3300025907 Bacteria 1911
212 Ga0207705_10220624 3300025909 Bacteria 1440
213 Ga0207654_10002487 3300025911 Bacteria 9361
214 Ga0207654_10110843 3300025911 Bacteria 1707
215 Ga0207654_10201352 3300025911 Bacteria 1311
216 Ga0207707_10000889 3300025912 Bacteria 29199
217 Ga0207695_10000128 3300025913 Bacteria 226098
218 Ga0207695_10000652 3300025913 Bacteria 68928
219 Ga0207695_10007934 3300025913 Bacteria 13395
220 Ga0207695_10024352 3300025913 Bacteria 6814
221 Ga0207695_10052284 3300025913 Bacteria 4281
222 Ga0207671_10004592 3300025914 Bacteria 13120
223 Ga0207671_10004614 3300025914 Bacteria 13072
224 Ga0207671_10035482 3300025914 Bacteria 3700
225 Ga0207671_10210564 3300025914 Bacteria 1520
226 Ga0207671_10233113 3300025914 Bacteria 1444
227 Ga0207693_10082538 3300025915 Bacteria 2517
228 Ga0207662_10037090 3300025918 Bacteria 2852
229 Ga0207662_10132330 3300025918 Bacteria 1574
230 Ga0207657_10069251 3300025919 Bacteria 2995
231 Ga0207649_10008214 3300025920 Bacteria 5685
232 Ga0207649_10148633 3300025920 Unclassified 1611
233 Ga0207652_10003369 3300025921 Bacteria 13194
234 Ga0207652_10157882 3300025921 Bacteria 2032
235 Ga0207646_10000734 3300025922 Bacteria 42601
236 Ga0207650_10036621 3300025925 Unclassified 3571
237 Ga0207659_10136822 3300025926 Unclassified 1897
238 Ga0207687_10002192 3300025927 Bacteria 13339
239 Ga0207700_10028095 3300025928 Bacteria 3948
240 Ga0207644_10006209 3300025931 Bacteria 7791
241 Ga0207644_10009705 3300025931 Bacteria 6327
242 Ga0207644_10040373 3300025931 Unclassified 3298
243 Ga0207690_10054734 3300025932 Bacteria 2684
244 Ga0207706_10010706 3300025933 Bacteria 8377
245 Ga0207706_10051198 3300025933 Bacteria 3648
246 Ga0207706_10060798 3300025933 Bacteria 3327
247 Ga0207706_10105602 3300025933 Unclassified 2478
248 Ga0207686_10052866 3300025934 Unclassified 2537
249 Ga0207670_10244095 3300025936 Bacteria 1385
250 Ga0207670_10253859 3300025936 Bacteria 1360
251 Ga0207691_10006686 3300025940 Bacteria 11125
252 Ga0207691_10017004 3300025940 Bacteria 6902
253 Ga0207691_10066056 3300025940 Bacteria 3273
254 Ga0207691_10211285 3300025940 Bacteria 1685
255 Ga0207711_10232708 3300025941 Bacteria 1688
256 Ga0207689_10001862 3300025942 Bacteria 19960
257 Ga0207689_10006664 3300025942 Bacteria 10187
258 Ga0207689_10023547 3300025942 Bacteria 5167
259 Ga0207661_10004188 3300025944 Bacteria 10091
260 Ga0207661_10159625 3300025944 Bacteria 1955
261 Ga0207679_10000691 3300025945 Bacteria 22567
262 Ga0207679_10041995 3300025945 Unclassified 3283
263 Ga0207679_10123398 3300025945 Bacteria 2066
264 Ga0207667_10000143 3300025949 Bacteria 108717
265 Ga0207667_10000275 3300025949 Bacteria 71281
266 Ga0207667_10003830 3300025949 Bacteria 18496
267 Ga0207667_10098502 3300025949 Bacteria 3017
268 Ga0207651_10327786 3300025960 Bacteria 1282
269 Ga0207712_10028796 3300025961 Bacteria 3719
270 Ga0207668_10005274 3300025972 Bacteria 7606
271 Ga0207668_10011054 3300025972 Bacteria 5474
272 Ga0207640_10037436 3300025981 Bacteria 3053
273 Ga0207640_10283313 3300025981 Bacteria 1303
274 Ga0207658_10019589 3300025986 Unclassified 4680
275 Ga0207658_10187079 3300025986 Bacteria 1718
276 Ga0207658_10228653 3300025986 Bacteria 1569
277 Ga0207658_10233367 3300025986 Bacteria 1554
278 Ga0207677_10010001 3300026023 Bacteria 5353
279 Ga0207677_10027002 3300026023 Bacteria 3609
280 Ga0207703_10061946 3300026035 Unclassified 3064
281 Ga0207703_10064002 3300026035 Unclassified 3017
282 Ga0207639_10006671 3300026041 Bacteria 7851
283 Ga0207639_10026646 3300026041 Bacteria 4200
284 Ga0207639_10095257 3300026041 Bacteria 2392
285 Ga0207639_10151494 3300026041 Bacteria 1943
286 Ga0207678_10043242 3300026067 Bacteria 3898
287 Ga0207678_10243198 3300026067 Bacteria 1541
288 Ga0207702_10023201 3300026078 Bacteria 5146
289 Ga0207702_10145670 3300026078 Unclassified 2149
290 Ga0207648_10002966 3300026089 Bacteria 17936
291 Ga0207648_10011071 3300026089 Bacteria 8511
292 Ga0207648_10032826 3300026089 Bacteria 4581
293 Ga0207648_10066081 3300026089 Bacteria 3154
294 Ga0207676_10016689 3300026095 Bacteria 5318
295 Ga0207674_10001433 3300026116 Bacteria 30815
296 Ga0207674_10012726 3300026116 Bacteria 9403
297 Ga0207674_10019971 3300026116 Bacteria 7250
298 Ga0207674_10136934 3300026116 Bacteria 2410
299 Ga0207674_10395837 3300026116 Unclassified 1335
300 Ga0207675_100000655 3300026118 Bacteria 34051
301 Ga0207675_100005410 3300026118 Bacteria 12231
302 Ga0207675_100013875 3300026118 Bacteria 7513
303 Ga0207675_100080551 3300026118 Bacteria 3053
304 Ga0207683_10031845 3300026121 Bacteria 4579
305 Ga0207683_10045717 3300026121 Bacteria 3829
306 Ga0207698_10005413 3300026142 Bacteria 7887
307 Ga0207698_10044840 3300026142 Bacteria 3326
308 Ga0207698_10060717 3300026142 Bacteria 2941
309 Ga0207698_10134376 3300026142 Bacteria 2120
310 Ga0209984_1001214 3300027424 Bacteria 2769
311 Ga0209995_1008167 3300027471 Bacteria 1687
312 Ga0268264_10002749 3300028381 Bacteria 15366
313 Ga0268264_10002932 3300028381 Bacteria 14820
314 Ga0268264_10062041 3300028381 Bacteria 3138
315 Ga0268264_10215853 3300028381 Bacteria 1763
316 Ga0265337_1031319 3300028556 Bacteria 1580
317 Ga0265323_10008432 3300028653 Bacteria 4249
318 Ga0307515_10000039 3300028794 Bacteria 323229
319 Ga0265338_10015062 3300028800 Bacteria 8535
320 Ga0265324_10000167 3300029957 Bacteria 50706
321 Ga0265324_10005980 3300029957 Bacteria 5152
322 Ga0265320_10065097 3300031240 Bacteria 1730
323 Ga0265325_10004171 3300031241 Bacteria 9191
324 Ga0265340_10001778 3300031247 Bacteria 12298
325 Ga0265339_10000087 3300031249 Bacteria 78504
326 Ga0265331_10006176 3300031250 Bacteria 7112
327 Ga0265327_10004024 3300031251 Bacteria 13367
328 Ga0307513_10102485 3300031456 Bacteria 2881
329 Ga0307509_10018463 3300031507 Bacteria 7997
330 Ga0307408_100089059 3300031548 Bacteria 2326
331 Ga0265313_10007093 3300031595 Bacteria 7736
332 Ga0265313_10078271 3300031595 Bacteria 1508
333 Ga0307508_10002859 3300031616 Bacteria 17909
334 Ga0316579_10025789 3300031691 Bacteria 2656
335 Ga0265314_10000009 3300031711 Bacteria 476805
336 Ga0265342_10000872 3300031712 Bacteria 30163
337 Ga0265342_10036041 3300031712 Bacteria 3024
338 Ga0316576_10015676 3300031727 Bacteria 5093
339 Ga0316576_10035072 3300031727 Bacteria 3579
340 Ga0316576_10053593 3300031727 Bacteria 2939
341 Ga0316576_10158712 3300031727 Bacteria 1705
342 Ga0316578_10007421 3300031728 Bacteria 5499
343 Ga0316578_10012671 3300031728 Bacteria 4450
344 Ga0316578_10026156 3300031728 Bacteria 3289
345 Ga0316577_10014735 3300031733 Bacteria 4295
346 Ga0307413_10012821 3300031824 Bacteria 4187
347 Ga0307410_10040129 3300031852 Bacteria 3079
348 Ga0307406_10005234 3300031901 Bacteria 7088
349 Ga0307412_10044663 3300031911 Bacteria 2892
350 Ga0307416_100014812 3300032002 Bacteria 5361
351 Ga0316580_10001930 3300032139 Bacteria 5582
352 Ga0316580_10004080 3300032139 Bacteria 4207
353 Ga0316580_10027495 3300032139 Bacteria 1758
354 Ga0316592_1001806 3300033524 Bacteria 3568
355 Ga0316588_1003827 3300033528 Bacteria 2790
356 Ga0316588_1005262 3300033528 Bacteria 2507
357 Ga0316574_0039066 3300035398 Bacteria 2916
358 Ga0316574_0055327 3300035398 Bacteria 2480
359 Ga0316574_0067765 3300035398 Bacteria 2250
360 Ga0316574_0088423 3300035398 Bacteria 1973
361 Ga0373924_0010856 3300035410 Bacteria 3371
362 Ga0373947_0069215 3300035725 Unclassified 2160
363 Ga0373937_0006124 3300036401 Bacteria 10356
364 Ga0316582_0022616 3300036647 Bacteria 3735
365 Ga0316584_0026037 3300036712 Bacteria 4295
366 Ga0316584_0036634 3300036712 Bacteria 3641
367 Ga0316584_0060423 3300036712 Bacteria 2838
368 Ga0316584_0156313 3300036712 Bacteria 1695
369 Ga0373925_0006077 3300037068 Bacteria 8935
370 Ga0395900_0036142 3300037418 Bacteria 5091
371 Ga0395905_0006277 3300037471 Bacteria 11990
372 Ga0436364_0320847 3300037853 Bacteria 68018
373 Ga0400483_213439 3300039062 Bacteria 2388
374 Ga0436365_1192048 3300039437 Bacteria 15320
375 Ga0436365_1528891 3300039437 Bacteria 35712
376 Ga0436361_0375914 3300039447 Bacteria 18209
377 Ga0439436_0009017 3300041404 Bacteria 3059
378 Ga0439431_0001142 3300041997 Bacteria 5789
379 Ga0439457_002642 3300042014 Bacteria 5060
380 Ga0439462_0002934 3300042015 Bacteria 4038
381 Ga0450904_000077 3300042139 Bacteria 22175
382 Ga0451577_0081893 3300042876 Unclassified 2879
383 Ga0451577_0127643 3300042876 Bacteria 2280
384 Ga0466969_0008944 3300044656 Bacteria 5310
385 Ga0466972_0000023 3300044658 Bacteria 192679
386 Ga0466972_0034162 3300044658 Bacteria 2493
387 Ga0453683_0176662 3300044673 Bacteria 1353
388 Ga0466966_0000028 3300044684 Bacteria 105667
389 Ga0466961_0010198 3300044693 Bacteria 5985
390 Ga0453684_0097597 3300044712 Unclassified 3606
391 Ga0453684_0324709 3300044712 Bacteria 1742
392 Ga0453684_0399885 3300044712 Bacteria 1539
393 Ga0466970_0007060 3300044765 Bacteria 5618
394 Ga0466957_0000871 3300044842 Bacteria 15502
395 Ga0466959_0000047 3300045049 Bacteria 86901
396 Ga0451576_0159158 3300045051 Bacteria 2356
397 Ga0495592_0057138 3300046454 Unclassified 2881
398 Ga0495638_0017218 3300046460 Bacteria 4824
399 Ga0495638_0052597 3300046460 Bacteria 2536
400 Ga0495606_0027950 3300046507 Bacteria 3987
401 Ga0495628_0008793 3300046516 Bacteria 8643
402 Ga0495648_0002188 3300046524 Bacteria 18313
403 Ga0495587_0047488 3300046536 Unclassified 2545
404 Ga0495667_0057646 3300046559 Unclassified 2553
405 Ga0495668_0000433 3300046616 Bacteria 54007
406 Ga0495668_0002761 3300046616 Bacteria 14040
407 Ga0495611_0000119 3300046648 Bacteria 56310
408 Ga0495670_0047355 3300046691 Unclassified 2149
409 Ga0495600_0062291 3300046809 Unclassified 2437
410 Ga0495676_0138806 3300047321 Unclassified 1744
411 Ga0495686_0000016 3300047472 Bacteria 443701
412 Ga0496109_0241229 3300048912 Unclassified 1701
413 Ga0501299_007480 3300049522 Unclassified 1746
414 Ga0501031_0002545 3300049568 Bacteria 11618
415 Ga0501032_0003679 3300049569 Bacteria 11653
416 Ga0501032_0048328 3300049569 Bacteria 2873
417 Ga0501034_0000043 3300049571 Bacteria 229049
418 Ga0501034_0000917 3300049571 Bacteria 43049
419 Ga0501034_0057856 3300049571 Unclassified 3897
420 Ga0501034_0106073 3300049571 Bacteria 2803
421 Ga0501034_0297013 3300049571 Bacteria 1552
422 Ga0501034_0352079 3300049571 Bacteria 1401
423 Ga0501036_0024036 3300049572 Bacteria 5136
424 Ga0501036_0038487 3300049572 Bacteria 4048
425 Ga0501036_0090369 3300049572 Unclassified 2587
426 Ga0501038_0003467 3300049574 Bacteria 14708
427 Ga0501038_0185525 3300049574 Bacteria 1676
428 Ga0501039_0115360 3300049575 Bacteria 2102
429 Ga0501039_0170941 3300049575 Bacteria 1708
430 Ga0501043_0006358 3300049579 Bacteria 9492
431 Ga0501043_0011970 3300049579 Bacteria 6788
432 Ga0501043_0021830 3300049579 Bacteria 5020
433 Ga0501043_0121633 3300049579 Bacteria 2047
434 Ga0501043_0121950 3300049579 Bacteria 2045
435 Ga0501043_0290703 3300049579 Bacteria 1251
436 Ga0501046_0002916 3300049580 Bacteria 15831
437 Ga0501047_0006021 3300049581 Bacteria 11401
438 Ga0501047_0006161 3300049581 Bacteria 11276
439 Ga0501047_0014647 3300049581 Bacteria 7463
440 Ga0501047_0015178 3300049581 Bacteria 7333
441 Ga0501047_0218769 3300049581 Bacteria 1761
442 Ga0501048_0017191 3300049582 Bacteria 5329
443 Ga0501048_0057168 3300049582 Bacteria 2767
444 Ga0501068_0106348 3300049584 Unclassified 1742
445 Ga0501069_0026804 3300049585 Bacteria 3157
446 Ga0501070_0018298 3300049586 Bacteria 5877
447 Ga0501072_0072610 3300049588 Bacteria 2720
448 Ga0501074_0000591 3300049590 Bacteria 22526
449 Ga0501077_0162288 3300049593 Unclassified 1419
450 Ga0501198_008078 3300049649 Bacteria 1521
451 Ga0501201_000305 3300049651 Bacteria 4482
452 Ga0501202_001739 3300049652 Bacteria 3546
453 Ga0501202_009118 3300049652 Unclassified 1817
454 Ga0501216_003825 3300049660 Bacteria 2212
455 Ga0501217_011471 3300049661 Bacteria 1961
456 Ga0501223_006264 3300049663 Bacteria 2467
457 Ga0501233_001008 3300049668 Bacteria 4785
458 Ga0501235_000598 3300049669 Bacteria 7273
459 Ga0501242_001431 3300049674 Bacteria 2391
460 Ga0501243_000414 3300049675 Bacteria 5674
461 Ga0501250_000153 3300049680 Unclassified 3914
462 Ga0501257_006030 3300049686 Bacteria 2684
463 Ga0501259_000264 3300049688 Bacteria 8223
464 Ga0501261_000329 3300049690 Bacteria 6404
465 Ga0501219_000741 3300049703 Bacteria 4426
466 Ga0501221_000293 3300049704 Bacteria 7435
467 Ga0501225_0001652 3300049705 Bacteria 6968
468 Ga0501225_0002225 3300049705 Bacteria 5998
469 Ga0501234_002632 3300049707 Bacteria 2829
470 Ga0501245_000189 3300049708 Bacteria 6831
471 Ga0501080_0112428 3300049742 Unclassified 2525
472 Ga0501083_0034230 3300049744 Bacteria 3474
473 Ga0501083_0057921 3300049744 Unclassified 2593
474 Ga0501241_003408 3300049758 Bacteria 3000
475 Ga0501266_003435 3300049763 Bacteria 1967
476 Ga0501273_005868 3300049770 Bacteria 1403
477 Ga0501035_0007536 3300049822 Bacteria 10171
478 Ga0501035_0053592 3300049822 Bacteria 3606
479 Ga0501035_0063174 3300049822 Unclassified 3294
480 Ga0501044_0001962 3300049823 Bacteria 23802
481 Ga0501044_0028031 3300049823 Bacteria 5943
482 Ga0501044_0259591 3300049823 Bacteria 1676
483 Ga0501212_007897 3300049851 Unclassified 1469
484 Ga0501284_00087 3300050005 Bacteria 22697
485 nmdc:mga0k408_156129_c1 3300050493 Bacteria 1359
486 nmdc:mga05p37_7694_c1 3300050507 Bacteria 12715
487 nmdc:mga08y16_2956_c1 3300050511 Bacteria 17511
488 Ga0500578_0000027 3300053086 Bacteria 144362
489 Ga0500646_0000703 3300053090 Bacteria 9542
490 Ga0500583_0000042 3300053092 Bacteria 82406
491 Ga0500583_0097214 3300053092 Bacteria 1439
492 Ga0500641_0003073 3300053096 Bacteria 5916
493 Ga0500555_012718 3300053103 Bacteria 2423
494 Ga0500652_012430 3300053131 Bacteria 2986
495 Ga0500568_0016542 3300053139 Bacteria 3276
496 Ga0500588_0002241 3300053146 Unclassified 3886
497 Ga0500588_0015580 3300053146 Bacteria 1950
498 Ga0500604_0019163 3300053151 Bacteria 1914
499 Ga0500622_0001642 3300053156 Bacteria 17504
500 Ga0500636_0051112 3300053177 Bacteria 2430
501 Ga0500611_005642 3300053727 Bacteria 1775
502 Ga0501084_0024350 3300054114 Bacteria 5049
503 Ga0501084_0060413 3300054114 Bacteria 3173
504 Ga0501082_0013528 3300060353 Bacteria 7011
505 Ga0466962_0020267 3300061719 Bacteria 3196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0159158 Ga0451576_0159158_29_1093 351
2 3300005347 Ga0070668_100125294 Ga0070668_1001252942 371
3 3300049680 Ga0501250_000153 Ga0501250_000153_1476_2633 372
4 3300014968 Ga0157379_10006681 Ga0157379_100066814 373
5 iso_pu_bacteria 2738541278 2738727675 375
6 3300005563 Ga0068855_100009366 Ga0068855_1000093667 378
7 3300009094 Ga0111539_10004167 Ga0111539_1000416725 378
8 3300041997 Ga0439431_0001142 Ga0439431_0001142_974_2113 378
9 3300050511 nmdc:mga08y16_2956_c1 nmdc:mga08y16_2956_c1_10891_12042 378
10 3300003316 rootH1_10145707 rootH1_101457072 379
11 3300003320 rootH2_10040915 rootH2_100409158 379
12 3300005367 Ga0070667_100245479 Ga0070667_1002454791 379
13 3300005564 Ga0070664_100206832 Ga0070664_1002068322 379
14 3300005564 Ga0070664_100231903 Ga0070664_1002319031 379
15 3300025921 Ga0207652_10157882 Ga0207652_101578821 379
16 3300025986 Ga0207658_10187079 Ga0207658_101870791 379
17 3300026118 Ga0207675_100005410 Ga0207675_10000541011 379
18 3300031240 Ga0265320_10065097 Ga0265320_100650972 379
19 3300031616 Ga0307508_10002859 Ga0307508_100028595 379
20 3300037418 Ga0395900_0036142 Ga0395900_0036142_866_2005 379
21 3300037471 Ga0395905_0006277 Ga0395905_0006277_5769_6908 379
22 3300044658 Ga0466972_0034162 Ga0466972_0034162_1342_2481 379
23 3300044673 Ga0453683_0176662 Ga0453683_0176662_155_1303 379
24 3300046460 Ga0495638_0017218 Ga0495638_0017218_3671_4810 379
25 3300049579 Ga0501043_0290703 Ga0501043_0290703_93_1232 379
26 3300049649 Ga0501198_008078 Ga0501198_008078_47_1186 379
27 3300053146 Ga0500588_0002241 Ga0500588_0002241_1963_3102 379
28 3300005445 Ga0070708_100213033 Ga0070708_1002130332 385
29 3300005468 Ga0070707_100052453 Ga0070707_1000524533 385
30 3300006881 Ga0068865_100013759 Ga0068865_1000137593 385
31 3300022467 Ga0224712_10008164 Ga0224712_100081643 385
32 3300025922 Ga0207646_10000734 Ga0207646_1000073427 385
33 3300005563 Ga0068855_100099025 Ga0068855_1000990252 386
34 3300005616 Ga0068852_100152566 Ga0068852_1001525662 386
35 3300009174 Ga0105241_10028686 Ga0105241_100286862 386
36 3300013105 Ga0157369_10103744 Ga0157369_101037442 386
37 3300025927 Ga0207687_10002192 Ga0207687_100021927 386
38 3300025949 Ga0207667_10098502 Ga0207667_100985024 386
39 3300026142 Ga0207698_10134376 Ga0207698_101343762 386
40 3300005436 Ga0070713_100091538 Ga0070713_1000915382 387
41 3300025915 Ga0207693_10082538 Ga0207693_100825382 387
42 3300025928 Ga0207700_10028095 Ga0207700_100280953 387
43 3300025920 Ga0207649_10148633 Ga0207649_101486331 389
44 3300028653 Ga0265323_10008432 Ga0265323_100084325 389
45 3300021388 Ga0213875_10000214 Ga0213875_100002147 390
46 3300031691 Ga0316579_10025789 Ga0316579_100257894 390
47 3300031727 Ga0316576_10015676 Ga0316576_100156765 390
48 3300031727 Ga0316576_10035072 Ga0316576_100350722 390
49 3300031727 Ga0316576_10053593 Ga0316576_100535932 390
50 3300031727 Ga0316576_10158712 Ga0316576_101587122 390
51 3300031728 Ga0316578_10007421 Ga0316578_100074216 390
52 3300031728 Ga0316578_10012671 Ga0316578_100126712 390
53 3300031728 Ga0316578_10026156 Ga0316578_100261562 390
54 3300031733 Ga0316577_10014735 Ga0316577_100147352 390
55 3300032139 Ga0316580_10001930 Ga0316580_100019303 390
56 3300032139 Ga0316580_10004080 Ga0316580_100040802 390
57 3300032139 Ga0316580_10027495 Ga0316580_100274952 390
58 3300033524 Ga0316592_1001806 Ga0316592_10018062 390
59 3300033528 Ga0316588_1003827 Ga0316588_10038273 390
60 3300033528 Ga0316588_1005262 Ga0316588_10052622 390
61 3300035398 Ga0316574_0039066 Ga0316574_0039066_886_2073 390
62 3300035398 Ga0316574_0055327 Ga0316574_0055327_1019_2200 390
63 3300035398 Ga0316574_0067765 Ga0316574_0067765_693_1880 390
64 3300035398 Ga0316574_0088423 Ga0316574_0088423_365_1552 390
65 3300036647 Ga0316582_0022616 Ga0316582_0022616_381_1568 390
66 3300036712 Ga0316584_0026037 Ga0316584_0026037_648_1835 390
67 3300036712 Ga0316584_0036634 Ga0316584_0036634_2099_3286 390
68 3300036712 Ga0316584_0060423 Ga0316584_0060423_1201_2382 390
69 3300036712 Ga0316584_0156313 Ga0316584_0156313_329_1516 390
70 3300037853 Ga0436364_0320847 Ga0436364_0320847_15556_16746 390
71 3300005355 Ga0070671_100001403 Ga0070671_1000014032 391
72 3300005843 Ga0068860_100267503 Ga0068860_1002675032 391
73 3300025931 Ga0207644_10006209 Ga0207644_100062092 391
74 3300028381 Ga0268264_10215853 Ga0268264_102158532 391
75 3300039062 Ga0400483_213439 Ga0400483_213439_673_1863 391
76 iso_pu_bacteria 2883068021 2883069325 391
77 iso_pu_bacteria 2884791551 2884794897 392
78 3300007265 Ga0099794_10002420 Ga0099794_100024203 394
79 3300028556 Ga0265337_1031319 Ga0265337_10313192 394
80 3300028800 Ga0265338_10015062 Ga0265338_100150629 394
81 3300029957 Ga0265324_10000167 Ga0265324_1000016743 394
82 3300029957 Ga0265324_10005980 Ga0265324_100059802 394
83 3300031241 Ga0265325_10004171 Ga0265325_100041713 394
84 3300031247 Ga0265340_10001778 Ga0265340_100017787 394
85 3300031249 Ga0265339_10000087 Ga0265339_100000877 394
86 3300031250 Ga0265331_10006176 Ga0265331_100061766 394
87 3300031595 Ga0265313_10007093 Ga0265313_100070935 394
88 3300031595 Ga0265313_10078271 Ga0265313_100782712 394
89 3300031711 Ga0265314_10000009 Ga0265314_10000009385 394
90 3300031712 Ga0265342_10000872 Ga0265342_100008727 394
91 3300031712 Ga0265342_10036041 Ga0265342_100360412 394
92 3300037068 Ga0373925_0006077 Ga0373925_0006077_4053_5252 394
93 3300005343 Ga0070687_100048141 Ga0070687_1000481412 395
94 3300005344 Ga0070661_100169319 Ga0070661_1001693192 395
95 3300005577 Ga0068857_100001841 Ga0068857_10000184117 395
96 3300005614 Ga0068856_100120012 Ga0068856_1001200122 395
97 3300005616 Ga0068852_100000370 Ga0068852_10000037019 395
98 3300005843 Ga0068860_100028533 Ga0068860_1000285335 395
99 3300009098 Ga0105245_10008937 Ga0105245_100089379 395
100 3300009174 Ga0105241_10095034 Ga0105241_100950342 395
101 3300009545 Ga0105237_10018964 Ga0105237_100189642 395
102 3300013104 Ga0157370_10013833 Ga0157370_100138335 395
103 3300013105 Ga0157369_10022345 Ga0157369_100223458 395
104 3300013307 Ga0157372_10000838 Ga0157372_1000083819 395
105 3300013307 Ga0157372_10127012 Ga0157372_101270122 395
106 3300021361 Ga0213872_10015546 Ga0213872_100155463 395
107 3300025904 Ga0207647_10041207 Ga0207647_100412072 395
108 3300025911 Ga0207654_10201352 Ga0207654_102013521 395
109 3300025914 Ga0207671_10004592 Ga0207671_100045927 395
110 3300025949 Ga0207667_10000275 Ga0207667_1000027530 395
111 3300025986 Ga0207658_10228653 Ga0207658_102286532 395
112 3300026078 Ga0207702_10023201 Ga0207702_100232012 395
113 3300026116 Ga0207674_10001433 Ga0207674_1000143317 395
114 3300026142 Ga0207698_10005413 Ga0207698_100054139 395
115 3300028381 Ga0268264_10002749 Ga0268264_100027499 395
116 3300039447 Ga0436361_0375914 Ga0436361_0375914_1793_3025 395
117 3300042139 Ga0450904_000077 Ga0450904_000077_659_1888 395
118 3300049522 Ga0501299_007480 Ga0501299_007480_234_1427 395
119 3300049651 Ga0501201_000305 Ga0501201_000305_2896_4089 395
120 3300049652 Ga0501202_009118 Ga0501202_009118_614_1807 395
121 3300049663 Ga0501223_006264 Ga0501223_006264_483_1676 395
122 3300049668 Ga0501233_001008 Ga0501233_001008_300_1493 395
123 3300049669 Ga0501235_000598 Ga0501235_000598_4027_5220 395
124 3300049674 Ga0501242_001431 Ga0501242_001431_287_1480 395
125 3300049675 Ga0501243_000414 Ga0501243_000414_2080_3273 395
126 3300049686 Ga0501257_006030 Ga0501257_006030_1120_2313 395
127 3300049688 Ga0501259_000264 Ga0501259_000264_3368_4561 395
128 3300049690 Ga0501261_000329 Ga0501261_000329_1208_2401 395
129 3300049704 Ga0501221_000293 Ga0501221_000293_5735_6928 395
130 3300049705 Ga0501225_0001652 Ga0501225_0001652_235_1428 395
131 3300049707 Ga0501234_002632 Ga0501234_002632_1265_2458 395
132 3300049708 Ga0501245_000189 Ga0501245_000189_5245_6438 395
133 3300049742 Ga0501080_0112428 Ga0501080_0112428_384_1571 395
134 3300049851 Ga0501212_007897 Ga0501212_007897_119_1312 395
135 iso_pu_bacteria 2808606445 2809215348 395
136 2162886007 SwRhRL2b_contig_1887178 SwRhRL2b_0407.00005830 396
137 2162886011 MRS1b_contig_3767459 MRS1b_0572.00000860 396
138 3300002459 JGI24751J29686_10000860 JGI24751J29686_100008602 396
139 3300003320 rootH2_10028215 rootH2_100282157 396
140 3300003323 rootH1_10002414 rootH1_1000241411 396
141 3300005289 Ga0065704_10070136 Ga0065704_10070136373 396
142 3300005290 Ga0065712_10008552 Ga0065712_100085522 396
143 3300005295 Ga0065707_10005297 Ga0065707_100052973 396
144 3300005328 Ga0070676_10037268 Ga0070676_100372684 396
145 3300005329 Ga0070683_100015154 Ga0070683_1000151548 396
146 3300005330 Ga0070690_100124352 Ga0070690_1001243521 396
147 3300005331 Ga0070670_100098970 Ga0070670_1000989701 396
148 3300005333 Ga0070677_10007114 Ga0070677_100071145 396
149 3300005334 Ga0068869_100006543 Ga0068869_1000065433 396
150 3300005334 Ga0068869_100139763 Ga0068869_1001397632 396
151 3300005335 Ga0070666_10197000 Ga0070666_101970001 396
152 3300005337 Ga0070682_100020945 Ga0070682_1000209453 396
153 3300005338 Ga0068868_100090800 Ga0068868_1000908002 396
154 3300005339 Ga0070660_100041423 Ga0070660_1000414233 396
155 3300005340 Ga0070689_100019284 Ga0070689_1000192841 396
156 3300005340 Ga0070689_100200381 Ga0070689_1002003812 396
157 3300005341 Ga0070691_10004393 Ga0070691_100043932 396
158 3300005341 Ga0070691_10014565 Ga0070691_100145653 396
159 3300005343 Ga0070687_100049704 Ga0070687_1000497042 396
160 3300005344 Ga0070661_100010597 Ga0070661_1000105975 396
161 3300005347 Ga0070668_100014629 Ga0070668_1000146292 396
162 3300005347 Ga0070668_100129439 Ga0070668_1001294393 396
163 3300005347 Ga0070668_100202102 Ga0070668_1002021022 396
164 3300005353 Ga0070669_100025859 Ga0070669_1000258592 396
165 3300005353 Ga0070669_100086674 Ga0070669_1000866742 396
166 3300005354 Ga0070675_100035168 Ga0070675_1000351686 396
167 3300005354 Ga0070675_100243578 Ga0070675_1002435782 396
168 3300005355 Ga0070671_100018804 Ga0070671_1000188045 396
169 3300005356 Ga0070674_100036811 Ga0070674_1000368112 396
170 3300005364 Ga0070673_100025202 Ga0070673_1000252023 396
171 3300005364 Ga0070673_100082386 Ga0070673_1000823863 396
172 3300005364 Ga0070673_100119326 Ga0070673_1001193263 396
173 3300005365 Ga0070688_100001085 Ga0070688_10000108511 396
174 3300005365 Ga0070688_100033192 Ga0070688_1000331923 396
175 3300005365 Ga0070688_100091978 Ga0070688_1000919782 396
176 3300005456 Ga0070678_100076009 Ga0070678_1000760092 396
177 3300005456 Ga0070678_100099909 Ga0070678_1000999091 396
178 3300005457 Ga0070662_100029061 Ga0070662_1000290613 396
179 3300005457 Ga0070662_100058517 Ga0070662_1000585172 396
180 3300005457 Ga0070662_100122349 Ga0070662_1001223491 396
181 3300005459 Ga0068867_100153288 Ga0068867_1001532881 396
182 3300005466 Ga0070685_10032880 Ga0070685_100328802 396
183 3300005466 Ga0070685_10051461 Ga0070685_100514612 396
184 3300005530 Ga0070679_100006080 Ga0070679_1000060802 396
185 3300005539 Ga0068853_100003134 Ga0068853_1000031342 396
186 3300005539 Ga0068853_100088478 Ga0068853_1000884784 396
187 3300005539 Ga0068853_100094908 Ga0068853_1000949082 396
188 3300005543 Ga0070672_100027883 Ga0070672_1000278832 396
189 3300005543 Ga0070672_100072997 Ga0070672_1000729972 396
190 3300005563 Ga0068855_100001225 Ga0068855_10000122512 396
191 3300005563 Ga0068855_100005467 Ga0068855_1000054672 396
192 3300005563 Ga0068855_100044949 Ga0068855_1000449492 396
193 3300005564 Ga0070664_100017898 Ga0070664_1000178982 396
194 3300005578 Ga0068854_100173839 Ga0068854_1001738392 396
195 3300005614 Ga0068856_100022841 Ga0068856_1000228412 396
196 3300005614 Ga0068856_100181466 Ga0068856_1001814663 396
197 3300005614 Ga0068856_100301569 Ga0068856_1003015691 396
198 3300005615 Ga0070702_100022600 Ga0070702_1000226003 396
199 3300005616 Ga0068852_100000882 Ga0068852_10000088218 396
200 3300005617 Ga0068859_100008213 Ga0068859_1000082135 396
201 3300005618 Ga0068864_100015077 Ga0068864_1000150772 396
202 3300005719 Ga0068861_100044275 Ga0068861_1000442753 396
203 3300005719 Ga0068861_100183866 Ga0068861_1001838662 396
204 3300005840 Ga0068870_10097153 Ga0068870_100971531 396
205 3300005841 Ga0068863_100092411 Ga0068863_1000924111 396
206 3300005841 Ga0068863_100105692 Ga0068863_1001056923 396
207 3300005843 Ga0068860_100003184 Ga0068860_1000031845 396
208 3300005843 Ga0068860_100009277 Ga0068860_1000092774 396
209 3300005843 Ga0068860_100061298 Ga0068860_1000612984 396
210 3300005844 Ga0068862_100027789 Ga0068862_1000277896 396
211 3300005983 Ga0081540_1009550 Ga0081540_10095502 396
212 3300006195 Ga0075366_10132995 Ga0075366_101329951 396
213 3300006358 Ga0068871_100002027 Ga0068871_1000020273 396
214 3300006358 Ga0068871_100046445 Ga0068871_1000464455 396
215 3300006358 Ga0068871_100073741 Ga0068871_1000737413 396
216 3300006844 Ga0075428_100044684 Ga0075428_1000446842 396
217 3300006846 Ga0075430_100051789 Ga0075430_1000517893 396
218 3300006847 Ga0075431_100018158 Ga0075431_1000181584 396
219 3300006880 Ga0075429_100017731 Ga0075429_1000177312 396
220 3300006881 Ga0068865_100202297 Ga0068865_1002022972 396
221 3300006931 Ga0097620_100008213 Ga0097620_1000082138 396
222 3300009093 Ga0105240_10001174 Ga0105240_1000117433 396
223 3300009093 Ga0105240_10002434 Ga0105240_1000243419 396
224 3300009093 Ga0105240_10038996 Ga0105240_100389962 396
225 3300009093 Ga0105240_10049649 Ga0105240_100496491 396
226 3300009093 Ga0105240_10067525 Ga0105240_100675252 396
227 3300009093 Ga0105240_10071507 Ga0105240_100715071 396
228 3300009094 Ga0111539_10012572 Ga0111539_100125722 396
229 3300009098 Ga0105245_10332481 Ga0105245_103324811 396
230 3300009101 Ga0105247_10003867 Ga0105247_100038676 396
231 3300009101 Ga0105247_10081713 Ga0105247_100817131 396
232 3300009147 Ga0114129_10012470 Ga0114129_100124708 396
233 3300009147 Ga0114129_10143226 Ga0114129_101432262 396
234 3300009174 Ga0105241_10000160 Ga0105241_100001602 396
235 3300009174 Ga0105241_10000532 Ga0105241_1000053220 396
236 3300009174 Ga0105241_10129615 Ga0105241_101296152 396
237 3300009176 Ga0105242_10074918 Ga0105242_100749183 396
238 3300009176 Ga0105242_10087108 Ga0105242_100871082 396
239 3300009177 Ga0105248_10278605 Ga0105248_102786051 396
240 3300009545 Ga0105237_10000113 Ga0105237_1000011327 396
241 3300009545 Ga0105237_10007983 Ga0105237_100079837 396
242 3300009545 Ga0105237_10055898 Ga0105237_100558982 396
243 3300009545 Ga0105237_10194839 Ga0105237_101948392 396
244 3300009545 Ga0105237_10369405 Ga0105237_103694052 396
245 3300009551 Ga0105238_10002162 Ga0105238_1000216212 396
246 3300009551 Ga0105238_10106039 Ga0105238_101060392 396
247 3300009553 Ga0105249_10001952 Ga0105249_100019525 396
248 3300009553 Ga0105249_10003264 Ga0105249_100032642 396
249 3300009553 Ga0105249_10025376 Ga0105249_100253762 396
250 3300010375 Ga0105239_10000797 Ga0105239_1000079722 396
251 3300010375 Ga0105239_10000852 Ga0105239_1000085232 396
252 3300010375 Ga0105239_10009145 Ga0105239_100091452 396
253 3300010375 Ga0105239_10021864 Ga0105239_100218648 396
254 3300010375 Ga0105239_10023373 Ga0105239_100233732 396
255 3300011119 Ga0105246_10025359 Ga0105246_100253592 396
256 3300013102 Ga0157371_10072963 Ga0157371_100729631 396
257 3300013104 Ga0157370_10000878 Ga0157370_1000087814 396
258 3300013104 Ga0157370_10138338 Ga0157370_101383382 396
259 3300013105 Ga0157369_10144783 Ga0157369_101447832 396
260 3300013105 Ga0157369_10212910 Ga0157369_102129102 396
261 3300013296 Ga0157374_10000002 Ga0157374_10000002164 396
262 3300013296 Ga0157374_10114455 Ga0157374_101144552 396
263 3300013297 Ga0157378_10002969 Ga0157378_100029699 396
264 3300013297 Ga0157378_10011050 Ga0157378_100110503 396
265 3300013297 Ga0157378_10051298 Ga0157378_100512982 396
266 3300013297 Ga0157378_10158713 Ga0157378_101587131 396
267 3300013297 Ga0157378_10419199 Ga0157378_104191992 396
268 3300013306 Ga0163162_10000871 Ga0163162_1000087120 396
269 3300013306 Ga0163162_10001660 Ga0163162_100016603 396
270 3300013306 Ga0163162_10002043 Ga0163162_100020434 396
271 3300013306 Ga0163162_10002520 Ga0163162_1000252014 396
272 3300013306 Ga0163162_10024259 Ga0163162_100242592 396
273 3300013306 Ga0163162_10030395 Ga0163162_100303952 396
274 3300013306 Ga0163162_10041585 Ga0163162_100415852 396
275 3300013306 Ga0163162_10101792 Ga0163162_101017923 396
276 3300013307 Ga0157372_10001435 Ga0157372_100014356 396
277 3300013307 Ga0157372_10019994 Ga0157372_100199946 396
278 3300013307 Ga0157372_10104075 Ga0157372_101040752 396
279 3300013307 Ga0157372_10106112 Ga0157372_101061123 396
280 3300013307 Ga0157372_10218673 Ga0157372_102186732 396
281 3300013307 Ga0157372_10241636 Ga0157372_102416361 396
282 3300013308 Ga0157375_10004609 Ga0157375_100046096 396
283 3300013308 Ga0157375_10071768 Ga0157375_100717682 396
284 3300013308 Ga0157375_10079329 Ga0157375_100793293 396
285 3300014325 Ga0163163_10001564 Ga0163163_1000156417 396
286 3300014325 Ga0163163_10264521 Ga0163163_102645212 396
287 3300014326 Ga0157380_10003169 Ga0157380_100031693 396
288 3300014326 Ga0157380_10009352 Ga0157380_100093523 396
289 3300014326 Ga0157380_10022050 Ga0157380_100220506 396
290 3300014326 Ga0157380_10402899 Ga0157380_104028991 396
291 3300014745 Ga0157377_10000795 Ga0157377_100007952 396
292 3300014968 Ga0157379_10010182 Ga0157379_100101822 396
293 3300014968 Ga0157379_10063590 Ga0157379_100635901 396
294 3300014968 Ga0157379_10102527 Ga0157379_101025272 396
295 3300014968 Ga0157379_10350439 Ga0157379_103504391 396
296 3300014969 Ga0157376_10007536 Ga0157376_100075361 396
297 3300014969 Ga0157376_10029493 Ga0157376_100294935 396
298 3300014969 Ga0157376_10061569 Ga0157376_100615692 396
299 3300014969 Ga0157376_10109215 Ga0157376_101092153 396
300 3300017792 Ga0163161_10002691 Ga0163161_100026913 396
301 3300017792 Ga0163161_10095553 Ga0163161_100955531 396
302 3300021384 Ga0213876_10007409 Ga0213876_100074094 396
303 3300025246 Ga0209646_1002521 Ga0209646_10025212 396
304 3300025900 Ga0207710_10002479 Ga0207710_100024796 396
305 3300025901 Ga0207688_10064652 Ga0207688_100646522 396
306 3300025904 Ga0207647_10000094 Ga0207647_1000009436 396
307 3300025904 Ga0207647_10016204 Ga0207647_100162042 396
308 3300025907 Ga0207645_10004029 Ga0207645_100040299 396
309 3300025907 Ga0207645_10095859 Ga0207645_100958592 396
310 3300025909 Ga0207705_10220624 Ga0207705_102206241 396
311 3300025911 Ga0207654_10002487 Ga0207654_100024879 396
312 3300025911 Ga0207654_10110843 Ga0207654_101108432 396
313 3300025912 Ga0207707_10000889 Ga0207707_100008893 396
314 3300025913 Ga0207695_10000128 Ga0207695_1000012823 396
315 3300025913 Ga0207695_10000652 Ga0207695_100006529 396
316 3300025913 Ga0207695_10007934 Ga0207695_100079348 396
317 3300025913 Ga0207695_10024352 Ga0207695_100243522 396
318 3300025913 Ga0207695_10052284 Ga0207695_100522847 396
319 3300025914 Ga0207671_10004614 Ga0207671_1000461414 396
320 3300025914 Ga0207671_10035482 Ga0207671_100354825 396
321 3300025914 Ga0207671_10210564 Ga0207671_102105642 396
322 3300025914 Ga0207671_10233113 Ga0207671_102331132 396
323 3300025918 Ga0207662_10037090 Ga0207662_100370904 396
324 3300025918 Ga0207662_10132330 Ga0207662_101323302 396
325 3300025919 Ga0207657_10069251 Ga0207657_100692514 396
326 3300025920 Ga0207649_10008214 Ga0207649_100082142 396
327 3300025921 Ga0207652_10003369 Ga0207652_1000336914 396
328 3300025925 Ga0207650_10036621 Ga0207650_100366212 396
329 3300025926 Ga0207659_10136822 Ga0207659_101368222 396
330 3300025931 Ga0207644_10009705 Ga0207644_100097053 396
331 3300025931 Ga0207644_10040373 Ga0207644_100403733 396
332 3300025932 Ga0207690_10054734 Ga0207690_100547343 396
333 3300025933 Ga0207706_10010706 Ga0207706_100107069 396
334 3300025933 Ga0207706_10051198 Ga0207706_100511983 396
335 3300025933 Ga0207706_10060798 Ga0207706_100607982 396
336 3300025933 Ga0207706_10105602 Ga0207706_101056022 396
337 3300025934 Ga0207686_10052866 Ga0207686_100528662 396
338 3300025936 Ga0207670_10244095 Ga0207670_102440951 396
339 3300025936 Ga0207670_10253859 Ga0207670_102538591 396
340 3300025940 Ga0207691_10006686 Ga0207691_100066867 396
341 3300025940 Ga0207691_10017004 Ga0207691_100170042 396
342 3300025940 Ga0207691_10066056 Ga0207691_100660563 396
343 3300025940 Ga0207691_10211285 Ga0207691_102112852 396
344 3300025941 Ga0207711_10232708 Ga0207711_102327081 396
345 3300025942 Ga0207689_10001862 Ga0207689_100018626 396
346 3300025942 Ga0207689_10006664 Ga0207689_100066646 396
347 3300025942 Ga0207689_10023547 Ga0207689_100235475 396
348 3300025944 Ga0207661_10004188 Ga0207661_100041888 396
349 3300025944 Ga0207661_10159625 Ga0207661_101596252 396
350 3300025945 Ga0207679_10000691 Ga0207679_1000069116 396
351 3300025945 Ga0207679_10041995 Ga0207679_100419952 396
352 3300025945 Ga0207679_10123398 Ga0207679_101233982 396
353 3300025949 Ga0207667_10000143 Ga0207667_1000014324 396
354 3300025949 Ga0207667_10003830 Ga0207667_1000383016 396
355 3300025960 Ga0207651_10327786 Ga0207651_103277861 396
356 3300025961 Ga0207712_10028796 Ga0207712_100287962 396
357 3300025972 Ga0207668_10005274 Ga0207668_100052742 396
358 3300025972 Ga0207668_10011054 Ga0207668_100110542 396
359 3300025981 Ga0207640_10037436 Ga0207640_100374361 396
360 3300025981 Ga0207640_10283313 Ga0207640_102833132 396
361 3300025986 Ga0207658_10019589 Ga0207658_100195892 396
362 3300025986 Ga0207658_10233367 Ga0207658_102333672 396
363 3300026023 Ga0207677_10010001 Ga0207677_100100015 396
364 3300026023 Ga0207677_10027002 Ga0207677_100270021 396
365 3300026035 Ga0207703_10061946 Ga0207703_100619461 396
366 3300026035 Ga0207703_10064002 Ga0207703_100640021 396
367 3300026041 Ga0207639_10006671 Ga0207639_100066712 396
368 3300026041 Ga0207639_10026646 Ga0207639_100266462 396
369 3300026041 Ga0207639_10095257 Ga0207639_100952573 396
370 3300026041 Ga0207639_10151494 Ga0207639_101514942 396
371 3300026067 Ga0207678_10043242 Ga0207678_100432422 396
372 3300026067 Ga0207678_10243198 Ga0207678_102431981 396
373 3300026078 Ga0207702_10145670 Ga0207702_101456703 396
374 3300026089 Ga0207648_10002966 Ga0207648_1000296612 396
375 3300026089 Ga0207648_10011071 Ga0207648_100110715 396
376 3300026089 Ga0207648_10032826 Ga0207648_100328268 396
377 3300026089 Ga0207648_10066081 Ga0207648_100660813 396
378 3300026095 Ga0207676_10016689 Ga0207676_100166892 396
379 3300026116 Ga0207674_10012726 Ga0207674_100127266 396
380 3300026116 Ga0207674_10019971 Ga0207674_100199712 396
381 3300026116 Ga0207674_10136934 Ga0207674_101369342 396
382 3300026116 Ga0207674_10395837 Ga0207674_103958371 396
383 3300026118 Ga0207675_100000655 Ga0207675_10000065513 396
384 3300026118 Ga0207675_100013875 Ga0207675_1000138755 396
385 3300026118 Ga0207675_100080551 Ga0207675_1000805511 396
386 3300026121 Ga0207683_10031845 Ga0207683_100318454 396
387 3300026121 Ga0207683_10045717 Ga0207683_100457173 396
388 3300026142 Ga0207698_10044840 Ga0207698_100448402 396
389 3300026142 Ga0207698_10060717 Ga0207698_100607171 396
390 3300027424 Ga0209984_1001214 Ga0209984_10012143 396
391 3300027471 Ga0209995_1008167 Ga0209995_10081671 396
392 3300028381 Ga0268264_10002932 Ga0268264_100029322 396
393 3300028381 Ga0268264_10062041 Ga0268264_100620411 396
394 3300028794 Ga0307515_10000039 Ga0307515_10000039163 396
395 3300031251 Ga0265327_10004024 Ga0265327_100040245 396
396 3300031456 Ga0307513_10102485 Ga0307513_101024852 396
397 3300031507 Ga0307509_10018463 Ga0307509_100184638 396
398 3300031548 Ga0307408_100089059 Ga0307408_1000890592 396
399 3300031824 Ga0307413_10012821 Ga0307413_100128213 396
400 3300031852 Ga0307410_10040129 Ga0307410_100401292 396
401 3300031901 Ga0307406_10005234 Ga0307406_100052347 396
402 3300031911 Ga0307412_10044663 Ga0307412_100446632 396
403 3300032002 Ga0307416_100014812 Ga0307416_1000148123 396
404 3300035410 Ga0373924_0010856 Ga0373924_0010856_34_1224 396
405 3300035725 Ga0373947_0069215 Ga0373947_0069215_833_2023 396
406 3300036401 Ga0373937_0006124 Ga0373937_0006124_273_1463 396
407 3300039437 Ga0436365_1192048 Ga0436365_1192048_405_1595 396
408 3300039437 Ga0436365_1528891 Ga0436365_1528891_2411_3601 396
409 3300041404 Ga0439436_0009017 Ga0439436_0009017_423_1613 396
410 3300042014 Ga0439457_002642 Ga0439457_002642_464_1654 396
411 3300042015 Ga0439462_0002934 Ga0439462_0002934_357_1547 396
412 3300042876 Ga0451577_0081893 Ga0451577_0081893_194_1393 396
413 3300042876 Ga0451577_0127643 Ga0451577_0127643_805_2007 396
414 3300044656 Ga0466969_0008944 Ga0466969_0008944_2592_3836 396
415 3300044658 Ga0466972_0000023 Ga0466972_0000023_168632_169822 396
416 3300044684 Ga0466966_0000028 Ga0466966_0000028_39661_40905 396
417 3300044693 Ga0466961_0010198 Ga0466961_0010198_2655_3845 396
418 3300044712 Ga0453684_0097597 Ga0453684_0097597_1072_2274 396
419 3300044712 Ga0453684_0324709 Ga0453684_0324709_90_1280 396
420 3300044712 Ga0453684_0399885 Ga0453684_0399885_233_1423 396
421 3300044765 Ga0466970_0007060 Ga0466970_0007060_2686_3876 396
422 3300044842 Ga0466957_0000871 Ga0466957_0000871_6808_7998 396
423 3300045049 Ga0466959_0000047 Ga0466959_0000047_5013_6257 396
424 3300046454 Ga0495592_0057138 Ga0495592_0057138_1619_2809 396
425 3300046460 Ga0495638_0052597 Ga0495638_0052597_748_1938 396
426 3300046507 Ga0495606_0027950 Ga0495606_0027950_341_1531 396
427 3300046516 Ga0495628_0008793 Ga0495628_0008793_5936_7126 396
428 3300046524 Ga0495648_0002188 Ga0495648_0002188_15103_16293 396
429 3300046536 Ga0495587_0047488 Ga0495587_0047488_1244_2434 396
430 3300046559 Ga0495667_0057646 Ga0495667_0057646_305_1495 396
431 3300046616 Ga0495668_0000433 Ga0495668_0000433_4062_5255 396
432 3300046616 Ga0495668_0002761 Ga0495668_0002761_4309_5598 396
433 3300046648 Ga0495611_0000119 Ga0495611_0000119_7451_8641 396
434 3300046691 Ga0495670_0047355 Ga0495670_0047355_685_1956 396
435 3300046809 Ga0495600_0062291 Ga0495600_0062291_1110_2300 396
436 3300047321 Ga0495676_0138806 Ga0495676_0138806_420_1610 396
437 3300047472 Ga0495686_0000016 Ga0495686_0000016_63327_64517 396
438 3300048912 Ga0496109_0241229 Ga0496109_0241229_190_1380 396
439 3300049568 Ga0501031_0002545 Ga0501031_0002545_9328_10539 396
440 3300049569 Ga0501032_0003679 Ga0501032_0003679_537_1727 396
441 3300049569 Ga0501032_0048328 Ga0501032_0048328_1088_2299 396
442 3300049571 Ga0501034_0000043 Ga0501034_0000043_191813_193006 396
443 3300049571 Ga0501034_0000917 Ga0501034_0000917_5939_7129 396
444 3300049571 Ga0501034_0057856 Ga0501034_0057856_2290_3483 396
445 3300049571 Ga0501034_0106073 Ga0501034_0106073_680_1870 396
446 3300049571 Ga0501034_0297013 Ga0501034_0297013_162_1373 396
447 3300049571 Ga0501034_0352079 Ga0501034_0352079_120_1310 396
448 3300049572 Ga0501036_0024036 Ga0501036_0024036_662_1873 396
449 3300049572 Ga0501036_0038487 Ga0501036_0038487_2439_3632 396
450 3300049572 Ga0501036_0090369 Ga0501036_0090369_194_1384 396
451 3300049574 Ga0501038_0003467 Ga0501038_0003467_8629_9819 396
452 3300049574 Ga0501038_0185525 Ga0501038_0185525_230_1441 396
453 3300049575 Ga0501039_0115360 Ga0501039_0115360_710_1903 396
454 3300049575 Ga0501039_0170941 Ga0501039_0170941_361_1572 396
455 3300049579 Ga0501043_0006358 Ga0501043_0006358_6102_7292 396
456 3300049579 Ga0501043_0011970 Ga0501043_0011970_5514_6704 396
457 3300049579 Ga0501043_0021830 Ga0501043_0021830_2820_4013 396
458 3300049579 Ga0501043_0121633 Ga0501043_0121633_17_1228 396
459 3300049579 Ga0501043_0121950 Ga0501043_0121950_708_1919 396
460 3300049580 Ga0501046_0002916 Ga0501046_0002916_12544_13737 396
461 3300049581 Ga0501047_0006021 Ga0501047_0006021_2015_3205 396
462 3300049581 Ga0501047_0006161 Ga0501047_0006161_8934_10127 396
463 3300049581 Ga0501047_0014647 Ga0501047_0014647_1159_2349 396
464 3300049581 Ga0501047_0015178 Ga0501047_0015178_2610_3800 396
465 3300049581 Ga0501047_0218769 Ga0501047_0218769_520_1731 396
466 3300049582 Ga0501048_0017191 Ga0501048_0017191_794_1987 396
467 3300049582 Ga0501048_0057168 Ga0501048_0057168_1524_2714 396
468 3300049584 Ga0501068_0106348 Ga0501068_0106348_230_1423 396
469 3300049585 Ga0501069_0026804 Ga0501069_0026804_1453_2643 396
470 3300049586 Ga0501070_0018298 Ga0501070_0018298_3838_5031 396
471 3300049588 Ga0501072_0072610 Ga0501072_0072610_872_2062 396
472 3300049590 Ga0501074_0000591 Ga0501074_0000591_640_1833 396
473 3300049593 Ga0501077_0162288 Ga0501077_0162288_156_1349 396
474 3300049652 Ga0501202_001739 Ga0501202_001739_2272_3462 396
475 3300049660 Ga0501216_003825 Ga0501216_003825_334_1524 396
476 3300049661 Ga0501217_011471 Ga0501217_011471_518_1708 396
477 3300049703 Ga0501219_000741 Ga0501219_000741_1638_2828 396
478 3300049705 Ga0501225_0002225 Ga0501225_0002225_280_1470 396
479 3300049744 Ga0501083_0034230 Ga0501083_0034230_1431_2621 396
480 3300049744 Ga0501083_0057921 Ga0501083_0057921_847_2040 396
481 3300049758 Ga0501241_003408 Ga0501241_003408_195_1385 396
482 3300049763 Ga0501266_003435 Ga0501266_003435_423_1613 396
483 3300049770 Ga0501273_005868 Ga0501273_005868_145_1335 396
484 3300049822 Ga0501035_0007536 Ga0501035_0007536_1396_2586 396
485 3300049822 Ga0501035_0053592 Ga0501035_0053592_1050_2240 396
486 3300049822 Ga0501035_0063174 Ga0501035_0063174_150_1343 396
487 3300049823 Ga0501044_0001962 Ga0501044_0001962_16082_17272 396
488 3300049823 Ga0501044_0028031 Ga0501044_0028031_247_1437 396
489 3300049823 Ga0501044_0259591 Ga0501044_0259591_311_1501 396
490 3300050005 Ga0501284_00087 Ga0501284_00087_7295_8485 396
491 3300050493 nmdc:mga0k408_156129_c1 nmdc:mga0k408_156129_c1_151_1341 396
492 3300050507 nmdc:mga05p37_7694_c1 nmdc:mga05p37_7694_c1_10274_11464 396
493 3300053086 Ga0500578_0000027 Ga0500578_0000027_17011_18201 396
494 3300053090 Ga0500646_0000703 Ga0500646_0000703_6362_7552 396
495 3300053092 Ga0500583_0000042 Ga0500583_0000042_30865_32271 396
496 3300053092 Ga0500583_0097214 Ga0500583_0097214_80_1270 396
497 3300053096 Ga0500641_0003073 Ga0500641_0003073_4067_5284 396
498 3300053103 Ga0500555_012718 Ga0500555_012718_780_1970 396
499 3300053131 Ga0500652_012430 Ga0500652_012430_242_1432 396
500 3300053139 Ga0500568_0016542 Ga0500568_0016542_1874_3064 396
501 3300053146 Ga0500588_0015580 Ga0500588_0015580_705_1895 396
502 3300053151 Ga0500604_0019163 Ga0500604_0019163_106_1296 396
503 3300053156 Ga0500622_0001642 Ga0500622_0001642_8967_10157 396
504 3300053177 Ga0500636_0051112 Ga0500636_0051112_933_2123 396
505 3300053727 Ga0500611_005642 Ga0500611_005642_332_1522 396
506 3300054114 Ga0501084_0024350 Ga0501084_0024350_2083_3276 396
507 3300054114 Ga0501084_0060413 Ga0501084_0060413_744_1934 396
508 3300060353 Ga0501082_0013528 Ga0501082_0013528_159_1349 396
509 3300061719 Ga0466962_0020267 Ga0466962_0020267_382_1572 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

102

460

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8wou-assembly1.cif.gz_B the crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila 0.9823 1 390
6f77-assembly3.cif.gz_F crystal structure of the prephenate aminotransferase from rhizobium meliloti 0.9801 1 396
5wmh-assembly2.cif.gz_C arabidopsis thaliana prephenate aminotransferase 0.9783 1 391
8wkj-assembly1.cif.gz_A-2 the crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila 0.9781 1 390
6f77-assembly3.cif.gz_F crystal structure of the prephenate aminotransferase from rhizobium meliloti 0.9777 1 396
ID Description Score Start End Superfamily
af_A0A0R0HS10_77_301_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9889 61 283 3.40.640.10
6f77C02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9835 62 283 3.40.640.10
af_A0A0R0F159_20_155_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9789 150 283 3.40.640.10
af_Q2FZL1_60_277_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9773 62 280 3.40.640.10
af_A0A0R0HS10_77_301_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9758 61 283 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A831JR42-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9904 169 396 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A1I4QFT7-F1-model_v4 L-aspartate aminotransferase apoenzyme 0.9889 1 396 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A0N0J6V3-F1-model_v4 deleted 0.9877 1 396
AF-B4S8K4-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9874 17 392 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A800ALX5-F1-model_v4 Aminotransferase (EC 2.6.1.-) 0.9872 17 396 GO:0006520
GO:0008483
GO:0009058
GO:0030170

Feature Viewer

pLDDT pTM Quality
95.71 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map