F457013

General Info

Members Datasets Scaffolds Average Seq Length
509 256 485 136

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0652304|Ga0395905_0652304_87_497
Length 129
Sequence MSEAAKKSRPQYSNIHVTQIIQYRMPLAAWVSILHRISGVLMFLLLPFVLYLLEQSLTSEVSFAYLHDIVAHPIAKLVILAHFCAGIRHLFMDMHMGLSKDGSRHSAFSVLAISLFLTLLVALKLFGAY

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 2643221645 Massilia sp. Root351 Isolate Unclassified
5 2643221664 Massilia sp. Root418 Isolate Unclassified
6 2738541280 Massilia sp. GV090 Isolate Unclassified
7 2738541297 Duganella sp. GV083 Isolate Unclassified
8 2738541300 Massilia sp. GV016 Isolate Unclassified
9 2738541357 Duganella sp. GV053 Isolate Unclassified
10 2738543003 Duganella sp. GV066 Isolate Unclassified
11 2738543018 Massilia sp. GV045 Isolate Unclassified
12 2738543026 Duganella sp. GV089 Isolate Unclassified
13 2738543029 Duganella sp. GV039 Isolate Unclassified
14 2738543030 Massilia sp. GV097 Isolate Unclassified
15 2821131069 Duganella sp. 1224 Isolate Unclassified
16 2842711865 Duganella sp. R-73148 Isolate Unclassified
17 2857553236 Duganella sp. R-74557 Isolate Unclassified
18 2857558681 Duganella sp. R-74565 Isolate Unclassified
19 2857564685 Duganella sp. R-74599 Isolate Unclassified
20 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
21 2904424332 Duganella sp. 1411 Isolate Rhizosphere
22 2919476304 Duganella sp. 3397 Isolate Unclassified
23 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
24 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
29 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
35 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
36 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
37 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
40 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
41 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
42 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
44 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
45 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
50 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
51 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
52 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
53 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
55 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
56 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
59 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
112 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
115 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
129 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
130 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
136 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
137 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
140 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
182 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
183 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
184 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
185 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
188 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
238 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
239 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
240 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
241 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
242 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
245 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
246 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
247 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
252 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.68
Metatranscriptomes 10.61
Isolates 4.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.06
Nodule 0.79
Rhizoplane 4.13
Rhizosphere 66.4
Stem 0
Stem Tuber 0
Unclassified 9.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000130 3300002738 Bacteria 59127
2 JGI25154J39366_1000747 3300002738 Bacteria 14585
3 JGI25158J39367_1008480 3300002739 Bacteria 1428
4 JGI25158J39367_1018755 3300002739 Bacteria 855
5 JGI25157J39369_1012983 3300002741 Bacteria 1054
6 JGI25152J39213_1002923 3300002773 Bacteria 6090
7 JGI25159J45721_1006004 3300002987 Bacteria 3711
8 JGI25159J45721_1007311 3300002987 Bacteria 3177
9 JGI25159J45721_1015535 3300002987 Bacteria 1663
10 JGI25153J46596_10031865 3300003215 Bacteria 1767
11 JGI25153J46596_10077179 3300003215 Bacteria 842
12 rootH2_10250728 3300003320 Bacteria 1318
13 rootL2_10125826 3300003322 Bacteria 1263
14 rootH1_10044980 3300003323 Bacteria 1441
15 rootH1_10210929 3300003323 Bacteria 1265
16 JGI25160J50197_1003901 3300003354 Bacteria 6536
17 JGI25161J50226_1004022 3300003374 Bacteria 3177
18 JGI25161J50226_1008087 3300003374 Bacteria 1663
19 JGI25161J50226_1010565 3300003374 Bacteria 1223
20 Ga0007417J51691_1038992 3300003544 Bacteria 1952
21 Ga0007410J51695_1028218 3300003574 Bacteria 3639
22 Ga0007410J51695_1042549 3300003574 Bacteria 4440
23 Ga0007410J51695_1066032 3300003574 Bacteria 1219
24 Ga0007409J51694_1012205 3300003575 Bacteria 6710
25 Ga0007416J51690_1016785 3300003577 Bacteria 6700
26 Ga0007416J51690_1031673 3300003577 Bacteria 509
27 Ga0007411J51799_116327 3300003611 Bacteria 763
28 Ga0007415J51800_118395 3300003613 Unclassified 609
29 Ga0032354_1025073 3300003693 Bacteria 6712
30 Ga0055538_1004527 3300003751 Bacteria 1564
31 Ga0055539_1009001 3300003752 Bacteria 1243
32 Ga0055533_1008336 3300003756 Bacteria 1324
33 Ga0055542_1001575 3300003762 Bacteria 10628
34 Ga0055529_1000095 3300003763 Bacteria 134030
35 Ga0055526_1000066 3300003771 Bacteria 101329
36 Ga0055526_1000158 3300003771 Bacteria 60304
37 Ga0055526_1004314 3300003771 Bacteria 8592
38 Ga0055526_1007455 3300003771 Bacteria 5679
39 Ga0055526_1032179 3300003771 Bacteria 1486
40 Ga0055537_1001124 3300003773 Bacteria 11528
41 Ga0055537_1004930 3300003773 Bacteria 3690
42 Ga0055537_1012068 3300003773 Bacteria 1707
43 Ga0055524_1001075 3300003775 Bacteria 16780
44 Ga0055524_1010843 3300003775 Bacteria 3603
45 Ga0055524_1024564 3300003775 Bacteria 1908
46 Ga0055534_1001481 3300003784 Bacteria 9319
47 Ga0055534_1001729 3300003784 Bacteria 8261
48 Ga0055534_1009940 3300003784 Bacteria 2026
49 Ga0055534_1020126 3300003784 Bacteria 1133
50 Ga0055528_1000089 3300003790 Bacteria 72690
51 Ga0055528_1004116 3300003790 Bacteria 7090
52 Ga0055530_10020486 3300003791 Bacteria 1974
53 Ga0055531_10027502 3300003794 Bacteria 1993
54 Ga0055541_1005193 3300003841 Bacteria 2295
55 Ga0055543_1009953 3300004625 Bacteria 2016
56 Ga0055543_1009954 3300004625 Bacteria 2016
57 Ga0065165_1006735 3300005262 Bacteria 5892
58 Ga0065165_1031911 3300005262 Bacteria 1658
59 Ga0065165_1052259 3300005262 Bacteria 1155
60 Ga0065165_1064998 3300005262 Bacteria 986
61 Ga0065714_10194222 3300005288 Bacteria 917
62 Ga0065715_10012231 3300005293 Bacteria 3045
63 Ga0070670_100174958 3300005331 Bacteria 1863
64 Ga0070671_100474202 3300005355 Bacteria 1075
65 Ga0070662_101557245 3300005457 Bacteria 570
66 Ga0068867_100627626 3300005459 Bacteria 940
67 Ga0075363_100126449 3300006048 Bacteria 1431
68 Ga0075362_10021292 3300006177 Bacteria 2719
69 Ga0068865_100090909 3300006881 Bacteria 2214
70 Ga0079104_1012462 3300006946 Bacteria 2669
71 Ga0099826_10000001 3300006948 Bacteria 1155201
72 Ga0105244_10006792 3300009036 Bacteria 7359
73 Ga0105244_10079456 3300009036 Bacteria 1625
74 Ga0105243_10996842 3300009148 Bacteria 840
75 Ga0105242_10703375 3300009176 Bacteria 989
76 Ga0105246_10513418 3300011119 Bacteria 1020
77 Ga0105246_11052335 3300011119 Bacteria 740
78 Ga0163162_10591688 3300013306 Bacteria 1236
79 Ga0182008_10060071 3300014497 Bacteria 1875
80 Ga0182006_1000117 3300015261 Bacteria 85963
81 Ga0182007_10062254 3300015262 Bacteria 1223
82 Ga0182005_1000041 3300015265 Bacteria 150123
83 Ga0163161_10088163 3300017792 Bacteria 2293
84 Ga0163161_10661875 3300017792 Bacteria 866
85 Ga0163161_10698814 3300017792 Bacteria 844
86 Ga0213872_10000666 3300021361 Bacteria 26015
87 Ga0213872_10010040 3300021361 Bacteria 4517
88 Ga0213872_10235421 3300021361 Bacteria 775
89 Ga0209436_101177 3300025208 Bacteria 9625
90 Ga0209436_122671 3300025208 Bacteria 804
91 Ga0209784_101968 3300025224 Bacteria 2314
92 Ga0209566_102296 3300025225 Bacteria 3698
93 Ga0209674_100264 3300025226 Bacteria 41417
94 Ga0209563_105342 3300025230 Bacteria 2340
95 Ga0209437_102900 3300025233 Bacteria 3204
96 Ga0209437_114442 3300025233 Bacteria 1100
97 Ga0207425_1000001 3300025245 Bacteria 2525432
98 Ga0207425_1000479 3300025245 Bacteria 25399
99 Ga0207425_1001380 3300025245 Bacteria 10272
100 Ga0209646_1000010 3300025246 Bacteria 573803
101 Ga0209646_1000019 3300025246 Bacteria 475248
102 Ga0209026_1007642 3300025250 Bacteria 2387
103 Ga0209148_1000330 3300025254 Bacteria 65396
104 Ga0209759_1001938 3300025256 Bacteria 10059
105 Ga0209129_1000001 3300025258 Bacteria 1452436
106 Ga0209565_1000009 3300025263 Bacteria 751701
107 Ga0209565_1001770 3300025263 Bacteria 8775
108 Ga0209565_1003171 3300025263 Bacteria 5464
109 Ga0209565_1010035 3300025263 Bacteria 2366
110 Ga0209565_1018588 3300025263 Bacteria 1500
111 Ga0209455_1000121 3300025272 Bacteria 173350
112 Ga0209673_1000019 3300025273 Bacteria 449094
113 Ga0209673_1004672 3300025273 Bacteria 7229
114 Ga0209130_1001997 3300025284 Bacteria 11153
115 Ga0209130_1003045 3300025284 Bacteria 7558
116 Ga0209675_1000028 3300025291 Bacteria 281253
117 Ga0209675_1001513 3300025291 Bacteria 13295
118 Ga0209675_1015107 3300025291 Bacteria 2311
119 Ga0209025_1007797 3300025294 Bacteria 7874
120 Ga0209564_1000009 3300025295 Bacteria 950196
121 Ga0209564_1000033 3300025295 Bacteria 446200
122 Ga0209564_1000058 3300025295 Bacteria 332955
123 Ga0209564_1002185 3300025295 Bacteria 16412
124 Ga0209564_1005493 3300025295 Bacteria 7208
125 Ga0209564_1047971 3300025295 Bacteria 1070
126 Ga0209758_1000116 3300025297 Bacteria 198356
127 Ga0209758_1000842 3300025297 Bacteria 42797
128 Ga0209050_1006232 3300025298 Bacteria 7145
129 Ga0209256_1000005 3300025299 Bacteria 1315082
130 Ga0209256_1000052 3300025299 Bacteria 299374
131 Ga0209256_1000872 3300025299 Bacteria 37384
132 Ga0209256_1015166 3300025299 Bacteria 2715
133 Ga0207426_1002443 3300025302 Bacteria 11859
134 Ga0209257_1000107 3300025304 Bacteria 240937
135 Ga0207655_1053621 3300025728 Bacteria 1610
136 Ga0207655_1055441 3300025728 Bacteria 1569
137 Ga0207650_10571129 3300025925 Bacteria 949
138 Ga0207686_10401857 3300025934 Bacteria 1044
139 Ga0207704_10139378 3300025938 Bacteria 1694
140 Ga0207691_10291445 3300025940 Bacteria 1403
141 Ga0207689_10680875 3300025942 Bacteria 867
142 Ga0207648_10404612 3300026089 Bacteria 1237
143 Ga0209281_1009545 3300027111 Bacteria 2274
144 Ga0209282_1000001 3300027666 Bacteria 2450367
145 Ga0307515_10131442 3300028794 Bacteria 2754
146 Ga0316181_1157853 3300030744 Bacteria 2409
147 Ga0316182_1423366 3300030745 Bacteria 531
148 Ga0307513_10218082 3300031456 Bacteria 1732
149 Ga0307408_100010634 3300031548 Bacteria 6071
150 Ga0307408_100054958 3300031548 Bacteria 2880
151 Ga0307408_100178407 3300031548 Bacteria 1701
152 Ga0307518_10005417 3300031838 Bacteria 9125
153 Ga0307412_10305602 3300031911 Bacteria 1259
154 Ga0307412_10390519 3300031911 Bacteria 1130
155 Ga0307412_10835934 3300031911 Bacteria 802
156 Ga0307416_100376152 3300032002 Bacteria 1448
157 Ga0307416_101274979 3300032002 Bacteria 841
158 Ga0307414_10086664 3300032004 Bacteria 2311
159 Ga0307414_11292870 3300032004 Bacteria 677
160 Ga0395899_0210545 3300037312 Bacteria 1351
161 Ga0395900_0337831 3300037418 Bacteria 1482
162 Ga0395898_0115386 3300037466 Bacteria 2573
163 Ga0395905_0014991 3300037471 Bacteria 7391
164 Ga0395905_0176424 3300037471 Bacteria 2006
165 Ga0395905_0652304 3300037471 Bacteria 954
166 Ga0395901_0619568 3300038443 Bacteria 1089
167 Ga0436361_0031202 3300039447 Bacteria 17500
168 Ga0436361_0925614 3300039447 Bacteria 558
169 Ga0436361_0946946 3300039447 Bacteria 1038
170 Ga0436361_0956350 3300039447 Bacteria 1255
171 Ga0439439_0207376 3300041406 Bacteria 571
172 Ga0451833_1265465 3300041491 Bacteria 938
173 Ga0450890_011135 3300042127 Bacteria 1160
174 Ga0439434_0243173 3300042435 Bacteria 614
175 Ga0450893_0012964 3300042532 Bacteria 1387
176 Ga0466965_0138353 3300044683 Bacteria 1266
177 Ga0466970_0850588 3300044765 Bacteria 535
178 Ga0495617_000049 3300046452 Bacteria 113032
179 Ga0495617_010347 3300046452 Bacteria 3196
180 Ga0495617_010848 3300046452 Bacteria 3119
181 Ga0495617_216812 3300046452 Bacteria 595
182 Ga0495627_000055 3300046453 Bacteria 149482
183 Ga0495590_0000003 3300046457 Bacteria 478593
184 Ga0495638_0000091 3300046460 Bacteria 146548
185 Ga0495638_0027695 3300046460 Bacteria 3666
186 Ga0495638_0050470 3300046460 Bacteria 2598
187 Ga0495638_0053769 3300046460 Bacteria 2505
188 Ga0495638_0168371 3300046460 Bacteria 1259
189 Ga0495650_0000097 3300046471 Bacteria 216051
190 Ga0495650_0002039 3300046471 Bacteria 17659
191 Ga0495650_0109621 3300046471 Bacteria 1026
192 Ga0495605_0000248 3300046474 Bacteria 63725
193 Ga0495605_0005259 3300046474 Bacteria 7552
194 Ga0495605_0050304 3300046474 Bacteria 2033
195 Ga0495639_0203201 3300046475 Bacteria 970
196 Ga0495584_0000924 3300046491 Bacteria 18616
197 Ga0495584_0003900 3300046491 Bacteria 8067
198 Ga0495585_0009367 3300046492 Bacteria 5876
199 Ga0495585_0055938 3300046492 Bacteria 2180
200 Ga0495585_0160611 3300046492 Bacteria 1166
201 Ga0495596_0005327 3300046500 Bacteria 6092
202 Ga0495607_0008135 3300046501 Bacteria 7194
203 Ga0495607_0076279 3300046501 Bacteria 1855
204 Ga0495607_0216165 3300046501 Bacteria 940
205 Ga0495607_0364182 3300046501 Bacteria 664
206 Ga0495583_0000155 3300046506 Bacteria 114870
207 Ga0495583_0004737 3300046506 Bacteria 9565
208 Ga0495583_0041750 3300046506 Bacteria 2146
209 Ga0495583_0061981 3300046506 Bacteria 1666
210 Ga0495606_0000141 3300046507 Bacteria 123586
211 Ga0495606_0000152 3300046507 Bacteria 119522
212 Ga0495606_0001575 3300046507 Bacteria 29893
213 Ga0495606_0008580 3300046507 Bacteria 8842
214 Ga0495606_0015878 3300046507 Bacteria 5778
215 Ga0495606_0018064 3300046507 Bacteria 5303
216 Ga0495606_0028316 3300046507 Bacteria 3955
217 Ga0495606_0045886 3300046507 Bacteria 2892
218 Ga0495606_0046399 3300046507 Bacteria 2872
219 Ga0495606_0048380 3300046507 Bacteria 2797
220 Ga0495606_0060224 3300046507 Bacteria 2432
221 Ga0495606_0515741 3300046507 Bacteria 601
222 Ga0495610_0000003 3300046512 Bacteria 1203910
223 Ga0495610_0007317 3300046512 Bacteria 7383
224 Ga0495610_0049877 3300046512 Bacteria 2046
225 Ga0495610_0069326 3300046512 Bacteria 1650
226 Ga0495610_0095651 3300046512 Bacteria 1338
227 Ga0495616_0077399 3300046513 Bacteria 1597
228 Ga0495631_0011618 3300046518 Bacteria 4326
229 Ga0495637_0000881 3300046520 Bacteria 19418
230 Ga0495637_0024309 3300046520 Bacteria 2741
231 Ga0495643_0007039 3300046522 Bacteria 7308
232 Ga0495643_0017465 3300046522 Bacteria 4193
233 Ga0495643_0020177 3300046522 Bacteria 3848
234 Ga0495643_0026091 3300046522 Bacteria 3301
235 Ga0495643_0035832 3300046522 Bacteria 2730
236 Ga0495643_0047044 3300046522 Bacteria 2337
237 Ga0495643_0140118 3300046522 Bacteria 1207
238 Ga0495643_0142790 3300046522 Bacteria 1192
239 Ga0495644_0022520 3300046523 Bacteria 2401
240 Ga0495644_0037999 3300046523 Bacteria 1816
241 Ga0495644_0051520 3300046523 Bacteria 1545
242 Ga0495644_0083516 3300046523 Bacteria 1204
243 Ga0495648_0000058 3300046524 Bacteria 156717
244 Ga0495648_0009549 3300046524 Bacteria 7488
245 Ga0495648_0035816 3300046524 Bacteria 3212
246 Ga0495648_0046270 3300046524 Bacteria 2698
247 Ga0495648_0120179 3300046524 Bacteria 1414
248 Ga0495648_0206272 3300046524 Bacteria 980
249 Ga0495648_0349061 3300046524 Bacteria 676
250 Ga0495663_0046120 3300046525 Bacteria 1338
251 Ga0495642_0008387 3300046528 Bacteria 3955
252 Ga0495642_0046150 3300046528 Bacteria 1782
253 Ga0495642_0105089 3300046528 Bacteria 1204
254 Ga0495642_0303034 3300046528 Bacteria 700
255 Ga0495642_0463352 3300046528 Bacteria 560
256 Ga0495654_0000261 3300046530 Bacteria 47872
257 Ga0495654_0027302 3300046530 Bacteria 2928
258 Ga0495654_0044445 3300046530 Bacteria 2197
259 Ga0495654_0079765 3300046530 Bacteria 1537
260 Ga0495654_0110349 3300046530 Bacteria 1256
261 Ga0495609_0000426 3300046538 Bacteria 35215
262 Ga0495609_0003109 3300046538 Bacteria 9715
263 Ga0495609_0004507 3300046538 Bacteria 7596
264 Ga0495609_0081178 3300046538 Bacteria 1417
265 Ga0495621_0228831 3300046539 Bacteria 754
266 Ga0495597_0001525 3300046542 Bacteria 16468
267 Ga0495597_0007071 3300046542 Bacteria 5745
268 Ga0495597_0012194 3300046542 Bacteria 4153
269 Ga0495597_0175511 3300046542 Bacteria 868
270 Ga0495622_0003320 3300046557 Bacteria 7599
271 Ga0495622_0011541 3300046557 Bacteria 4083
272 Ga0495622_0054625 3300046557 Bacteria 1853
273 Ga0495622_0129193 3300046557 Bacteria 1151
274 Ga0495633_0008936 3300046558 Bacteria 5584
275 Ga0495633_0017946 3300046558 Bacteria 3602
276 Ga0495633_0049603 3300046558 Bacteria 1980
277 Ga0495633_0062839 3300046558 Bacteria 1738
278 Ga0495633_0083747 3300046558 Bacteria 1484
279 Ga0495633_0105305 3300046558 Bacteria 1308
280 Ga0495633_0138280 3300046558 Bacteria 1126
281 Ga0495656_0193101 3300046615 Bacteria 1006
282 Ga0495656_0525756 3300046615 Bacteria 629
283 Ga0495668_0000063 3300046616 Bacteria 184563
284 Ga0495668_0002731 3300046616 Bacteria 14134
285 Ga0495668_0007441 3300046616 Bacteria 6995
286 Ga0495668_0007548 3300046616 Bacteria 6939
287 Ga0495668_0008482 3300046616 Bacteria 6405
288 Ga0495668_0033416 3300046616 Bacteria 2890
289 Ga0495668_0059353 3300046616 Bacteria 2111
290 Ga0495611_0035193 3300046648 Bacteria 2217
291 Ga0495611_0045571 3300046648 Bacteria 1964
292 Ga0495611_0557852 3300046648 Bacteria 518
293 Ga0495625_0017675 3300046660 Bacteria 5580
294 Ga0495625_0027829 3300046660 Bacteria 4248
295 Ga0495625_0041908 3300046660 Bacteria 3329
296 Ga0495625_0049883 3300046660 Bacteria 3006
297 Ga0495625_0064954 3300046660 Bacteria 2573
298 Ga0495625_0109698 3300046660 Bacteria 1887
299 Ga0495625_0154783 3300046660 Bacteria 1539
300 Ga0495625_0458175 3300046660 Bacteria 786
301 Ga0495659_0000073 3300046664 Bacteria 42850
302 Ga0495659_0006944 3300046664 Bacteria 3583
303 Ga0495659_0007441 3300046664 Bacteria 3474
304 Ga0495659_0119364 3300046664 Bacteria 1037
305 Ga0495661_0013094 3300046665 Bacteria 5581
306 Ga0495661_0037553 3300046665 Bacteria 3023
307 Ga0495661_0063510 3300046665 Bacteria 2182
308 Ga0495661_0102507 3300046665 Bacteria 1608
309 Ga0495588_0013666 3300046674 Bacteria 3870
310 Ga0495588_0148549 3300046674 Bacteria 1238
311 Ga0495669_0005823 3300046684 Bacteria 5141
312 Ga0495670_0297573 3300046691 Bacteria 864
313 Ga0495670_0489487 3300046691 Bacteria 668
314 Ga0495670_0492743 3300046691 Bacteria 665
315 Ga0495671_0000001 3300046692 Bacteria 1169494
316 Ga0495671_0000309 3300046692 Bacteria 41290
317 Ga0495671_0010548 3300046692 Bacteria 5111
318 Ga0495671_0085223 3300046692 Bacteria 1548
319 Ga0495649_0021357 3300046694 Bacteria 3627
320 Ga0495649_0028389 3300046694 Bacteria 3101
321 Ga0495649_0046758 3300046694 Bacteria 2356
322 Ga0495649_0100778 3300046694 Bacteria 1535
323 Ga0495649_0445263 3300046694 Bacteria 647
324 Ga0495589_0061166 3300046794 Bacteria 1849
325 Ga0495589_0164440 3300046794 Bacteria 1056
326 Ga0495660_0021513 3300046810 Bacteria 3693
327 Ga0495660_0023684 3300046810 Bacteria 3502
328 Ga0495660_0073188 3300046810 Bacteria 1813
329 Ga0495660_0126249 3300046810 Bacteria 1288
330 Ga0495636_0001622 3300047318 Bacteria 8558
331 Ga0495636_0007644 3300047318 Bacteria 4251
332 Ga0495636_0011164 3300047318 Bacteria 3553
333 Ga0495636_0021538 3300047318 Bacteria 2603
334 Ga0495636_0032135 3300047318 Bacteria 2152
335 Ga0495636_0102158 3300047318 Bacteria 1255
336 Ga0495636_0126082 3300047318 Bacteria 1136
337 Ga0495636_0379945 3300047318 Bacteria 670
338 Ga0495636_0541452 3300047318 Bacteria 566
339 Ga0495672_0000176 3300047320 Bacteria 92728
340 Ga0495672_0000263 3300047320 Bacteria 72879
341 Ga0495672_0050654 3300047320 Bacteria 2449
342 Ga0495672_0270259 3300047320 Bacteria 816
343 Ga0495676_0087321 3300047321 Bacteria 2344
344 Ga0495683_0039174 3300047323 Bacteria 2396
345 Ga0495683_0303487 3300047323 Bacteria 685
346 Ga0495687_000296 3300047443 Bacteria 65626
347 Ga0495687_005542 3300047443 Bacteria 8006
348 Ga0495687_008783 3300047443 Bacteria 5734
349 Ga0495687_020138 3300047443 Bacteria 3257
350 Ga0495687_032760 3300047443 Bacteria 2367
351 Ga0495687_106730 3300047443 Bacteria 1038
352 Ga0495677_0001373 3300047445 Bacteria 9736
353 Ga0495677_0006058 3300047445 Bacteria 4572
354 Ga0495677_0120170 3300047445 Bacteria 1002
355 Ga0495677_0135437 3300047445 Bacteria 944
356 Ga0495679_009450 3300047446 Bacteria 3902
357 Ga0495685_000250 3300047447 Bacteria 18582
358 Ga0495685_007493 3300047447 Bacteria 3604
359 Ga0495685_073871 3300047447 Bacteria 1140
360 Ga0495673_0000006 3300047469 Bacteria 908691
361 Ga0495673_0000024 3300047469 Bacteria 521349
362 Ga0495673_0000049 3300047469 Bacteria 265878
363 Ga0495673_0007809 3300047469 Bacteria 6092
364 Ga0495673_0015916 3300047469 Bacteria 3859
365 Ga0495681_0025094 3300047470 Bacteria 3124
366 Ga0495681_0027938 3300047470 Bacteria 2911
367 Ga0495686_0022789 3300047472 Bacteria 4139
368 Ga0495686_0025509 3300047472 Bacteria 3874
369 Ga0495686_0041667 3300047472 Bacteria 2922
370 Ga0495686_0062331 3300047472 Bacteria 2313
371 Ga0495686_0227016 3300047472 Bacteria 1059
372 Ga0495615_0005881 3300048090 Bacteria 2237
373 Ga0495626_0091381 3300048091 Bacteria 1338
374 Ga0496100_0262825 3300048903 Bacteria 1280
375 Ga0496101_0253033 3300048904 Bacteria 1373
376 Ga0496102_0034285 3300048905 Bacteria 4564
377 Ga0496102_0037864 3300048905 Bacteria 4351
378 Ga0496102_0097127 3300048905 Bacteria 2732
379 Ga0496102_0708473 3300048905 Bacteria 929
380 Ga0496103_0002220 3300048906 Bacteria 12303
381 Ga0496103_0043004 3300048906 Bacteria 2781
382 Ga0496103_0152808 3300048906 Bacteria 1479
383 Ga0496104_0092571 3300048907 Bacteria 2890
384 Ga0496104_0212720 3300048907 Bacteria 1845
385 Ga0496105_0399390 3300048908 Bacteria 1091
386 Ga0496106_0105061 3300048909 Bacteria 2194
387 Ga0496109_0070983 3300048912 Bacteria 3196
388 Ga0496110_0186126 3300048913 Bacteria 1885
389 Ga0496111_0012600 3300048914 Bacteria 5730
390 Ga0496111_0236740 3300048914 Bacteria 1356
391 Ga0496114_0171677 3300048917 Bacteria 1890
392 Ga0496114_0269231 3300048917 Bacteria 1501
393 Ga0496115_0472227 3300048918 Bacteria 1011
394 Ga0496116_0037867 3300048919 Bacteria 3357
395 Ga0496117_0000001 3300048920 Bacteria 2526244
396 Ga0496118_0000078 3300048921 Bacteria 190946
397 Ga0496119_0114008 3300048922 Bacteria 1496
398 Ga0496121_0008619 3300048924 Bacteria 11936
399 Ga0496121_0195051 3300048924 Bacteria 1448
400 Ga0496121_0398881 3300048924 Bacteria 902
401 Ga0496122_0054686 3300048925 Bacteria 2995
402 Ga0496123_0014321 3300048926 Bacteria 6582
403 Ga0496123_0050713 3300048926 Bacteria 2770
404 Ga0496124_0056704 3300048927 Bacteria 3303
405 Ga0496125_0003517 3300048928 Bacteria 18904
406 Ga0496125_0033319 3300048928 Bacteria 4559
407 Ga0496126_0020682 3300048929 Bacteria 6446
408 Ga0496126_0445502 3300048929 Bacteria 1043
409 Ga0501306_010745 3300049127 Bacteria 1157
410 Ga0501308_005670 3300049128 Bacteria 1253
411 Ga0501308_025541 3300049128 Bacteria 766
412 Ga0501309_007823 3300049129 Bacteria 1332
413 Ga0501310_004803 3300049130 Bacteria 1369
414 Ga0501310_045874 3300049130 Bacteria 621
415 Ga0501344_01815 3300049133 Bacteria 1062
416 Ga0501304_003517 3300049160 Bacteria 1152
417 Ga0501305_009614 3300049161 Bacteria 1275
418 Ga0501305_100798 3300049161 Bacteria 537
419 Ga0501307_005000 3300049162 Bacteria 1380
420 Ga0501307_013506 3300049162 Bacteria 987
421 Ga0501307_037243 3300049162 Bacteria 696
422 Ga0495678_000155 3300049459 Bacteria 81324
423 Ga0495678_010317 3300049459 Bacteria 4548
424 Ga0495678_018497 3300049459 Bacteria 3131
425 Ga0495678_031280 3300049459 Bacteria 2220
426 Ga0495678_062484 3300049459 Bacteria 1394
427 Ga0495678_086229 3300049459 Bacteria 1116
428 Ga0495678_144091 3300049459 Bacteria 776
429 Ga0495678_167940 3300049459 Bacteria 696
430 Ga0495682_0040194 3300049460 Bacteria 1715
431 Ga0495682_0042543 3300049460 Bacteria 1664
432 Ga0495682_0083346 3300049460 Bacteria 1149
433 Ga0501311_004873 3300049527 Bacteria 1446
434 Ga0501311_010471 3300049527 Bacteria 1126
435 Ga0501312_021418 3300049528 Bacteria 962
436 Ga0501312_077136 3300049528 Bacteria 598
437 Ga0501313_037848 3300049529 Bacteria 642
438 Ga0501313_047452 3300049529 Bacteria 588
439 Ga0501314_008454 3300049530 Bacteria 931
440 Ga0501315_009567 3300049531 Bacteria 1149
441 Ga0501315_009856 3300049531 Bacteria 1137
442 Ga0501315_022636 3300049531 Bacteria 858
443 Ga0501315_053271 3300049531 Bacteria 640
444 Ga0501315_059210 3300049531 Bacteria 616
445 Ga0501315_059427 3300049531 Bacteria 616
446 Ga0501316_002775 3300049532 Bacteria 1648
447 Ga0501316_031771 3300049532 Bacteria 709
448 Ga0501316_033058 3300049532 Bacteria 699
449 Ga0501316_069332 3300049532 Bacteria 532
450 Ga0501318_006362 3300049534 Bacteria 1204
451 Ga0501319_021966 3300049535 Bacteria 577
452 Ga0501319_022711 3300049535 Bacteria 570
453 Ga0501321_041631 3300049537 Bacteria 648
454 Ga0501323_009474 3300049539 Bacteria 1148
455 Ga0501323_054396 3300049539 Bacteria 614
456 Ga0501325_022604 3300049541 Bacteria 673
457 Ga0501326_14042 3300049542 Bacteria 503
458 Ga0501328_00978 3300049544 Bacteria 1072
459 Ga0501329_07090 3300049545 Bacteria 651
460 Ga0501335_007630 3300049551 Bacteria 1004
461 Ga0501335_028288 3300049551 Bacteria 625
462 Ga0501336_019311 3300049552 Bacteria 610
463 Ga0501211_009179 3300049658 Bacteria 968
464 Ga0501227_058541 3300049665 Bacteria 983
465 Ga0501230_013692 3300049667 Bacteria 1319
466 Ga0501235_036607 3300049669 Bacteria 1116
467 Ga0501238_004582 3300049671 Bacteria 1732
468 Ga0501248_025484 3300049678 Bacteria 643
469 Ga0501249_002398 3300049679 Bacteria 3787
470 Ga0501219_002983 3300049703 Bacteria 1251
471 Ga0501263_063025 3300049760 Bacteria 585
472 Ga0501269_000168 3300049766 Bacteria 20001
473 Ga0501279_001743 3300049775 Bacteria 2863
474 Ga0501279_005098 3300049775 Bacteria 1723
475 nmdc:mga03683_13644_c1 3300050489 Bacteria 2995
476 nmdc:mga03n38_54782_c1 3300050490 Bacteria 1794
477 nmdc:mga0k408_286418_c1 3300050493 Bacteria 983
478 Ga0500594_0171728 3300053118 Bacteria 704
479 Ga0500618_000786 3300053125 Bacteria 17782
480 Ga0500618_031806 3300053125 Bacteria 1236
481 Ga0500618_104668 3300053125 Bacteria 638
482 Ga0500559_0271076 3300053136 Bacteria 799
483 Ga0500586_009115 3300053145 Bacteria 2737
484 Ga0500622_0103027 3300053156 Bacteria 1403
485 Ga0587083_0269298 3300059505 Bacteria 514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049542 Ga0501326_14042 Ga0501326_14042_13_363 116
2 3300047318 Ga0495636_0541452 Ga0495636_0541452_198_551 117
3 3300047472 Ga0495686_0041667 Ga0495686_0041667_656_1078 118
4 3300031548 Ga0307408_100178407 Ga0307408_1001784072 119
5 3300049531 Ga0501315_059427 Ga0501315_059427_155_577 120
6 3300002773 JGI25152J39213_1002923 JGI25152J39213_10029233 121
7 3300003215 JGI25153J46596_10031865 JGI25153J46596_100318653 121
8 3300006946 Ga0079104_1012462 Ga0079104_10124623 121
9 3300009148 Ga0105243_10996842 Ga0105243_109968422 121
10 3300015261 Ga0182006_1000117 Ga0182006_100011724 121
11 3300015262 Ga0182007_10062254 Ga0182007_100622541 121
12 3300015265 Ga0182005_1000041 Ga0182005_1000041125 121
13 3300025245 Ga0207425_1000001 Ga0207425_10000011736 121
14 3300025245 Ga0207425_1001380 Ga0207425_10013806 121
15 3300025258 Ga0209129_1000001 Ga0209129_1000001913 121
16 3300025297 Ga0209758_1000116 Ga0209758_1000116174 121
17 3300027111 Ga0209281_1009545 Ga0209281_10095452 121
18 3300046453 Ga0495627_000055 Ga0495627_000055_27052_27474 121
19 3300046460 Ga0495638_0053769 Ga0495638_0053769_789_1211 121
20 3300046491 Ga0495584_0000924 Ga0495584_0000924_4081_4503 121
21 3300046501 Ga0495607_0008135 Ga0495607_0008135_742_1164 121
22 3300046506 Ga0495583_0061981 Ga0495583_0061981_345_767 121
23 3300046513 Ga0495616_0077399 Ga0495616_0077399_691_1113 121
24 3300046522 Ga0495643_0026091 Ga0495643_0026091_556_978 121
25 3300046523 Ga0495644_0037999 Ga0495644_0037999_853_1275 121
26 3300046524 Ga0495648_0120179 Ga0495648_0120179_624_1046 121
27 3300046530 Ga0495654_0110349 Ga0495654_0110349_285_707 121
28 3300046538 Ga0495609_0000426 Ga0495609_0000426_4035_4457 121
29 3300046538 Ga0495609_0004507 Ga0495609_0004507_775_1197 121
30 3300046616 Ga0495668_0008482 Ga0495668_0008482_2105_2527 121
31 3300046660 Ga0495625_0041908 Ga0495625_0041908_2155_2577 121
32 3300046664 Ga0495659_0007441 Ga0495659_0007441_2039_2461 121
33 3300046665 Ga0495661_0063510 Ga0495661_0063510_1335_1757 121
34 3300046684 Ga0495669_0005823 Ga0495669_0005823_4375_4797 121
35 3300046692 Ga0495671_0085223 Ga0495671_0085223_235_657 121
36 3300046694 Ga0495649_0021357 Ga0495649_0021357_1973_2395 121
37 3300046810 Ga0495660_0023684 Ga0495660_0023684_1517_1939 121
38 3300046810 Ga0495660_0073188 Ga0495660_0073188_627_1049 121
39 3300047318 Ga0495636_0011164 Ga0495636_0011164_2104_2526 121
40 3300047443 Ga0495687_008783 Ga0495687_008783_2457_2879 121
41 3300047445 Ga0495677_0001373 Ga0495677_0001373_3984_4406 121
42 3300047447 Ga0495685_007493 Ga0495685_007493_1769_2191 121
43 3300047470 Ga0495681_0025094 Ga0495681_0025094_1885_2307 121
44 3300047470 Ga0495681_0027938 Ga0495681_0027938_1170_1592 121
45 3300049459 Ga0495678_000155 Ga0495678_000155_76592_77014 121
46 3300002739 JGI25158J39367_1008480 JGI25158J39367_10084801 122
47 3300002987 JGI25159J45721_1007311 JGI25159J45721_10073111 122
48 3300002987 JGI25159J45721_1015535 JGI25159J45721_10155353 122
49 3300003354 JGI25160J50197_1003901 JGI25160J50197_10039016 122
50 3300003374 JGI25161J50226_1004022 JGI25161J50226_10040221 122
51 3300003374 JGI25161J50226_1008087 JGI25161J50226_10080873 122
52 3300003771 Ga0055526_1007455 Ga0055526_10074555 122
53 3300003771 Ga0055526_1032179 Ga0055526_10321792 122
54 3300003773 Ga0055537_1004930 Ga0055537_10049302 122
55 3300003773 Ga0055537_1012068 Ga0055537_10120682 122
56 3300003775 Ga0055524_1024564 Ga0055524_10245643 122
57 3300003784 Ga0055534_1009940 Ga0055534_10099403 122
58 3300003784 Ga0055534_1020126 Ga0055534_10201262 122
59 3300003790 Ga0055528_1004116 Ga0055528_10041164 122
60 3300003791 Ga0055530_10020486 Ga0055530_100204862 122
61 3300003794 Ga0055531_10027502 Ga0055531_100275023 122
62 3300004625 Ga0055543_1009953 Ga0055543_10099532 122
63 3300004625 Ga0055543_1009954 Ga0055543_10099542 122
64 3300005262 Ga0065165_1031911 Ga0065165_10319112 122
65 3300005262 Ga0065165_1064998 Ga0065165_10649982 122
66 3300025208 Ga0209436_101177 Ga0209436_1011776 122
67 3300025263 Ga0209565_1001770 Ga0209565_10017707 122
68 3300025263 Ga0209565_1003171 Ga0209565_10031714 122
69 3300025263 Ga0209565_1010035 Ga0209565_10100353 122
70 3300025273 Ga0209673_1004672 Ga0209673_10046726 122
71 3300025284 Ga0209130_1001997 Ga0209130_10019976 122
72 3300025291 Ga0209675_1001513 Ga0209675_10015137 122
73 3300025291 Ga0209675_1015107 Ga0209675_10151072 122
74 3300025295 Ga0209564_1002185 Ga0209564_100218513 122
75 3300025295 Ga0209564_1005493 Ga0209564_10054936 122
76 3300025298 Ga0209050_1006232 Ga0209050_10062326 122
77 3300025299 Ga0209256_1000872 Ga0209256_100087236 122
78 3300025299 Ga0209256_1015166 Ga0209256_10151663 122
79 3300025302 Ga0207426_1002443 Ga0207426_10024436 122
80 3300025304 Ga0209257_1000107 Ga0209257_10001076 122
81 3300031548 Ga0307408_100054958 Ga0307408_1000549583 122
82 3300042532 Ga0450893_0012964 Ga0450893_0012964_373_795 122
83 3300049127 Ga0501306_010745 Ga0501306_010745_549_971 122
84 3300049128 Ga0501308_025541 Ga0501308_025541_141_563 122
85 3300049129 Ga0501309_007823 Ga0501309_007823_275_697 122
86 3300049133 Ga0501344_01815 Ga0501344_01815_455_877 122
87 3300049161 Ga0501305_009614 Ga0501305_009614_89_511 122
88 3300049162 Ga0501307_005000 Ga0501307_005000_361_783 122
89 3300049162 Ga0501307_013506 Ga0501307_013506_306_728 122
90 3300049527 Ga0501311_004873 Ga0501311_004873_425_847 122
91 3300049528 Ga0501312_021418 Ga0501312_021418_94_516 122
92 3300049530 Ga0501314_008454 Ga0501314_008454_491_913 122
93 3300049531 Ga0501315_009856 Ga0501315_009856_304_726 122
94 3300049532 Ga0501316_069332 Ga0501316_069332_36_458 122
95 3300049534 Ga0501318_006362 Ga0501318_006362_201_623 122
96 3300049551 Ga0501335_007630 Ga0501335_007630_510_932 122
97 3300049665 Ga0501227_058541 Ga0501227_058541_215_637 122
98 3300049775 Ga0501279_001743 Ga0501279_001743_1732_2154 122
99 3300011119 Ga0105246_10513418 Ga0105246_105134182 124
100 3300003771 Ga0055526_1004314 Ga0055526_10043148 125
101 3300003773 Ga0055537_1001124 Ga0055537_10011243 125
102 3300003775 Ga0055524_1010843 Ga0055524_10108434 125
103 3300003784 Ga0055534_1001481 Ga0055534_10014817 125
104 3300003784 Ga0055534_1001729 Ga0055534_10017298 125
105 3300003790 Ga0055528_1000089 Ga0055528_100008957 125
106 3300025263 Ga0209565_1000009 Ga0209565_1000009178 125
107 3300025273 Ga0209673_1000019 Ga0209673_1000019204 125
108 3300025291 Ga0209675_1000028 Ga0209675_1000028152 125
109 3300025295 Ga0209564_1000058 Ga0209564_1000058142 125
110 3300025299 Ga0209256_1000052 Ga0209256_100005212 125
111 3300047318 Ga0495636_0102158 Ga0495636_0102158_207_629 125
112 3300048904 Ga0496101_0253033 Ga0496101_0253033_388_810 125
113 3300046616 Ga0495668_0000063 Ga0495668_0000063_801_1223 126
114 3300049459 Ga0495678_167940 Ga0495678_167940_120_542 126
115 3300047472 Ga0495686_0025509 Ga0495686_0025509_758_1180 127
116 3300041406 Ga0439439_0207376 Ga0439439_0207376_93_515 128
117 3300042127 Ga0450890_011135 Ga0450890_011135_433_855 128
118 3300042435 Ga0439434_0243173 Ga0439434_0243173_121_543 128
119 3300046507 Ga0495606_0046399 Ga0495606_0046399_673_1095 128
120 3300046512 Ga0495610_0007317 Ga0495610_0007317_3861_4283 128
121 3300049658 Ga0501211_009179 Ga0501211_009179_75_497 128
122 3300049678 Ga0501248_025484 Ga0501248_025484_62_484 128
123 3300003577 Ga0007416J51690_1031673 Ga0007416J51690_10316731 129
124 3300032002 Ga0307416_100376152 Ga0307416_1003761522 129
125 3300037471 Ga0395905_0652304 Ga0395905_0652304_87_497 129
126 3300049760 Ga0501263_063025 Ga0501263_063025_74_496 129
127 3300049775 Ga0501279_005098 Ga0501279_005098_1279_1701 129
128 3300046522 Ga0495643_0047044 Ga0495643_0047044_1382_1798 134
129 3300046694 Ga0495649_0100778 Ga0495649_0100778_880_1296 134
130 3300049703 Ga0501219_002983 Ga0501219_002983_760_1176 134
131 iso_pu_bacteria 2600255292 2601667358 134
132 iso_pu_bacteria 2643221554 2643787381 134
133 iso_pu_bacteria 2643221638 2644214104 134
134 iso_pu_bacteria 2643221645 2644252404 134
135 iso_pu_bacteria 2643221664 2644357096 134
136 iso_pu_bacteria 2738541280 2738741563 134
137 iso_pu_bacteria 2738541297 2738829596 134
138 iso_pu_bacteria 2738541300 2738843818 134
139 iso_pu_bacteria 2738541357 2739153392 134
140 iso_pu_bacteria 2738543003 2739195312 134
141 iso_pu_bacteria 2738543018 2739277643 134
142 iso_pu_bacteria 2738543026 2739321788 134
143 iso_pu_bacteria 2738543029 2739339656 134
144 iso_pu_bacteria 2738543030 2739346672 134
145 iso_pu_bacteria 2821131069 2821131234 134
146 iso_pu_bacteria 2842711865 2842714427 134
147 iso_pu_bacteria 2857553236 2857554126 134
148 iso_pu_bacteria 2857558681 2857561541 134
149 iso_pu_bacteria 2857564685 2857565093 134
150 iso_pu_bacteria 2885080285 2885083652 134
151 iso_pu_bacteria 2904424332 2904426413 134
152 iso_pu_bacteria 2919476304 2919478743 134
153 iso_pu_bacteria 2932410948 2932410976 134
154 iso_pu_bacteria 2932416698 2932419457 134
155 3300003574 Ga0007410J51695_1066032 Ga0007410J51695_10660321 135
156 3300003611 Ga0007411J51799_116327 Ga0007411J51799_1163271 135
157 3300031548 Ga0307408_100010634 Ga0307408_1000106343 135
158 3300044683 Ga0466965_0138353 Ga0466965_0138353_168_587 135
159 3300046691 Ga0495670_0492743 Ga0495670_0492743_160_582 135
160 3300049529 Ga0501313_037848 Ga0501313_037848_122_541 135
161 3300049531 Ga0501315_059210 Ga0501315_059210_57_476 135
162 3300049532 Ga0501316_033058 Ga0501316_033058_106_525 135
163 3300049667 Ga0501230_013692 Ga0501230_013692_648_1067 135
164 3300059505 Ga0587083_0269298 Ga0587083_0269298_74_493 135
165 3300002738 JGI25154J39366_1000130 JGI25154J39366_100013051 136
166 3300002738 JGI25154J39366_1000747 JGI25154J39366_10007472 136
167 3300002739 JGI25158J39367_1018755 JGI25158J39367_10187551 136
168 3300002741 JGI25157J39369_1012983 JGI25157J39369_10129832 136
169 3300002987 JGI25159J45721_1006004 JGI25159J45721_10060043 136
170 3300003215 JGI25153J46596_10077179 JGI25153J46596_100771792 136
171 3300003320 rootH2_10250728 rootH2_102507282 136
172 3300003322 rootL2_10125826 rootL2_101258261 136
173 3300003323 rootH1_10044980 rootH1_100449802 136
174 3300003323 rootH1_10210929 rootH1_102109292 136
175 3300003374 JGI25161J50226_1010565 JGI25161J50226_10105652 136
176 3300003544 Ga0007417J51691_1038992 Ga0007417J51691_10389922 136
177 3300003574 Ga0007410J51695_1028218 Ga0007410J51695_10282181 136
178 3300003574 Ga0007410J51695_1042549 Ga0007410J51695_10425492 136
179 3300003575 Ga0007409J51694_1012205 Ga0007409J51694_10122053 136
180 3300003577 Ga0007416J51690_1016785 Ga0007416J51690_10167853 136
181 3300003613 Ga0007415J51800_118395 Ga0007415J51800_1183951 136
182 3300003693 Ga0032354_1025073 Ga0032354_10250733 136
183 3300003751 Ga0055538_1004527 Ga0055538_10045271 136
184 3300003752 Ga0055539_1009001 Ga0055539_10090012 136
185 3300003756 Ga0055533_1008336 Ga0055533_10083362 136
186 3300003762 Ga0055542_1001575 Ga0055542_10015751 136
187 3300003763 Ga0055529_1000095 Ga0055529_100009571 136
188 3300003771 Ga0055526_1000066 Ga0055526_100006692 136
189 3300003771 Ga0055526_1000158 Ga0055526_10001584 136
190 3300003775 Ga0055524_1001075 Ga0055524_10010756 136
191 3300003841 Ga0055541_1005193 Ga0055541_10051932 136
192 3300005262 Ga0065165_1006735 Ga0065165_10067353 136
193 3300005262 Ga0065165_1052259 Ga0065165_10522591 136
194 3300005288 Ga0065714_10194222 Ga0065714_101942222 136
195 3300005293 Ga0065715_10012231 Ga0065715_100122313 136
196 3300005331 Ga0070670_100174958 Ga0070670_1001749581 136
197 3300005355 Ga0070671_100474202 Ga0070671_1004742021 136
198 3300005457 Ga0070662_101557245 Ga0070662_1015572451 136
199 3300005459 Ga0068867_100627626 Ga0068867_1006276262 136
200 3300006048 Ga0075363_100126449 Ga0075363_1001264492 136
201 3300006177 Ga0075362_10021292 Ga0075362_100212923 136
202 3300006881 Ga0068865_100090909 Ga0068865_1000909092 136
203 3300006948 Ga0099826_10000001 Ga0099826_100000011074 136
204 3300009036 Ga0105244_10006792 Ga0105244_100067926 136
205 3300009036 Ga0105244_10079456 Ga0105244_100794563 136
206 3300009176 Ga0105242_10703375 Ga0105242_107033751 136
207 3300011119 Ga0105246_11052335 Ga0105246_110523352 136
208 3300013306 Ga0163162_10591688 Ga0163162_105916881 136
209 3300014497 Ga0182008_10060071 Ga0182008_100600712 136
210 3300017792 Ga0163161_10088163 Ga0163161_100881633 136
211 3300017792 Ga0163161_10661875 Ga0163161_106618751 136
212 3300017792 Ga0163161_10698814 Ga0163161_106988141 136
213 3300021361 Ga0213872_10000666 Ga0213872_100006665 136
214 3300021361 Ga0213872_10010040 Ga0213872_100100403 136
215 3300021361 Ga0213872_10235421 Ga0213872_102354211 136
216 3300025208 Ga0209436_122671 Ga0209436_1226712 136
217 3300025224 Ga0209784_101968 Ga0209784_1019682 136
218 3300025225 Ga0209566_102296 Ga0209566_1022963 136
219 3300025226 Ga0209674_100264 Ga0209674_10026441 136
220 3300025230 Ga0209563_105342 Ga0209563_1053422 136
221 3300025233 Ga0209437_102900 Ga0209437_1029003 136
222 3300025233 Ga0209437_114442 Ga0209437_1144422 136
223 3300025245 Ga0207425_1000479 Ga0207425_100047919 136
224 3300025246 Ga0209646_1000010 Ga0209646_1000010456 136
225 3300025246 Ga0209646_1000019 Ga0209646_1000019351 136
226 3300025250 Ga0209026_1007642 Ga0209026_10076423 136
227 3300025254 Ga0209148_1000330 Ga0209148_100033068 136
228 3300025256 Ga0209759_1001938 Ga0209759_10019383 136
229 3300025263 Ga0209565_1018588 Ga0209565_10185882 136
230 3300025272 Ga0209455_1000121 Ga0209455_100012179 136
231 3300025284 Ga0209130_1003045 Ga0209130_10030456 136
232 3300025294 Ga0209025_1007797 Ga0209025_10077977 136
233 3300025295 Ga0209564_1000009 Ga0209564_1000009550 136
234 3300025295 Ga0209564_1000033 Ga0209564_100003346 136
235 3300025295 Ga0209564_1047971 Ga0209564_10479713 136
236 3300025297 Ga0209758_1000842 Ga0209758_100084227 136
237 3300025299 Ga0209256_1000005 Ga0209256_1000005545 136
238 3300025728 Ga0207655_1053621 Ga0207655_10536213 136
239 3300025728 Ga0207655_1055441 Ga0207655_10554412 136
240 3300025925 Ga0207650_10571129 Ga0207650_105711292 136
241 3300025934 Ga0207686_10401857 Ga0207686_104018571 136
242 3300025938 Ga0207704_10139378 Ga0207704_101393782 136
243 3300025940 Ga0207691_10291445 Ga0207691_102914453 136
244 3300025942 Ga0207689_10680875 Ga0207689_106808752 136
245 3300026089 Ga0207648_10404612 Ga0207648_104046122 136
246 3300027666 Ga0209282_1000001 Ga0209282_10000012198 136
247 3300028794 Ga0307515_10131442 Ga0307515_101314423 136
248 3300030744 Ga0316181_1157853 Ga0316181_11578533 136
249 3300030745 Ga0316182_1423366 Ga0316182_14233661 136
250 3300031456 Ga0307513_10218082 Ga0307513_102180822 136
251 3300031838 Ga0307518_10005417 Ga0307518_100054172 136
252 3300031911 Ga0307412_10305602 Ga0307412_103056023 136
253 3300031911 Ga0307412_10390519 Ga0307412_103905192 136
254 3300031911 Ga0307412_10835934 Ga0307412_108359341 136
255 3300032002 Ga0307416_101274979 Ga0307416_1012749792 136
256 3300032004 Ga0307414_10086664 Ga0307414_100866642 136
257 3300032004 Ga0307414_11292870 Ga0307414_112928701 136
258 3300037312 Ga0395899_0210545 Ga0395899_0210545_409_819 136
259 3300037418 Ga0395900_0337831 Ga0395900_0337831_1001_1411 136
260 3300037466 Ga0395898_0115386 Ga0395898_0115386_572_982 136
261 3300037471 Ga0395905_0014991 Ga0395905_0014991_6935_7345 136
262 3300037471 Ga0395905_0176424 Ga0395905_0176424_958_1368 136
263 3300038443 Ga0395901_0619568 Ga0395901_0619568_61_471 136
264 3300039447 Ga0436361_0031202 Ga0436361_0031202_15887_16309 136
265 3300039447 Ga0436361_0925614 Ga0436361_0925614_28_450 136
266 3300039447 Ga0436361_0946946 Ga0436361_0946946_89_511 136
267 3300039447 Ga0436361_0956350 Ga0436361_0956350_191_613 136
268 3300041491 Ga0451833_1265465 Ga0451833_1265465_506_928 136
269 3300044765 Ga0466970_0850588 Ga0466970_0850588_84_506 136
270 3300046452 Ga0495617_000049 Ga0495617_000049_4089_4511 136
271 3300046452 Ga0495617_010347 Ga0495617_010347_2105_2527 136
272 3300046452 Ga0495617_010848 Ga0495617_010848_1696_2118 136
273 3300046452 Ga0495617_216812 Ga0495617_216812_111_533 136
274 3300046457 Ga0495590_0000003 Ga0495590_0000003_475693_476115 136
275 3300046460 Ga0495638_0000091 Ga0495638_0000091_37925_38347 136
276 3300046460 Ga0495638_0027695 Ga0495638_0027695_1050_1472 136
277 3300046460 Ga0495638_0050470 Ga0495638_0050470_383_805 136
278 3300046460 Ga0495638_0168371 Ga0495638_0168371_205_627 136
279 3300046471 Ga0495650_0000097 Ga0495650_0000097_4205_4627 136
280 3300046471 Ga0495650_0002039 Ga0495650_0002039_16017_16439 136
281 3300046471 Ga0495650_0109621 Ga0495650_0109621_43_465 136
282 3300046474 Ga0495605_0000248 Ga0495605_0000248_59153_59575 136
283 3300046474 Ga0495605_0005259 Ga0495605_0005259_1235_1657 136
284 3300046474 Ga0495605_0050304 Ga0495605_0050304_410_832 136
285 3300046475 Ga0495639_0203201 Ga0495639_0203201_469_879 136
286 3300046491 Ga0495584_0003900 Ga0495584_0003900_411_833 136
287 3300046492 Ga0495585_0009367 Ga0495585_0009367_778_1200 136
288 3300046492 Ga0495585_0055938 Ga0495585_0055938_683_1105 136
289 3300046492 Ga0495585_0160611 Ga0495585_0160611_392_814 136
290 3300046500 Ga0495596_0005327 Ga0495596_0005327_810_1232 136
291 3300046501 Ga0495607_0076279 Ga0495607_0076279_408_830 136
292 3300046501 Ga0495607_0216165 Ga0495607_0216165_10_432 136
293 3300046501 Ga0495607_0364182 Ga0495607_0364182_60_482 136
294 3300046506 Ga0495583_0000155 Ga0495583_0000155_34817_35239 136
295 3300046506 Ga0495583_0004737 Ga0495583_0004737_3977_4399 136
296 3300046506 Ga0495583_0041750 Ga0495583_0041750_1509_1931 136
297 3300046507 Ga0495606_0000141 Ga0495606_0000141_4114_4536 136
298 3300046507 Ga0495606_0000152 Ga0495606_0000152_24564_24986 136
299 3300046507 Ga0495606_0001575 Ga0495606_0001575_4118_4540 136
300 3300046507 Ga0495606_0008580 Ga0495606_0008580_4329_4751 136
301 3300046507 Ga0495606_0015878 Ga0495606_0015878_534_956 136
302 3300046507 Ga0495606_0018064 Ga0495606_0018064_534_944 136
303 3300046507 Ga0495606_0028316 Ga0495606_0028316_1732_2154 136
304 3300046507 Ga0495606_0045886 Ga0495606_0045886_981_1403 136
305 3300046507 Ga0495606_0048380 Ga0495606_0048380_1026_1448 136
306 3300046507 Ga0495606_0060224 Ga0495606_0060224_412_834 136
307 3300046507 Ga0495606_0515741 Ga0495606_0515741_129_551 136
308 3300046512 Ga0495610_0000003 Ga0495610_0000003_171439_171861 136
309 3300046512 Ga0495610_0049877 Ga0495610_0049877_356_778 136
310 3300046512 Ga0495610_0069326 Ga0495610_0069326_609_1031 136
311 3300046512 Ga0495610_0095651 Ga0495610_0095651_215_637 136
312 3300046518 Ga0495631_0011618 Ga0495631_0011618_747_1169 136
313 3300046520 Ga0495637_0000881 Ga0495637_0000881_1085_1507 136
314 3300046520 Ga0495637_0024309 Ga0495637_0024309_1535_1957 136
315 3300046522 Ga0495643_0007039 Ga0495643_0007039_1647_2057 136
316 3300046522 Ga0495643_0017465 Ga0495643_0017465_1943_2365 136
317 3300046522 Ga0495643_0020177 Ga0495643_0020177_2022_2444 136
318 3300046522 Ga0495643_0035832 Ga0495643_0035832_1870_2292 136
319 3300046522 Ga0495643_0140118 Ga0495643_0140118_684_1106 136
320 3300046522 Ga0495643_0142790 Ga0495643_0142790_428_850 136
321 3300046523 Ga0495644_0022520 Ga0495644_0022520_1191_1613 136
322 3300046523 Ga0495644_0051520 Ga0495644_0051520_64_486 136
323 3300046523 Ga0495644_0083516 Ga0495644_0083516_102_524 136
324 3300046524 Ga0495648_0000058 Ga0495648_0000058_154296_154718 136
325 3300046524 Ga0495648_0009549 Ga0495648_0009549_4744_5166 136
326 3300046524 Ga0495648_0035816 Ga0495648_0035816_1437_1859 136
327 3300046524 Ga0495648_0046270 Ga0495648_0046270_917_1339 136
328 3300046524 Ga0495648_0206272 Ga0495648_0206272_523_945 136
329 3300046524 Ga0495648_0349061 Ga0495648_0349061_96_518 136
330 3300046525 Ga0495663_0046120 Ga0495663_0046120_821_1243 136
331 3300046528 Ga0495642_0008387 Ga0495642_0008387_948_1370 136
332 3300046528 Ga0495642_0046150 Ga0495642_0046150_479_901 136
333 3300046528 Ga0495642_0105089 Ga0495642_0105089_91_513 136
334 3300046528 Ga0495642_0303034 Ga0495642_0303034_82_504 136
335 3300046528 Ga0495642_0463352 Ga0495642_0463352_77_499 136
336 3300046530 Ga0495654_0000261 Ga0495654_0000261_4136_4558 136
337 3300046530 Ga0495654_0027302 Ga0495654_0027302_1741_2163 136
338 3300046530 Ga0495654_0044445 Ga0495654_0044445_1297_1719 136
339 3300046530 Ga0495654_0079765 Ga0495654_0079765_1004_1426 136
340 3300046538 Ga0495609_0003109 Ga0495609_0003109_7075_7497 136
341 3300046538 Ga0495609_0081178 Ga0495609_0081178_188_610 136
342 3300046539 Ga0495621_0228831 Ga0495621_0228831_245_655 136
343 3300046542 Ga0495597_0001525 Ga0495597_0001525_640_1062 136
344 3300046542 Ga0495597_0007071 Ga0495597_0007071_1287_1709 136
345 3300046542 Ga0495597_0012194 Ga0495597_0012194_1022_1444 136
346 3300046542 Ga0495597_0175511 Ga0495597_0175511_390_812 136
347 3300046557 Ga0495622_0003320 Ga0495622_0003320_2484_2906 136
348 3300046557 Ga0495622_0011541 Ga0495622_0011541_1886_2308 136
349 3300046557 Ga0495622_0054625 Ga0495622_0054625_751_1173 136
350 3300046557 Ga0495622_0129193 Ga0495622_0129193_169_591 136
351 3300046558 Ga0495633_0008936 Ga0495633_0008936_691_1113 136
352 3300046558 Ga0495633_0017946 Ga0495633_0017946_1142_1564 136
353 3300046558 Ga0495633_0049603 Ga0495633_0049603_240_662 136
354 3300046558 Ga0495633_0062839 Ga0495633_0062839_794_1216 136
355 3300046558 Ga0495633_0083747 Ga0495633_0083747_342_752 136
356 3300046558 Ga0495633_0105305 Ga0495633_0105305_647_1069 136
357 3300046558 Ga0495633_0138280 Ga0495633_0138280_688_1110 136
358 3300046615 Ga0495656_0193101 Ga0495656_0193101_500_922 136
359 3300046615 Ga0495656_0525756 Ga0495656_0525756_168_578 136
360 3300046616 Ga0495668_0002731 Ga0495668_0002731_91_513 136
361 3300046616 Ga0495668_0007441 Ga0495668_0007441_5424_5846 136
362 3300046616 Ga0495668_0007548 Ga0495668_0007548_5811_6233 136
363 3300046616 Ga0495668_0033416 Ga0495668_0033416_1455_1865 136
364 3300046616 Ga0495668_0059353 Ga0495668_0059353_1180_1602 136
365 3300046648 Ga0495611_0035193 Ga0495611_0035193_1420_1842 136
366 3300046648 Ga0495611_0045571 Ga0495611_0045571_1458_1880 136
367 3300046648 Ga0495611_0557852 Ga0495611_0557852_85_507 136
368 3300046660 Ga0495625_0017675 Ga0495625_0017675_571_993 136
369 3300046660 Ga0495625_0027829 Ga0495625_0027829_2435_2857 136
370 3300046660 Ga0495625_0049883 Ga0495625_0049883_2071_2493 136
371 3300046660 Ga0495625_0064954 Ga0495625_0064954_1372_1794 136
372 3300046660 Ga0495625_0109698 Ga0495625_0109698_858_1280 136
373 3300046660 Ga0495625_0154783 Ga0495625_0154783_863_1285 136
374 3300046660 Ga0495625_0458175 Ga0495625_0458175_186_608 136
375 3300046664 Ga0495659_0000073 Ga0495659_0000073_678_1100 136
376 3300046664 Ga0495659_0006944 Ga0495659_0006944_2039_2461 136
377 3300046664 Ga0495659_0119364 Ga0495659_0119364_105_527 136
378 3300046665 Ga0495661_0013094 Ga0495661_0013094_340_750 136
379 3300046665 Ga0495661_0037553 Ga0495661_0037553_1984_2406 136
380 3300046665 Ga0495661_0102507 Ga0495661_0102507_279_701 136
381 3300046674 Ga0495588_0013666 Ga0495588_0013666_485_907 136
382 3300046674 Ga0495588_0148549 Ga0495588_0148549_330_752 136
383 3300046691 Ga0495670_0297573 Ga0495670_0297573_420_842 136
384 3300046691 Ga0495670_0489487 Ga0495670_0489487_136_558 136
385 3300046692 Ga0495671_0000001 Ga0495671_0000001_494300_494722 136
386 3300046692 Ga0495671_0000309 Ga0495671_0000309_40252_40674 136
387 3300046692 Ga0495671_0010548 Ga0495671_0010548_724_1146 136
388 3300046694 Ga0495649_0028389 Ga0495649_0028389_2025_2447 136
389 3300046694 Ga0495649_0046758 Ga0495649_0046758_1440_1862 136
390 3300046694 Ga0495649_0445263 Ga0495649_0445263_204_626 136
391 3300046794 Ga0495589_0061166 Ga0495589_0061166_536_958 136
392 3300046794 Ga0495589_0164440 Ga0495589_0164440_132_554 136
393 3300046810 Ga0495660_0021513 Ga0495660_0021513_1839_2261 136
394 3300046810 Ga0495660_0126249 Ga0495660_0126249_315_737 136
395 3300047318 Ga0495636_0001622 Ga0495636_0001622_7157_7579 136
396 3300047318 Ga0495636_0007644 Ga0495636_0007644_1028_1450 136
397 3300047318 Ga0495636_0021538 Ga0495636_0021538_552_974 136
398 3300047318 Ga0495636_0032135 Ga0495636_0032135_711_1133 136
399 3300047318 Ga0495636_0126082 Ga0495636_0126082_506_928 136
400 3300047318 Ga0495636_0379945 Ga0495636_0379945_169_591 136
401 3300047320 Ga0495672_0000176 Ga0495672_0000176_18993_19415 136
402 3300047320 Ga0495672_0000263 Ga0495672_0000263_1173_1595 136
403 3300047320 Ga0495672_0050654 Ga0495672_0050654_1118_1540 136
404 3300047320 Ga0495672_0270259 Ga0495672_0270259_194_616 136
405 3300047321 Ga0495676_0087321 Ga0495676_0087321_1482_1904 136
406 3300047323 Ga0495683_0039174 Ga0495683_0039174_1495_1917 136
407 3300047323 Ga0495683_0303487 Ga0495683_0303487_181_603 136
408 3300047443 Ga0495687_000296 Ga0495687_000296_1182_1604 136
409 3300047443 Ga0495687_005542 Ga0495687_005542_3294_3716 136
410 3300047443 Ga0495687_020138 Ga0495687_020138_2818_3228 136
411 3300047443 Ga0495687_032760 Ga0495687_032760_935_1345 136
412 3300047443 Ga0495687_106730 Ga0495687_106730_30_440 136
413 3300047445 Ga0495677_0006058 Ga0495677_0006058_3698_4120 136
414 3300047445 Ga0495677_0120170 Ga0495677_0120170_103_525 136
415 3300047445 Ga0495677_0135437 Ga0495677_0135437_339_761 136
416 3300047446 Ga0495679_009450 Ga0495679_009450_3464_3886 136
417 3300047447 Ga0495685_000250 Ga0495685_000250_4514_4936 136
418 3300047447 Ga0495685_073871 Ga0495685_073871_604_1026 136
419 3300047469 Ga0495673_0000006 Ga0495673_0000006_700355_700777 136
420 3300047469 Ga0495673_0000024 Ga0495673_0000024_314274_314696 136
421 3300047469 Ga0495673_0000049 Ga0495673_0000049_123503_123925 136
422 3300047469 Ga0495673_0007809 Ga0495673_0007809_821_1243 136
423 3300047469 Ga0495673_0015916 Ga0495673_0015916_2499_2921 136
424 3300047472 Ga0495686_0022789 Ga0495686_0022789_3170_3592 136
425 3300047472 Ga0495686_0062331 Ga0495686_0062331_1258_1680 136
426 3300047472 Ga0495686_0227016 Ga0495686_0227016_616_1038 136
427 3300048090 Ga0495615_0005881 Ga0495615_0005881_1168_1590 136
428 3300048091 Ga0495626_0091381 Ga0495626_0091381_168_590 136
429 3300048903 Ga0496100_0262825 Ga0496100_0262825_71_535 136
430 3300048905 Ga0496102_0034285 Ga0496102_0034285_2103_2525 136
431 3300048905 Ga0496102_0037864 Ga0496102_0037864_1052_1462 136
432 3300048905 Ga0496102_0097127 Ga0496102_0097127_1546_1968 136
433 3300048905 Ga0496102_0708473 Ga0496102_0708473_215_637 136
434 3300048906 Ga0496103_0002220 Ga0496103_0002220_7111_7533 136
435 3300048906 Ga0496103_0043004 Ga0496103_0043004_1022_1432 136
436 3300048906 Ga0496103_0152808 Ga0496103_0152808_631_1053 136
437 3300048907 Ga0496104_0092571 Ga0496104_0092571_1167_1631 136
438 3300048907 Ga0496104_0212720 Ga0496104_0212720_1232_1654 136
439 3300048908 Ga0496105_0399390 Ga0496105_0399390_127_591 136
440 3300048909 Ga0496106_0105061 Ga0496106_0105061_804_1214 136
441 3300048912 Ga0496109_0070983 Ga0496109_0070983_345_809 136
442 3300048913 Ga0496110_0186126 Ga0496110_0186126_129_539 136
443 3300048914 Ga0496111_0012600 Ga0496111_0012600_3790_4200 136
444 3300048914 Ga0496111_0236740 Ga0496111_0236740_604_1026 136
445 3300048917 Ga0496114_0171677 Ga0496114_0171677_1124_1534 136
446 3300048917 Ga0496114_0269231 Ga0496114_0269231_692_1102 136
447 3300048918 Ga0496115_0472227 Ga0496115_0472227_28_438 136
448 3300048919 Ga0496116_0037867 Ga0496116_0037867_764_1186 136
449 3300048920 Ga0496117_0000001 Ga0496117_0000001_1762253_1762675 136
450 3300048921 Ga0496118_0000078 Ga0496118_0000078_71365_71787 136
451 3300048922 Ga0496119_0114008 Ga0496119_0114008_774_1196 136
452 3300048924 Ga0496121_0008619 Ga0496121_0008619_3816_4238 136
453 3300048924 Ga0496121_0195051 Ga0496121_0195051_629_1051 136
454 3300048924 Ga0496121_0398881 Ga0496121_0398881_71_493 136
455 3300048925 Ga0496122_0054686 Ga0496122_0054686_542_964 136
456 3300048926 Ga0496123_0014321 Ga0496123_0014321_1782_2204 136
457 3300048926 Ga0496123_0050713 Ga0496123_0050713_431_853 136
458 3300048927 Ga0496124_0056704 Ga0496124_0056704_2687_3109 136
459 3300048928 Ga0496125_0003517 Ga0496125_0003517_17622_18032 136
460 3300048928 Ga0496125_0033319 Ga0496125_0033319_3707_4129 136
461 3300048929 Ga0496126_0020682 Ga0496126_0020682_2733_3155 136
462 3300048929 Ga0496126_0445502 Ga0496126_0445502_345_767 136
463 3300049128 Ga0501308_005670 Ga0501308_005670_324_746 136
464 3300049130 Ga0501310_004803 Ga0501310_004803_363_785 136
465 3300049130 Ga0501310_045874 Ga0501310_045874_187_609 136
466 3300049160 Ga0501304_003517 Ga0501304_003517_513_935 136
467 3300049161 Ga0501305_100798 Ga0501305_100798_96_518 136
468 3300049162 Ga0501307_037243 Ga0501307_037243_253_675 136
469 3300049459 Ga0495678_010317 Ga0495678_010317_2352_2774 136
470 3300049459 Ga0495678_018497 Ga0495678_018497_1850_2272 136
471 3300049459 Ga0495678_031280 Ga0495678_031280_1752_2174 136
472 3300049459 Ga0495678_062484 Ga0495678_062484_528_950 136
473 3300049459 Ga0495678_086229 Ga0495678_086229_648_1070 136
474 3300049459 Ga0495678_144091 Ga0495678_144091_227_649 136
475 3300049460 Ga0495682_0040194 Ga0495682_0040194_716_1138 136
476 3300049460 Ga0495682_0042543 Ga0495682_0042543_64_486 136
477 3300049460 Ga0495682_0083346 Ga0495682_0083346_664_1086 136
478 3300049527 Ga0501311_010471 Ga0501311_010471_402_824 136
479 3300049528 Ga0501312_077136 Ga0501312_077136_20_442 136
480 3300049529 Ga0501313_047452 Ga0501313_047452_146_568 136
481 3300049531 Ga0501315_009567 Ga0501315_009567_354_776 136
482 3300049531 Ga0501315_022636 Ga0501315_022636_374_796 136
483 3300049531 Ga0501315_053271 Ga0501315_053271_138_560 136
484 3300049532 Ga0501316_002775 Ga0501316_002775_369_791 136
485 3300049532 Ga0501316_031771 Ga0501316_031771_91_513 136
486 3300049535 Ga0501319_021966 Ga0501319_021966_20_442 136
487 3300049535 Ga0501319_022711 Ga0501319_022711_64_486 136
488 3300049537 Ga0501321_041631 Ga0501321_041631_71_493 136
489 3300049539 Ga0501323_009474 Ga0501323_009474_497_919 136
490 3300049539 Ga0501323_054396 Ga0501323_054396_87_509 136
491 3300049541 Ga0501325_022604 Ga0501325_022604_44_466 136
492 3300049544 Ga0501328_00978 Ga0501328_00978_252_674 136
493 3300049545 Ga0501329_07090 Ga0501329_07090_151_573 136
494 3300049551 Ga0501335_028288 Ga0501335_028288_131_553 136
495 3300049552 Ga0501336_019311 Ga0501336_019311_167_589 136
496 3300049669 Ga0501235_036607 Ga0501235_036607_424_846 136
497 3300049671 Ga0501238_004582 Ga0501238_004582_836_1258 136
498 3300049679 Ga0501249_002398 Ga0501249_002398_1254_1676 136
499 3300049766 Ga0501269_000168 Ga0501269_000168_12639_13061 136
500 3300050489 nmdc:mga03683_13644_c1 nmdc:mga03683_13644_c1_733_1155 136
501 3300050490 nmdc:mga03n38_54782_c1 nmdc:mga03n38_54782_c1_693_1115 136
502 3300050493 nmdc:mga0k408_286418_c1 nmdc:mga0k408_286418_c1_281_703 136
503 3300053118 Ga0500594_0171728 Ga0500594_0171728_249_671 136
504 3300053125 Ga0500618_000786 Ga0500618_000786_16682_17104 136
505 3300053125 Ga0500618_031806 Ga0500618_031806_391_813 136
506 3300053125 Ga0500618_104668 Ga0500618_104668_202_624 136
507 3300053136 Ga0500559_0271076 Ga0500559_0271076_193_615 136
508 3300053145 Ga0500586_009115 Ga0500586_009115_598_1020 136
509 3300053156 Ga0500622_0103027 Ga0500622_0103027_138_548 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

7

121

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wu6-assembly1.cif.gz_C succinate-coenzyme q reductase 0.858 23 132
2wdv-assembly1.cif.gz_C e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket 0.8573 13 131
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.8534 13 132
2wdv-assembly1.cif.gz_C e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket 0.8382 13 131
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.8344 13 132
ID Description Score Start End Superfamily
2wdrC00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.854 13 132 1.20.1300.10
2wdvK00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8504 13 131 1.20.1300.10
2wdrC00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8349 13 132 1.20.1300.10
af_Q2FZC9_1_204_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8325 29 133 1.20.1300.10
2wdvK00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8313 13 131 1.20.1300.10
ID Description Score Start End GO Terms
AF-K2BWE5-F1-model_v4 Succinate dehydrogenase, cytochrome b556 subunit 0.9449 23 132 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-K2BWE5-F1-model_v4 Succinate dehydrogenase, cytochrome b556 subunit 0.9286 23 132 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A0Q9Z0L3-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9246 13 134 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A510X4K9-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9227 25 132 GO:0005886
GO:0006099
GO:0009055
GO:0046872
AF-A0A316FQE6-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9225 23 132 GO:0005886
GO:0006099
GO:0009055
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.43 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map