F457002

General Info

Members Datasets Scaffolds Average Seq Length
509 317 1018 201

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10142937|Ga0307412_101429372
Length 205
Sequence MQELLVDFITSLDGYGAAEGWPGFWGLQGPEYLAWLGEQPERGYTILMGANTYRLMSGFAAEAETLEADEAAAVDELATTPKVVFSSTLQPPLAWANTQLVGGDAVEAVAGMKRDGAGPMRTLGSLTLCRSLLEAGLVDRFRVVVFPVITGSTGRDRIYDGYPDVALDMLASQTFDGRLQLIEYVPKVLTGPPGTHPNASRRSQA

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
83 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
84 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
85 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
86 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
87 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
88 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
151 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
155 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
156 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
166 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
167 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
174 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
175 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
182 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
183 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
184 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
185 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
186 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
189 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
190 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
191 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
192 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
193 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
194 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
195 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
196 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
197 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
198 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
199 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
200 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
201 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
202 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
203 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
204 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
205 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
206 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
242 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
247 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
263 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
285 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
286 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
287 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
288 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
289 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
313 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
314 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.48
Nodule 0.2
Rhizoplane 3.54
Rhizosphere 88.41
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_10142937 3300031911 Bacteria 1755
2 LJQas_1002241 3300000549 Bacteria 2724
3 JGI24737J22298_10004822 3300001990 Bacteria 4683
4 JGI25406J46586_10075815 3300003203 Bacteria 1042
5 JGI25406J46586_10122537 3300003203 Bacteria 765
6 JGI25407J50210_10000029 3300003373 Bacteria 15001
7 JGI25407J50210_10002132 3300003373 Bacteria 4619
8 JGI25407J50210_10068943 3300003373 Bacteria 884
9 JGI25404J52841_10038869 3300003659 Bacteria 1009
10 Ga0070670_100420782 3300005331 Bacteria 1181
11 Ga0070682_100417669 3300005337 Bacteria 1019
12 Ga0068868_100316516 3300005338 Bacteria 1328
13 Ga0070689_100203249 3300005340 Bacteria 1618
14 Ga0070691_10226223 3300005341 Bacteria 994
15 Ga0070661_100746779 3300005344 Bacteria 800
16 Ga0070692_10070644 3300005345 Bacteria 1859
17 Ga0070671_100001169 3300005355 Bacteria 19598
18 Ga0070674_100221730 3300005356 Bacteria 1471
19 Ga0070688_100142727 3300005365 Bacteria 1629
20 Ga0070659_100426493 3300005366 Bacteria 1122
21 Ga0070659_101060594 3300005366 Bacteria 713
22 Ga0070667_100132951 3300005367 Bacteria 2173
23 Ga0070703_10127173 3300005406 Bacteria 932
24 Ga0070714_100083868 3300005435 Bacteria 2780
25 Ga0070713_101020100 3300005436 Bacteria 798
26 Ga0070711_100725216 3300005439 Bacteria 838
27 Ga0070663_100391027 3300005455 Bacteria 1135
28 Ga0070662_100261418 3300005457 Bacteria 1394
29 Ga0068867_100563078 3300005459 Bacteria 989
30 Ga0070685_10205503 3300005466 Bacteria 1282
31 Ga0070685_10590178 3300005466 Bacteria 798
32 Ga0070679_101370969 3300005530 Bacteria 653
33 Ga0070684_100692634 3300005535 Bacteria 950
34 Ga0070697_100055694 3300005536 Bacteria 3215
35 Ga0070697_100717590 3300005536 Bacteria 882
36 Ga0068853_100540915 3300005539 Bacteria 1103
37 Ga0070672_100519166 3300005543 Bacteria 1032
38 Ga0070686_100412800 3300005544 Bacteria 1029
39 Ga0070686_100816642 3300005544 Bacteria 753
40 Ga0070665_100001232 3300005548 Bacteria 31094
41 Ga0070665_100002166 3300005548 Bacteria 21914
42 Ga0070664_100885377 3300005564 Bacteria 837
43 Ga0068857_100209462 3300005577 Bacteria 1778
44 Ga0068856_100482582 3300005614 Bacteria 1260
45 Ga0068859_100000102 3300005617 Bacteria 79658
46 Ga0068866_10210368 3300005718 Bacteria 1167
47 Ga0068861_100466567 3300005719 Bacteria 1134
48 Ga0068863_100634762 3300005841 Bacteria 1058
49 Ga0068858_100011369 3300005842 Bacteria 8406
50 Ga0068858_100685333 3300005842 Bacteria 997
51 Ga0068860_100438316 3300005843 Bacteria 1297
52 Ga0068860_100820199 3300005843 Bacteria 944
53 Ga0068862_100000273 3300005844 Bacteria 57697
54 Ga0068862_100037341 3300005844 Bacteria 4117
55 Ga0081455_10136866 3300005937 Bacteria 1907
56 Ga0081455_10147252 3300005937 Bacteria 1820
57 Ga0081538_10001284 3300005981 Bacteria 26093
58 Ga0081538_10003414 3300005981 Bacteria 15029
59 Ga0081538_10005797 3300005981 Bacteria 11012
60 Ga0081538_10010866 3300005981 Bacteria 7426
61 Ga0081538_10049974 3300005981 Bacteria 2531
62 Ga0081538_10162322 3300005981 Bacteria 991
63 Ga0081540_1011224 3300005983 Bacteria 6005
64 Ga0081540_1117352 3300005983 Bacteria 1112
65 Ga0081540_1135567 3300005983 Bacteria 997
66 Ga0081539_10003101 3300005985 Bacteria 21322
67 Ga0081539_10004616 3300005985 Bacteria 15008
68 Ga0081539_10035146 3300005985 Bacteria 3017
69 Ga0070717_10085050 3300006028 Bacteria 2661
70 Ga0070717_10546411 3300006028 Bacteria 1049
71 Ga0075365_10001725 3300006038 Bacteria 10135
72 Ga0075365_10339510 3300006038 Bacteria 1058
73 Ga0075363_100014882 3300006048 Bacteria 3814
74 Ga0075363_100088793 3300006048 Bacteria 1699
75 Ga0075363_100189392 3300006048 Bacteria 1173
76 Ga0075364_10000061 3300006051 Bacteria 40845
77 Ga0075364_10039885 3300006051 Bacteria 3045
78 Ga0075364_10373412 3300006051 Bacteria 973
79 Ga0070715_10003987 3300006163 Bacteria 4783
80 Ga0075362_10042579 3300006177 Bacteria 2008
81 Ga0075367_10041970 3300006178 Bacteria 2675
82 Ga0075367_10192090 3300006178 Bacteria 1274
83 Ga0075367_10283724 3300006178 Bacteria 1041
84 Ga0075427_10021425 3300006194 Bacteria 1028
85 Ga0097621_100799605 3300006237 Bacteria 874
86 Ga0075370_10021525 3300006353 Bacteria 3533
87 Ga0068871_100329328 3300006358 Bacteria 1347
88 Ga0075428_100001570 3300006844 Bacteria 24485
89 Ga0075428_100026345 3300006844 Bacteria 6436
90 Ga0075428_100076464 3300006844 Bacteria 3655
91 Ga0075428_100155717 3300006844 Bacteria 2482
92 Ga0075428_100599641 3300006844 Bacteria 1176
93 Ga0075428_101085688 3300006844 Bacteria 845
94 Ga0075430_100000756 3300006846 Bacteria 24924
95 Ga0075430_100181157 3300006846 Bacteria 1752
96 Ga0075431_100000685 3300006847 Bacteria 29059
97 Ga0075431_100186596 3300006847 Bacteria 2126
98 Ga0075431_100191964 3300006847 Bacteria 2093
99 Ga0075431_100711541 3300006847 Bacteria 981
100 Ga0075433_10121189 3300006852 Bacteria 2322
101 Ga0075433_10121810 3300006852 Bacteria 2316
102 Ga0075433_11027908 3300006852 Bacteria 717
103 Ga0075434_100026259 3300006871 Bacteria 5703
104 Ga0075434_100039444 3300006871 Bacteria 4679
105 Ga0075434_100088200 3300006871 Bacteria 3103
106 Ga0075434_100136585 3300006871 Bacteria 2471
107 Ga0075429_100000770 3300006880 Bacteria 25272
108 Ga0075429_100001823 3300006880 Bacteria 17630
109 Ga0075429_100234442 3300006880 Bacteria 1608
110 Ga0068865_100140536 3300006881 Bacteria 1820
111 Ga0068865_100466831 3300006881 Bacteria 1046
112 Ga0075436_100168885 3300006914 Bacteria 1544
113 Ga0097620_100000102 3300006931 Bacteria 79658
114 Ga0099826_10175874 3300006948 Bacteria 1196
115 Ga0075435_100029454 3300007076 Bacteria 4308
116 Ga0075435_100407534 3300007076 Bacteria 1170
117 Ga0105244_10221256 3300009036 Bacteria 888
118 Ga0105240_10000541 3300009093 Bacteria 69900
119 Ga0105240_10447013 3300009093 Bacteria 1447
120 Ga0111539_10001628 3300009094 Bacteria 30018
121 Ga0111539_10033938 3300009094 Bacteria 6192
122 Ga0111539_10275210 3300009094 Bacteria 1959
123 Ga0111539_10458539 3300009094 Bacteria 1484
124 Ga0105245_10133091 3300009098 Bacteria 2334
125 Ga0105245_10457177 3300009098 Bacteria 1286
126 Ga0105247_10373360 3300009101 Bacteria 1009
127 Ga0114129_10122956 3300009147 Bacteria 3570
128 Ga0114129_10251725 3300009147 Bacteria 2371
129 Ga0105243_10009821 3300009148 Bacteria 7285
130 Ga0105243_10908922 3300009148 Bacteria 876
131 Ga0105242_10194641 3300009176 Bacteria 1797
132 Ga0105242_10229981 3300009176 Bacteria 1661
133 Ga0105238_10004346 3300009551 Bacteria 14059
134 Ga0105249_10025896 3300009553 Bacteria 5284
135 Ga0105249_10122139 3300009553 Bacteria 2476
136 Ga0105239_10077436 3300010375 Bacteria 3659
137 Ga0105239_10090362 3300010375 Unclassified 3378
138 Ga0105239_10834804 3300010375 Bacteria 1056
139 Ga0105246_10121032 3300011119 Bacteria 1939
140 Ga0157340_1002615 3300012473 Bacteria 931
141 Ga0157344_1004743 3300012476 Bacteria 820
142 Ga0157346_1004181 3300012480 Bacteria 843
143 Ga0157318_1004299 3300012482 Bacteria 863
144 Ga0157321_1004319 3300012487 Bacteria 889
145 Ga0157323_1010434 3300012495 Bacteria 730
146 Ga0157326_1007338 3300012513 Bacteria 1190
147 Ga0157370_11006218 3300013104 Bacteria 754
148 Ga0157378_10688498 3300013297 Bacteria 1041
149 Ga0157378_10975090 3300013297 Bacteria 881
150 Ga0163162_10539478 3300013306 Bacteria 1295
151 Ga0163162_10562455 3300013306 Bacteria 1268
152 Ga0157372_10959938 3300013307 Bacteria 991
153 Ga0157375_10133419 3300013308 Bacteria 2604
154 Ga0157375_10894441 3300013308 Bacteria 1032
155 Ga0163163_10043914 3300014325 Bacteria 4383
156 Ga0163163_10324421 3300014325 Bacteria 1593
157 Ga0157380_10192196 3300014326 Bacteria 1803
158 Ga0157380_11545692 3300014326 Bacteria 718
159 Ga0157379_10356743 3300014968 Bacteria 1339
160 Ga0157376_10171009 3300014969 Bacteria 1979
161 Ga0183367_1004 3300015688 Bacteria 716880
162 Ga0163161_10079717 3300017792 Bacteria 2408
163 Ga0163161_10456058 3300017792 Bacteria 1034
164 Ga0163161_10890268 3300017792 Bacteria 753
165 Ga0206353_11188448 3300020082 Bacteria 827
166 Ga0207656_10239792 3300025321 Bacteria 886
167 Ga0207653_10012251 3300025885 Bacteria 2677
168 Ga0207692_10036087 3300025898 Bacteria 2407
169 Ga0207642_10148600 3300025899 Bacteria 1244
170 Ga0207688_10050845 3300025901 Bacteria 2321
171 Ga0207680_10483531 3300025903 Bacteria 881
172 Ga0207647_10057241 3300025904 Bacteria 2390
173 Ga0207685_10015307 3300025905 Bacteria 2428
174 Ga0207699_10073807 3300025906 Bacteria 2094
175 Ga0207645_10314821 3300025907 Bacteria 1043
176 Ga0207643_10028465 3300025908 Bacteria 3103
177 Ga0207705_10588970 3300025909 Bacteria 865
178 Ga0207705_10850317 3300025909 Bacteria 707
179 Ga0207654_10393052 3300025911 Bacteria 963
180 Ga0207695_10010482 3300025913 Bacteria 11337
181 Ga0207671_10306242 3300025914 Bacteria 1256
182 Ga0207663_10074640 3300025916 Bacteria 2198
183 Ga0207662_10083663 3300025918 Bacteria 1951
184 Ga0207662_10259441 3300025918 Bacteria 1143
185 Ga0207657_10371010 3300025919 Bacteria 1128
186 Ga0207694_10031297 3300025924 Bacteria 4063
187 Ga0207687_10166305 3300025927 Bacteria 1697
188 Ga0207687_10404871 3300025927 Bacteria 1123
189 Ga0207700_10329861 3300025928 Bacteria 1324
190 Ga0207664_10028154 3300025929 Bacteria 4268
191 Ga0207644_10275141 3300025931 Bacteria 1350
192 Ga0207690_10836269 3300025932 Bacteria 762
193 Ga0207706_10066955 3300025933 Bacteria 3160
194 Ga0207670_10614606 3300025936 Bacteria 893
195 Ga0207704_10341613 3300025938 Bacteria 1162
196 Ga0207704_10390412 3300025938 Bacteria 1095
197 Ga0207691_10613797 3300025940 Bacteria 920
198 Ga0207689_10382979 3300025942 Bacteria 1171
199 Ga0207689_10605743 3300025942 Bacteria 922
200 Ga0207712_10084778 3300025961 Bacteria 2316
201 Ga0207668_10058555 3300025972 Bacteria 2694
202 Ga0207668_11029516 3300025972 Bacteria 737
203 Ga0207658_11352769 3300025986 Bacteria 651
204 Ga0207703_10014566 3300026035 Bacteria 6135
205 Ga0207703_10785206 3300026035 Bacteria 909
206 Ga0207703_10840038 3300026035 Bacteria 878
207 Ga0207678_10138458 3300026067 Bacteria 2077
208 Ga0207678_10629508 3300026067 Bacteria 942
209 Ga0207708_10156870 3300026075 Bacteria 1795
210 Ga0207702_10812835 3300026078 Bacteria 924
211 Ga0207641_10004622 3300026088 Bacteria 11889
212 Ga0207676_10747828 3300026095 Bacteria 951
213 Ga0207674_10177210 3300026116 Bacteria 2084
214 Ga0207674_10806121 3300026116 Bacteria 906
215 Ga0207675_100105040 3300026118 Bacteria 2662
216 Ga0207675_100398785 3300026118 Bacteria 1355
217 Ga0207698_10466710 3300026142 Bacteria 1222
218 Ga0207698_10601437 3300026142 Bacteria 1084
219 Ga0209966_1018073 3300027695 Bacteria 1348
220 Ga0209998_10088435 3300027717 Bacteria 757
221 Ga0209813_10088254 3300027866 Bacteria 1037
222 Ga0209974_10064617 3300027876 Bacteria 1242
223 Ga0207428_10031566 3300027907 Bacteria 4367
224 Ga0207428_10060001 3300027907 Bacteria 3014
225 Ga0207428_10124148 3300027907 Bacteria 1978
226 Ga0207428_10228576 3300027907 Bacteria 1393
227 Ga0268266_10005545 3300028379 Bacteria 11747
228 Ga0268266_10293990 3300028379 Bacteria 1513
229 Ga0268265_10000174 3300028380 Bacteria 76817
230 Ga0268264_10946205 3300028381 Bacteria 866
231 Ga0316177_1062290 3300030731 Bacteria 1262
232 Ga0316182_1329237 3300030745 Bacteria 2114
233 Ga0307513_10017011 3300031456 Bacteria 8737
234 Ga0307408_100044025 3300031548 Bacteria 3179
235 Ga0307408_100124475 3300031548 Bacteria 2002
236 Ga0307408_100454292 3300031548 Bacteria 1112
237 Ga0307514_10235935 3300031649 Bacteria 1102
238 Ga0307516_10538984 3300031730 Bacteria 821
239 Ga0307518_10249955 3300031838 Bacteria 1128
240 Ga0307410_10008386 3300031852 Bacteria 5727
241 Ga0307410_10085326 3300031852 Bacteria 2228
242 Ga0307410_10240228 3300031852 Bacteria 1403
243 Ga0307406_10001635 3300031901 Bacteria 12318
244 Ga0307406_10085089 3300031901 Bacteria 2113
245 Ga0307406_10616443 3300031901 Bacteria 896
246 Ga0307406_10848443 3300031901 Bacteria 774
247 Ga0307407_10155500 3300031903 Bacteria 1491
248 Ga0307407_10290057 3300031903 Bacteria 1137
249 Ga0307407_10657799 3300031903 Bacteria 785
250 Ga0307409_100009030 3300031995 Bacteria 6099
251 Ga0307409_100157473 3300031995 Bacteria 1981
252 Ga0307409_100181271 3300031995 Bacteria 1865
253 Ga0307409_100326661 3300031995 Bacteria 1438
254 Ga0307409_100459573 3300031995 Bacteria 1230
255 Ga0307409_101388513 3300031995 Bacteria 728
256 Ga0307416_100023207 3300032002 Bacteria 4497
257 Ga0307416_100035047 3300032002 Bacteria 3827
258 Ga0307416_100212539 3300032002 Bacteria 1847
259 Ga0307416_100582135 3300032002 Bacteria 1197
260 Ga0307416_101329449 3300032002 Bacteria 824
261 Ga0307416_101341174 3300032002 Bacteria 821
262 Ga0307414_10300672 3300032004 Bacteria 1357
263 Ga0307411_10564104 3300032005 Bacteria 973
264 Ga0307415_100011091 3300032126 Bacteria 5138
265 Ga0307415_100124745 3300032126 Bacteria 1938
266 Ga0373948_0009558 3300034817 Bacteria 1674
267 Ga0373959_0057701 3300034820 Bacteria 852
268 Ga0373938_0021142 3300034957 Bacteria 1317
269 Ga0373949_0052563 3300035090 Bacteria 1030
270 Ga0373952_0043345 3300035092 Bacteria 1048
271 Ga0373932_0118810 3300035112 Bacteria 879
272 Ga0373939_0005001 3300035114 Bacteria 3151
273 Ga0373941_0055392 3300035115 Bacteria 1274
274 Ga0373960_0093095 3300035121 Bacteria 966
275 Ga0373960_0135169 3300035121 Bacteria 830
276 Ga0373942_0014607 3300035207 Bacteria 1904
277 Ga0373961_0127563 3300035241 Bacteria 849
278 Ga0373931_0052821 3300035691 Bacteria 2167
279 Ga0395900_0274152 3300037418 Bacteria 1681
280 Ga0395898_0007500 3300037466 Bacteria 11590
281 Ga0395898_0156282 3300037466 Bacteria 2181
282 Ga0395905_0152412 3300037471 Bacteria 2174
283 Ga0395905_0677886 3300037471 Bacteria 933
284 Ga0395901_0748288 3300038443 Bacteria 971
285 Ga0439436_0007138 3300041404 Bacteria 3439
286 Ga0439453_0083771 3300041408 Bacteria 691
287 Ga0451835_0942724 3300041492 Bacteria 715
288 Ga0451837_1557500 3300041494 Bacteria 908
289 Ga0451855_0387345 3300041511 Bacteria 738
290 Ga0439433_0004141 3300041999 Bacteria 3116
291 Ga0439445_0088232 3300042004 Bacteria 872
292 Ga0439450_008075 3300042008 Bacteria 1952
293 Ga0439454_008771 3300042011 Bacteria 1299
294 Ga0439455_0021093 3300042012 Bacteria 1550
295 Ga0439455_0076377 3300042012 Bacteria 906
296 Ga0439457_004943 3300042014 Bacteria 3411
297 Ga0439463_009168 3300042016 Bacteria 2436
298 Ga0439463_062308 3300042016 Bacteria 953
299 Ga0450912_008271 3300042116 Bacteria 860
300 Ga0450914_011724 3300042118 Bacteria 868
301 Ga0450917_004198 3300042120 Bacteria 1049
302 Ga0450922_008003 3300042124 Bacteria 994
303 Ga0450894_000800 3300042131 Bacteria 5097
304 Ga0450903_006055 3300042138 Bacteria 2018
305 Ga0450905_017933 3300042142 Bacteria 1029
306 Ga0439458_0002739 3300042157 Bacteria 4246
307 Ga0439435_0001806 3300042436 Bacteria 4083
308 Ga0439444_0007680 3300042437 Bacteria 1664
309 Ga0450916_019706 3300042530 Bacteria 918
310 Ga0450901_008830 3300042533 Bacteria 1041
311 Ga0450901_009240 3300042533 Bacteria 1019
312 Ga0439440_0008832 3300042993 Bacteria 2074
313 Ga0439440_0082446 3300042993 Bacteria 852
314 Ga0466972_0005102 3300044658 Bacteria 6576
315 Ga0466965_0434879 3300044683 Bacteria 729
316 Ga0466961_0131280 3300044693 Bacteria 1570
317 Ga0466963_0015743 3300044694 Bacteria 4691
318 Ga0466968_0169418 3300044735 Bacteria 1011
319 Ga0466970_0004665 3300044765 Bacteria 6765
320 Ga0466960_0014092 3300044901 Bacteria 3412
321 Ga0466960_0454884 3300044901 Bacteria 745
322 Ga0466967_0001185 3300045976 Bacteria 14632
323 Ga0466967_0953315 3300045976 Bacteria 854
324 Ga0466967_1081903 3300045976 Bacteria 799
325 Ga0495629_0035423 3300046459 Bacteria 3527
326 Ga0495638_0355884 3300046460 Bacteria 772
327 Ga0495584_0087595 3300046491 Bacteria 1569
328 Ga0495585_0315577 3300046492 Bacteria 765
329 Ga0495594_0001029 3300046499 Bacteria 14524
330 Ga0495596_0093766 3300046500 Bacteria 1165
331 Ga0495607_0161485 3300046501 Bacteria 1138
332 Ga0495583_0094077 3300046506 Bacteria 1287
333 Ga0495583_0126416 3300046506 Bacteria 1072
334 Ga0495608_0127750 3300046511 Bacteria 1628
335 Ga0495610_0231753 3300046512 Bacteria 741
336 Ga0495620_0163456 3300046515 Bacteria 864
337 Ga0495632_0102956 3300046519 Bacteria 1345
338 Ga0495637_0175697 3300046520 Bacteria 796
339 Ga0495643_0276667 3300046522 Bacteria 774
340 Ga0495644_0106687 3300046523 Bacteria 1061
341 Ga0495642_0137910 3300046528 Bacteria 1052
342 Ga0495621_0112926 3300046539 Bacteria 1043
343 Ga0495597_0176786 3300046542 Bacteria 864
344 Ga0495656_0021768 3300046615 Bacteria 2500
345 Ga0495668_0124585 3300046616 Bacteria 1410
346 Ga0495611_0188763 3300046648 Bacteria 962
347 Ga0495625_0020154 3300046660 Bacteria 5153
348 Ga0495659_0189872 3300046664 Bacteria 839
349 Ga0495588_0023232 3300046674 Bacteria 3069
350 Ga0495669_0200369 3300046684 Bacteria 954
351 Ga0495670_0493742 3300046691 Bacteria 664
352 Ga0495649_0174087 3300046694 Bacteria 1125
353 Ga0495589_0170860 3300046794 Bacteria 1033
354 Ga0495660_0068756 3300046810 Bacteria 1884
355 Ga0495672_0307245 3300047320 Bacteria 749
356 Ga0495676_0001676 3300047321 Bacteria 19346
357 Ga0495677_0176404 3300047445 Bacteria 827
358 Ga0495679_097946 3300047446 Bacteria 817
359 Ga0495673_0182595 3300047469 Bacteria 794
360 Ga0496100_0147192 3300048903 Bacteria 1676
361 Ga0496101_0653043 3300048904 Bacteria 831
362 Ga0496102_0330963 3300048905 Bacteria 1435
363 Ga0496102_1195747 3300048905 Bacteria 680
364 Ga0496104_0005320 3300048907 Bacteria 11262
365 Ga0496105_0060311 3300048908 Bacteria 3130
366 Ga0496105_0274888 3300048908 Bacteria 1360
367 Ga0496107_0336200 3300048910 Bacteria 1124
368 Ga0496108_0016795 3300048911 Bacteria 5980
369 Ga0496108_0124124 3300048911 Bacteria 2216
370 Ga0496109_0048182 3300048912 Bacteria 3877
371 Ga0496109_0081128 3300048912 Bacteria 2989
372 Ga0496110_0074228 3300048913 Bacteria 3020
373 Ga0496111_0871262 3300048914 Bacteria 649
374 Ga0496112_0573133 3300048915 Bacteria 1062
375 Ga0496113_0469568 3300048916 Bacteria 1011
376 Ga0496114_0874681 3300048917 Bacteria 779
377 Ga0496115_0098869 3300048918 Bacteria 2390
378 Ga0501296_028339 3300049519 Bacteria 745
379 Ga0501321_025055 3300049537 Bacteria 767
380 Ga0501031_0189563 3300049568 Bacteria 1343
381 Ga0501033_0216971 3300049570 Bacteria 1363
382 Ga0501034_0017805 3300049571 Bacteria 7288
383 Ga0501034_0088834 3300049571 Bacteria 3088
384 Ga0501034_0279390 3300049571 Bacteria 1609
385 Ga0501036_0037786 3300049572 Bacteria 4084
386 Ga0501036_0043058 3300049572 Bacteria 3823
387 Ga0501036_0098898 3300049572 Bacteria 2467
388 Ga0501036_0128230 3300049572 Bacteria 2142
389 Ga0501036_0225419 3300049572 Bacteria 1573
390 Ga0501038_0001048 3300049574 Bacteria 24906
391 Ga0501039_0250814 3300049575 Bacteria 1392
392 Ga0501039_0486466 3300049575 Bacteria 969
393 Ga0501039_0664888 3300049575 Bacteria 815
394 Ga0501040_0062731 3300049576 Bacteria 2557
395 Ga0501040_0070631 3300049576 Bacteria 2410
396 Ga0501040_0071450 3300049576 Bacteria 2396
397 Ga0501040_0090732 3300049576 Bacteria 2124
398 Ga0501040_0093069 3300049576 Bacteria 2096
399 Ga0501041_0041143 3300049577 Bacteria 2806
400 Ga0501041_0095716 3300049577 Bacteria 1835
401 Ga0501041_0154920 3300049577 Bacteria 1431
402 Ga0501042_0028868 3300049578 Bacteria 3912
403 Ga0501042_0099211 3300049578 Bacteria 2094
404 Ga0501042_0144383 3300049578 Bacteria 1716
405 Ga0501042_0462853 3300049578 Bacteria 920
406 Ga0501042_0749180 3300049578 Bacteria 710
407 Ga0501046_0080717 3300049580 Bacteria 2513
408 Ga0501046_0507575 3300049580 Bacteria 863
409 Ga0501047_0007867 3300049581 Bacteria 10047
410 Ga0501047_0040233 3300049581 Bacteria 4521
411 Ga0501048_0501992 3300049582 Bacteria 870
412 Ga0501048_0875517 3300049582 Bacteria 646
413 Ga0501068_0156860 3300049584 Bacteria 1433
414 Ga0501068_0265377 3300049584 Bacteria 1095
415 Ga0501071_0023618 3300049587 Bacteria 4294
416 Ga0501072_0305215 3300049588 Bacteria 1265
417 Ga0501072_0394735 3300049588 Bacteria 1097
418 Ga0501073_0474358 3300049589 Bacteria 865
419 Ga0501074_0110613 3300049590 Bacteria 1966
420 Ga0501075_0037228 3300049591 Bacteria 3634
421 Ga0501075_0121391 3300049591 Bacteria 1989
422 Ga0501076_0022359 3300049592 Bacteria 4861
423 Ga0501076_0059539 3300049592 Bacteria 3038
424 Ga0501077_0082570 3300049593 Bacteria 2036
425 Ga0501077_0087038 3300049593 Bacteria 1980
426 Ga0501234_059870 3300049707 Bacteria 644
427 Ga0501079_0043944 3300049741 Bacteria 3449
428 Ga0501079_0078592 3300049741 Bacteria 2552
429 Ga0501081_0010287 3300049743 Bacteria 6108
430 Ga0501081_0163468 3300049743 Bacteria 1605
431 Ga0501081_0196435 3300049743 Bacteria 1462
432 Ga0501081_0690795 3300049743 Bacteria 766
433 Ga0501264_025518 3300049761 Bacteria 652
434 Ga0501267_010625 3300049764 Bacteria 931
435 Ga0501268_061479 3300049765 Bacteria 745
436 Ga0501035_0160817 3300049822 Bacteria 1944
437 Ga0501035_0607611 3300049822 Bacteria 890
438 Ga0501035_0696124 3300049822 Bacteria 820
439 Ga0501044_0213786 3300049823 Bacteria 1881
440 Ga0501044_0870919 3300049823 Bacteria 777
441 Ga0501045_0012990 3300049824 Bacteria 5871
442 Ga0501045_0148193 3300049824 Bacteria 1746
443 Ga0501212_021292 3300049851 Bacteria 1005
444 nmdc:mga03683_34855_c1 3300050489 Bacteria 2038
445 nmdc:mga03683_69473_c1 3300050489 Bacteria 1046
446 nmdc:mga03n38_10533_c1 3300050490 Bacteria 3407
447 nmdc:mga03n38_36328_c1 3300050490 Bacteria 2117
448 nmdc:mga00v17_125629_c1 3300050491 Bacteria 1636
449 nmdc:mga00v17_19627_c1 3300050491 Bacteria 3863
450 nmdc:mga00v17_3110_c1 3300050491 Bacteria 8533
451 nmdc:mga00v17_442870_c1 3300050491 Bacteria 844
452 nmdc:mga00v17_709169_c1 3300050491 Bacteria 644
453 nmdc:mga0yw44_140190_c1 3300050492 Bacteria 1571
454 nmdc:mga0yw44_1424_c1 3300050492 Bacteria 9498
455 nmdc:mga0yw44_281923_c1 3300050492 Bacteria 1111
456 nmdc:mga06z11_162222_c1 3300050494 Bacteria 1278
457 nmdc:mga06z11_22508_c1 3300050494 Bacteria 2521
458 nmdc:mga06z11_469619_c1 3300050494 Bacteria 761
459 nmdc:mga05p37_2018_c1 3300050507 Bacteria 23680
460 nmdc:mga05p37_61545_c1 3300050507 Bacteria 4621
461 nmdc:mga05p37_82060_c1 3300050507 Bacteria 3972
462 nmdc:mga05p37_96263_c1 3300050507 Bacteria 3647
463 nmdc:mga09592_1010986_c1 3300050508 Bacteria 695
464 nmdc:mga09592_23137_c1 3300050508 Bacteria 5130
465 nmdc:mga09592_24048_c1 3300050508 Bacteria 5036
466 nmdc:mga09592_289580_c1 3300050508 Bacteria 1420
467 nmdc:mga09592_654594_c1 3300050508 Bacteria 897
468 nmdc:mga09592_68154_c1 3300050508 Bacteria 3018
469 nmdc:mga0qj67_212801_c1 3300050509 Bacteria 1570
470 nmdc:mga0qj67_301847_c1 3300050509 Bacteria 1297
471 nmdc:mga0qj67_5626_c1 3300050509 Bacteria 9164
472 nmdc:mga0qj67_6237_c1 3300050509 Bacteria 8756
473 nmdc:mga06r32_126502_c1 3300050510 Bacteria 2525
474 nmdc:mga06r32_1546_c1 3300050510 Bacteria 20726
475 nmdc:mga06r32_426813_c1 3300050510 Bacteria 1307
476 nmdc:mga06r32_6169_c1 3300050510 Bacteria 10761
477 nmdc:mga06r32_93147_c1 3300050510 Bacteria 2947
478 nmdc:mga08y16_28534_c1 3300050511 Bacteria 5242
479 nmdc:mga08y16_827600_c1 3300050511 Bacteria 917
480 nmdc:mga0n895_126378_c1 3300050512 Bacteria 2581
481 nmdc:mga0n895_205588_c1 3300050512 Bacteria 2000
482 nmdc:mga0n895_388582_c1 3300050512 Bacteria 1412
483 nmdc:mga0n895_566648_c1 3300050512 Bacteria 1141
484 nmdc:mga0rr50_211420_c1 3300050513 Bacteria 1598
485 nmdc:mga0a205_62731_c1 3300050515 Bacteria 3591
486 nmdc:mga0a205_91048_c1 3300050515 Bacteria 2947
487 nmdc:mga0sz30_26653_c1 3300050516 Bacteria 2370
488 Ga0495619_0068682 3300053085 Bacteria 2368
489 Ga0500616_0001807 3300053153 Bacteria 19448
490 Ga0500616_0014388 3300053153 Bacteria 4547
491 Ga0500616_0149067 3300053153 Bacteria 1085
492 Ga0501084_0036475 3300054114 Bacteria 4107
493 Ga0501084_0040975 3300054114 Bacteria 3874
494 Ga0501084_0060098 3300054114 Bacteria 3182
495 Ga0501084_0081134 3300054114 Bacteria 2720
496 Ga0590071_109347 3300059421 Bacteria 700
497 Ga0590074_007285 3300059423 Bacteria 1838
498 Ga0590074_035317 3300059423 Bacteria 891
499 Ga0590077_024879 3300059426 Bacteria 1287
500 Ga0590077_073721 3300059426 Bacteria 781
501 Ga0587083_0100231 3300059505 Bacteria 720
502 Ga0587099_011948 3300059622 Bacteria 887
503 Ga0501082_0014332 3300060353 Bacteria 6821
504 Ga0501082_0065299 3300060353 Bacteria 3134
505 Ga0501082_0076252 3300060353 Bacteria 2890
506 Ga0501082_0401094 3300060353 Bacteria 1197
507 Ga0530510_0017185 3300061734 Bacteria 5125
508 Ga0530510_0018828 3300061734 Bacteria 4897
509 Ga0530510_0140173 3300061734 Bacteria 1781
510 Ga0307412_10142937
511 LJQas_1002241
512 JGI24737J22298_10004822
513 JGI25406J46586_10075815
514 JGI25406J46586_10122537
515 JGI25407J50210_10000029
516 JGI25407J50210_10002132
517 JGI25407J50210_10068943
518 JGI25404J52841_10038869
519 Ga0070670_100420782
520 Ga0070682_100417669
521 Ga0068868_100316516
522 Ga0070689_100203249
523 Ga0070691_10226223
524 Ga0070661_100746779
525 Ga0070692_10070644
526 Ga0070671_100001169
527 Ga0070674_100221730
528 Ga0070688_100142727
529 Ga0070659_100426493
530 Ga0070659_101060594
531 Ga0070667_100132951
532 Ga0070703_10127173
533 Ga0070714_100083868
534 Ga0070713_101020100
535 Ga0070711_100725216
536 Ga0070663_100391027
537 Ga0070662_100261418
538 Ga0068867_100563078
539 Ga0070685_10205503
540 Ga0070685_10590178
541 Ga0070679_101370969
542 Ga0070684_100692634
543 Ga0070697_100055694
544 Ga0070697_100717590
545 Ga0068853_100540915
546 Ga0070672_100519166
547 Ga0070686_100412800
548 Ga0070686_100816642
549 Ga0070665_100001232
550 Ga0070665_100002166
551 Ga0070664_100885377
552 Ga0068857_100209462
553 Ga0068856_100482582
554 Ga0068859_100000102
555 Ga0068866_10210368
556 Ga0068861_100466567
557 Ga0068863_100634762
558 Ga0068858_100011369
559 Ga0068858_100685333
560 Ga0068860_100438316
561 Ga0068860_100820199
562 Ga0068862_100000273
563 Ga0068862_100037341
564 Ga0081455_10136866
565 Ga0081455_10147252
566 Ga0081538_10001284
567 Ga0081538_10003414
568 Ga0081538_10005797
569 Ga0081538_10010866
570 Ga0081538_10049974
571 Ga0081538_10162322
572 Ga0081540_1011224
573 Ga0081540_1117352
574 Ga0081540_1135567
575 Ga0081539_10003101
576 Ga0081539_10004616
577 Ga0081539_10035146
578 Ga0070717_10085050
579 Ga0070717_10546411
580 Ga0075365_10001725
581 Ga0075365_10339510
582 Ga0075363_100014882
583 Ga0075363_100088793
584 Ga0075363_100189392
585 Ga0075364_10000061
586 Ga0075364_10039885
587 Ga0075364_10373412
588 Ga0070715_10003987
589 Ga0075362_10042579
590 Ga0075367_10041970
591 Ga0075367_10192090
592 Ga0075367_10283724
593 Ga0075427_10021425
594 Ga0097621_100799605
595 Ga0075370_10021525
596 Ga0068871_100329328
597 Ga0075428_100001570
598 Ga0075428_100026345
599 Ga0075428_100076464
600 Ga0075428_100155717
601 Ga0075428_100599641
602 Ga0075428_101085688
603 Ga0075430_100000756
604 Ga0075430_100181157
605 Ga0075431_100000685
606 Ga0075431_100186596
607 Ga0075431_100191964
608 Ga0075431_100711541
609 Ga0075433_10121189
610 Ga0075433_10121810
611 Ga0075433_11027908
612 Ga0075434_100026259
613 Ga0075434_100039444
614 Ga0075434_100088200
615 Ga0075434_100136585
616 Ga0075429_100000770
617 Ga0075429_100001823
618 Ga0075429_100234442
619 Ga0068865_100140536
620 Ga0068865_100466831
621 Ga0075436_100168885
622 Ga0097620_100000102
623 Ga0099826_10175874
624 Ga0075435_100029454
625 Ga0075435_100407534
626 Ga0105244_10221256
627 Ga0105240_10000541
628 Ga0105240_10447013
629 Ga0111539_10001628
630 Ga0111539_10033938
631 Ga0111539_10275210
632 Ga0111539_10458539
633 Ga0105245_10133091
634 Ga0105245_10457177
635 Ga0105247_10373360
636 Ga0114129_10122956
637 Ga0114129_10251725
638 Ga0105243_10009821
639 Ga0105243_10908922
640 Ga0105242_10194641
641 Ga0105242_10229981
642 Ga0105238_10004346
643 Ga0105249_10025896
644 Ga0105249_10122139
645 Ga0105239_10077436
646 Ga0105239_10090362
647 Ga0105239_10834804
648 Ga0105246_10121032
649 Ga0157340_1002615
650 Ga0157344_1004743
651 Ga0157346_1004181
652 Ga0157318_1004299
653 Ga0157321_1004319
654 Ga0157323_1010434
655 Ga0157326_1007338
656 Ga0157370_11006218
657 Ga0157378_10688498
658 Ga0157378_10975090
659 Ga0163162_10539478
660 Ga0163162_10562455
661 Ga0157372_10959938
662 Ga0157375_10133419
663 Ga0157375_10894441
664 Ga0163163_10043914
665 Ga0163163_10324421
666 Ga0157380_10192196
667 Ga0157380_11545692
668 Ga0157379_10356743
669 Ga0157376_10171009
670 Ga0183367_1004
671 Ga0163161_10079717
672 Ga0163161_10456058
673 Ga0163161_10890268
674 Ga0206353_11188448
675 Ga0207656_10239792
676 Ga0207653_10012251
677 Ga0207692_10036087
678 Ga0207642_10148600
679 Ga0207688_10050845
680 Ga0207680_10483531
681 Ga0207647_10057241
682 Ga0207685_10015307
683 Ga0207699_10073807
684 Ga0207645_10314821
685 Ga0207643_10028465
686 Ga0207705_10588970
687 Ga0207705_10850317
688 Ga0207654_10393052
689 Ga0207695_10010482
690 Ga0207671_10306242
691 Ga0207663_10074640
692 Ga0207662_10083663
693 Ga0207662_10259441
694 Ga0207657_10371010
695 Ga0207694_10031297
696 Ga0207687_10166305
697 Ga0207687_10404871
698 Ga0207700_10329861
699 Ga0207664_10028154
700 Ga0207644_10275141
701 Ga0207690_10836269
702 Ga0207706_10066955
703 Ga0207670_10614606
704 Ga0207704_10341613
705 Ga0207704_10390412
706 Ga0207691_10613797
707 Ga0207689_10382979
708 Ga0207689_10605743
709 Ga0207712_10084778
710 Ga0207668_10058555
711 Ga0207668_11029516
712 Ga0207658_11352769
713 Ga0207703_10014566
714 Ga0207703_10785206
715 Ga0207703_10840038
716 Ga0207678_10138458
717 Ga0207678_10629508
718 Ga0207708_10156870
719 Ga0207702_10812835
720 Ga0207641_10004622
721 Ga0207676_10747828
722 Ga0207674_10177210
723 Ga0207674_10806121
724 Ga0207675_100105040
725 Ga0207675_100398785
726 Ga0207698_10466710
727 Ga0207698_10601437
728 Ga0209966_1018073
729 Ga0209998_10088435
730 Ga0209813_10088254
731 Ga0209974_10064617
732 Ga0207428_10031566
733 Ga0207428_10060001
734 Ga0207428_10124148
735 Ga0207428_10228576
736 Ga0268266_10005545
737 Ga0268266_10293990
738 Ga0268265_10000174
739 Ga0268264_10946205
740 Ga0316177_1062290
741 Ga0316182_1329237
742 Ga0307513_10017011
743 Ga0307408_100044025
744 Ga0307408_100124475
745 Ga0307408_100454292
746 Ga0307514_10235935
747 Ga0307516_10538984
748 Ga0307518_10249955
749 Ga0307410_10008386
750 Ga0307410_10085326
751 Ga0307410_10240228
752 Ga0307406_10001635
753 Ga0307406_10085089
754 Ga0307406_10616443
755 Ga0307406_10848443
756 Ga0307407_10155500
757 Ga0307407_10290057
758 Ga0307407_10657799
759 Ga0307409_100009030
760 Ga0307409_100157473
761 Ga0307409_100181271
762 Ga0307409_100326661
763 Ga0307409_100459573
764 Ga0307409_101388513
765 Ga0307416_100023207
766 Ga0307416_100035047
767 Ga0307416_100212539
768 Ga0307416_100582135
769 Ga0307416_101329449
770 Ga0307416_101341174
771 Ga0307414_10300672
772 Ga0307411_10564104
773 Ga0307415_100011091
774 Ga0307415_100124745
775 Ga0373948_0009558
776 Ga0373959_0057701
777 Ga0373938_0021142
778 Ga0373949_0052563
779 Ga0373952_0043345
780 Ga0373932_0118810
781 Ga0373939_0005001
782 Ga0373941_0055392
783 Ga0373960_0093095
784 Ga0373960_0135169
785 Ga0373942_0014607
786 Ga0373961_0127563
787 Ga0373931_0052821
788 Ga0395900_0274152
789 Ga0395898_0007500
790 Ga0395898_0156282
791 Ga0395905_0152412
792 Ga0395905_0677886
793 Ga0395901_0748288
794 Ga0439436_0007138
795 Ga0439453_0083771
796 Ga0451835_0942724
797 Ga0451837_1557500
798 Ga0451855_0387345
799 Ga0439433_0004141
800 Ga0439445_0088232
801 Ga0439450_008075
802 Ga0439454_008771
803 Ga0439455_0021093
804 Ga0439455_0076377
805 Ga0439457_004943
806 Ga0439463_009168
807 Ga0439463_062308
808 Ga0450912_008271
809 Ga0450914_011724
810 Ga0450917_004198
811 Ga0450922_008003
812 Ga0450894_000800
813 Ga0450903_006055
814 Ga0450905_017933
815 Ga0439458_0002739
816 Ga0439435_0001806
817 Ga0439444_0007680
818 Ga0450916_019706
819 Ga0450901_008830
820 Ga0450901_009240
821 Ga0439440_0008832
822 Ga0439440_0082446
823 Ga0466972_0005102
824 Ga0466965_0434879
825 Ga0466961_0131280
826 Ga0466963_0015743
827 Ga0466968_0169418
828 Ga0466970_0004665
829 Ga0466960_0014092
830 Ga0466960_0454884
831 Ga0466967_0001185
832 Ga0466967_0953315
833 Ga0466967_1081903
834 Ga0495629_0035423
835 Ga0495638_0355884
836 Ga0495584_0087595
837 Ga0495585_0315577
838 Ga0495594_0001029
839 Ga0495596_0093766
840 Ga0495607_0161485
841 Ga0495583_0094077
842 Ga0495583_0126416
843 Ga0495608_0127750
844 Ga0495610_0231753
845 Ga0495620_0163456
846 Ga0495632_0102956
847 Ga0495637_0175697
848 Ga0495643_0276667
849 Ga0495644_0106687
850 Ga0495642_0137910
851 Ga0495621_0112926
852 Ga0495597_0176786
853 Ga0495656_0021768
854 Ga0495668_0124585
855 Ga0495611_0188763
856 Ga0495625_0020154
857 Ga0495659_0189872
858 Ga0495588_0023232
859 Ga0495669_0200369
860 Ga0495670_0493742
861 Ga0495649_0174087
862 Ga0495589_0170860
863 Ga0495660_0068756
864 Ga0495672_0307245
865 Ga0495676_0001676
866 Ga0495677_0176404
867 Ga0495679_097946
868 Ga0495673_0182595
869 Ga0496100_0147192
870 Ga0496101_0653043
871 Ga0496102_0330963
872 Ga0496102_1195747
873 Ga0496104_0005320
874 Ga0496105_0060311
875 Ga0496105_0274888
876 Ga0496107_0336200
877 Ga0496108_0016795
878 Ga0496108_0124124
879 Ga0496109_0048182
880 Ga0496109_0081128
881 Ga0496110_0074228
882 Ga0496111_0871262
883 Ga0496112_0573133
884 Ga0496113_0469568
885 Ga0496114_0874681
886 Ga0496115_0098869
887 Ga0501296_028339
888 Ga0501321_025055
889 Ga0501031_0189563
890 Ga0501033_0216971
891 Ga0501034_0017805
892 Ga0501034_0088834
893 Ga0501034_0279390
894 Ga0501036_0037786
895 Ga0501036_0043058
896 Ga0501036_0098898
897 Ga0501036_0128230
898 Ga0501036_0225419
899 Ga0501038_0001048
900 Ga0501039_0250814
901 Ga0501039_0486466
902 Ga0501039_0664888
903 Ga0501040_0062731
904 Ga0501040_0070631
905 Ga0501040_0071450
906 Ga0501040_0090732
907 Ga0501040_0093069
908 Ga0501041_0041143
909 Ga0501041_0095716
910 Ga0501041_0154920
911 Ga0501042_0028868
912 Ga0501042_0099211
913 Ga0501042_0144383
914 Ga0501042_0462853
915 Ga0501042_0749180
916 Ga0501046_0080717
917 Ga0501046_0507575
918 Ga0501047_0007867
919 Ga0501047_0040233
920 Ga0501048_0501992
921 Ga0501048_0875517
922 Ga0501068_0156860
923 Ga0501068_0265377
924 Ga0501071_0023618
925 Ga0501072_0305215
926 Ga0501072_0394735
927 Ga0501073_0474358
928 Ga0501074_0110613
929 Ga0501075_0037228
930 Ga0501075_0121391
931 Ga0501076_0022359
932 Ga0501076_0059539
933 Ga0501077_0082570
934 Ga0501077_0087038
935 Ga0501234_059870
936 Ga0501079_0043944
937 Ga0501079_0078592
938 Ga0501081_0010287
939 Ga0501081_0163468
940 Ga0501081_0196435
941 Ga0501081_0690795
942 Ga0501264_025518
943 Ga0501267_010625
944 Ga0501268_061479
945 Ga0501035_0160817
946 Ga0501035_0607611
947 Ga0501035_0696124
948 Ga0501044_0213786
949 Ga0501044_0870919
950 Ga0501045_0012990
951 Ga0501045_0148193
952 Ga0501212_021292
953 nmdc:mga03683_34855_c1
954 nmdc:mga03683_69473_c1
955 nmdc:mga03n38_10533_c1
956 nmdc:mga03n38_36328_c1
957 nmdc:mga00v17_125629_c1
958 nmdc:mga00v17_19627_c1
959 nmdc:mga00v17_3110_c1
960 nmdc:mga00v17_442870_c1
961 nmdc:mga00v17_709169_c1
962 nmdc:mga0yw44_140190_c1
963 nmdc:mga0yw44_1424_c1
964 nmdc:mga0yw44_281923_c1
965 nmdc:mga06z11_162222_c1
966 nmdc:mga06z11_22508_c1
967 nmdc:mga06z11_469619_c1
968 nmdc:mga05p37_2018_c1
969 nmdc:mga05p37_61545_c1
970 nmdc:mga05p37_82060_c1
971 nmdc:mga05p37_96263_c1
972 nmdc:mga09592_1010986_c1
973 nmdc:mga09592_23137_c1
974 nmdc:mga09592_24048_c1
975 nmdc:mga09592_289580_c1
976 nmdc:mga09592_654594_c1
977 nmdc:mga09592_68154_c1
978 nmdc:mga0qj67_212801_c1
979 nmdc:mga0qj67_301847_c1
980 nmdc:mga0qj67_5626_c1
981 nmdc:mga0qj67_6237_c1
982 nmdc:mga06r32_126502_c1
983 nmdc:mga06r32_1546_c1
984 nmdc:mga06r32_426813_c1
985 nmdc:mga06r32_6169_c1
986 nmdc:mga06r32_93147_c1
987 nmdc:mga08y16_28534_c1
988 nmdc:mga08y16_827600_c1
989 nmdc:mga0n895_126378_c1
990 nmdc:mga0n895_205588_c1
991 nmdc:mga0n895_388582_c1
992 nmdc:mga0n895_566648_c1
993 nmdc:mga0rr50_211420_c1
994 nmdc:mga0a205_62731_c1
995 nmdc:mga0a205_91048_c1
996 nmdc:mga0sz30_26653_c1
997 Ga0495619_0068682
998 Ga0500616_0001807
999 Ga0500616_0014388
1000 Ga0500616_0149067
1001 Ga0501084_0036475
1002 Ga0501084_0040975
1003 Ga0501084_0060098
1004 Ga0501084_0081134
1005 Ga0590071_109347
1006 Ga0590074_007285
1007 Ga0590074_035317
1008 Ga0590077_024879
1009 Ga0590077_073721
1010 Ga0587083_0100231
1011 Ga0587099_011948
1012 Ga0501082_0014332
1013 Ga0501082_0065299
1014 Ga0501082_0076252
1015 Ga0501082_0401094
1016 Ga0530510_0017185
1017 Ga0530510_0018828
1018 Ga0530510_0140173

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

2

181

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7506 1 188
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7502 2 190
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7462 2 190
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7414 3 190
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7388 1 188
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.746 1 188 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7342 1 188 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7284 4 188 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7275 1 191 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7247 3 187 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A6B3CCB0-F1-model_v4 Dihydrofolate reductase family protein 0.9488 102 194 GO:0008703
GO:0009231
AF-A0A1G8Y8C3-F1-model_v4 RibD C-terminal domain-containing protein 0.9476 28 199 GO:0008703
GO:0009231
AF-A0A429AF06-F1-model_v4 deleted 0.9459 1 201
AF-A0A6J4IMI5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.944 1 201 GO:0008703
GO:0009231
AF-A0A5S5CTI2-F1-model_v4 Dihydrofolate reductase 0.9432 46 201 GO:0008703
GO:0009231

Map