F456985

General Info

Members Datasets Scaffolds Average Seq Length
509 317 509 119

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_11519837|Ga0157380_115198371
Length 125
Sequence LIKHLLEYRTVTTTMDDERLDAMFAALADRTRRDIVARLSEGEATVKELAAPYGMTMQAVSQHIGVLERCGLISRGRHRQTRPCRLEPQALEEAVSWIEHSRRVWAERMDRLEAHLDRLQEDQQR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
179 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
182 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
183 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
186 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
189 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
288 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
289 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
298 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
309 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
310 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
311 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
312 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
313 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 0
Rhizoplane 3.14
Rhizosphere 85.66
Stem 0
Stem Tuber 0
Unclassified 3.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10020274 3300003320 Bacteria 4190
2 rootH2_10087120 3300003320 Bacteria 1616
3 Ga0006562J51391_1136862 3300003578 Bacteria 1060
4 Ga0055524_1000251 3300003775 Bacteria 55840
5 Ga0055534_1048317 3300003784 Bacteria 610
6 Ga0070670_101250460 3300005331 Bacteria 679
7 Ga0070682_101267448 3300005337 Unclassified 625
8 Ga0070682_101322552 3300005337 Bacteria 613
9 Ga0070682_101594457 3300005337 Bacteria 564
10 Ga0068868_100338521 3300005338 Bacteria 1286
11 Ga0068868_102084602 3300005338 Bacteria 539
12 Ga0070660_100727153 3300005339 Bacteria 833
13 Ga0070660_100801231 3300005339 Bacteria 792
14 Ga0070687_101182895 3300005343 Bacteria 563
15 Ga0070692_10244844 3300005345 Bacteria 1070
16 Ga0070692_10264340 3300005345 Bacteria 1036
17 Ga0070668_101950299 3300005347 Bacteria 541
18 Ga0070674_100543089 3300005356 Bacteria 974
19 Ga0070673_101342522 3300005364 Bacteria 672
20 Ga0070688_100202916 3300005365 Bacteria 1388
21 Ga0070709_10141216 3300005434 Bacteria 1655
22 Ga0070709_10867400 3300005434 Bacteria 712
23 Ga0070714_100009814 3300005435 Bacteria 7546
24 Ga0070714_100650491 3300005435 Bacteria 1015
25 Ga0070713_100769209 3300005436 Bacteria 922
26 Ga0070710_10010663 3300005437 Bacteria 4519
27 Ga0070701_10023734 3300005438 Bacteria 2958
28 Ga0070701_11156279 3300005438 Unclassified 547
29 Ga0070711_100126338 3300005439 Bacteria 1899
30 Ga0070705_100023787 3300005440 Bacteria 3296
31 Ga0070705_100367374 3300005440 Bacteria 1055
32 Ga0070705_100460605 3300005440 Bacteria 956
33 Ga0070700_100000003 3300005441 Bacteria 261247
34 Ga0070694_100190734 3300005444 Bacteria 1522
35 Ga0070694_100541872 3300005444 Bacteria 931
36 Ga0070663_100571594 3300005455 Bacteria 947
37 Ga0070663_100719201 3300005455 Bacteria 850
38 Ga0070678_100773853 3300005456 Bacteria 870
39 Ga0070662_100113697 3300005457 Bacteria 2066
40 Ga0070662_101512147 3300005457 Bacteria 579
41 Ga0068867_100060729 3300005459 Bacteria 2805
42 Ga0068867_100951345 3300005459 Bacteria 776
43 Ga0070707_100002617 3300005468 Bacteria 17105
44 Ga0070707_100089840 3300005468 Bacteria 2973
45 Ga0070707_100181519 3300005468 Bacteria 2052
46 Ga0070707_101043591 3300005468 Bacteria 783
47 Ga0070698_100106145 3300005471 Bacteria 2778
48 Ga0070698_100146996 3300005471 Bacteria 2306
49 Ga0070698_100698146 3300005471 Bacteria 957
50 Ga0070699_100880049 3300005518 Bacteria 820
51 Ga0070699_101203285 3300005518 Bacteria 695
52 Ga0070679_100022892 3300005530 Bacteria 6111
53 Ga0070697_100222502 3300005536 Bacteria 1609
54 Ga0070697_100662218 3300005536 Bacteria 920
55 Ga0068853_100814963 3300005539 Bacteria 894
56 Ga0070672_100145565 3300005543 Bacteria 1958
57 Ga0070672_100180286 3300005543 Bacteria 1760
58 Ga0070695_100412967 3300005545 Bacteria 1026
59 Ga0070696_100040043 3300005546 Bacteria 3235
60 Ga0070696_100047743 3300005546 Bacteria 2971
61 Ga0070693_100762685 3300005547 Bacteria 714
62 Ga0070665_101260463 3300005548 Bacteria 749
63 Ga0070704_100053024 3300005549 Bacteria 2865
64 Ga0070704_100191226 3300005549 Bacteria 1645
65 Ga0070704_100544529 3300005549 Bacteria 1013
66 Ga0068855_100763609 3300005563 Bacteria 1030
67 Ga0068857_100008928 3300005577 Bacteria 8684
68 Ga0068856_100085538 3300005614 Bacteria 3132
69 Ga0068852_102373049 3300005616 Bacteria 551
70 Ga0068859_100212086 3300005617 Bacteria 2023
71 Ga0068859_100874412 3300005617 Bacteria 984
72 Ga0068864_100586313 3300005618 Bacteria 1081
73 Ga0068864_101435181 3300005618 Bacteria 692
74 Ga0068866_10378436 3300005718 Bacteria 907
75 Ga0068861_100157124 3300005719 Bacteria 1872
76 Ga0068870_10009964 3300005840 Bacteria 4344
77 Ga0068863_100178250 3300005841 Bacteria 2040
78 Ga0068858_100769663 3300005842 Bacteria 938
79 Ga0068860_100537735 3300005843 Bacteria 1170
80 Ga0068862_100001624 3300005844 Bacteria 20473
81 Ga0068862_100095847 3300005844 Bacteria 2589
82 Ga0081538_10017285 3300005981 Bacteria 5482
83 Ga0081538_10028702 3300005981 Bacteria 3819
84 Ga0081539_10026515 3300005985 Bacteria 3696
85 Ga0070717_10161546 3300006028 Bacteria 1944
86 Ga0075365_10846714 3300006038 Bacteria 645
87 Ga0075363_100078432 3300006048 Bacteria 1803
88 Ga0075364_10039235 3300006051 Bacteria 3069
89 Ga0070712_100189071 3300006175 Bacteria 1610
90 Ga0075362_10002166 3300006177 Bacteria 6502
91 Ga0075362_10392720 3300006177 Bacteria 699
92 Ga0075367_10001770 3300006178 Bacteria 9489
93 Ga0075369_10045986 3300006186 Bacteria 1878
94 Ga0075366_10030141 3300006195 Bacteria 3188
95 Ga0075366_10384340 3300006195 Bacteria 863
96 Ga0075370_10001219 3300006353 Bacteria 10879
97 Ga0075370_10051313 3300006353 Bacteria 2340
98 Ga0075428_101145915 3300006844 Bacteria 821
99 Ga0075430_100065222 3300006846 Bacteria 3059
100 Ga0075430_100635849 3300006846 Bacteria 880
101 Ga0075433_11058422 3300006852 Bacteria 706
102 Ga0075429_100173056 3300006880 Bacteria 1891
103 Ga0075429_100470611 3300006880 Bacteria 1101
104 Ga0097620_100212096 3300006931 Bacteria 2023
105 Ga0097620_100874380 3300006931 Bacteria 984
106 Ga0097620_101317300 3300006931 Bacteria 796
107 Ga0105240_10014731 3300009093 Bacteria 10667
108 Ga0111539_10621246 3300009094 Bacteria 1258
109 Ga0105245_10086216 3300009098 Bacteria 2880
110 Ga0105245_10801101 3300009098 Bacteria 980
111 Ga0105245_11023893 3300009098 Unclassified 871
112 Ga0105247_10117647 3300009101 Bacteria 1718
113 Ga0114129_10232236 3300009147 Bacteria 2484
114 Ga0114129_10362183 3300009147 Bacteria 1918
115 Ga0114129_11210195 3300009147 Bacteria 940
116 Ga0114129_11497041 3300009147 Bacteria 829
117 Ga0105243_10127652 3300009148 Bacteria 2154
118 Ga0105243_10410618 3300009148 Bacteria 1260
119 Ga0105243_10910174 3300009148 Bacteria 876
120 Ga0105243_11264286 3300009148 Bacteria 754
121 Ga0105241_10783968 3300009174 Bacteria 877
122 Ga0105241_11020082 3300009174 Bacteria 775
123 Ga0105242_10270728 3300009176 Bacteria 1538
124 Ga0105242_12239422 3300009176 Bacteria 592
125 Ga0105248_12760778 3300009177 Bacteria 560
126 Ga0105237_10000523 3300009545 Bacteria 54108
127 Ga0105238_10003906 3300009551 Bacteria 14804
128 Ga0105238_11441909 3300009551 Bacteria 716
129 Ga0105249_10003530 3300009553 Bacteria 13520
130 Ga0105249_10312034 3300009553 Bacteria 1581
131 Ga0105249_10403408 3300009553 Bacteria 1398
132 Ga0105239_10007336 3300010375 Bacteria 12660
133 Ga0105239_11391132 3300010375 Bacteria 810
134 Ga0105239_11595400 3300010375 Bacteria 755
135 Ga0105246_10763302 3300011119 Bacteria 854
136 Ga0157369_10030265 3300013105 Bacteria 5973
137 Ga0157369_10230226 3300013105 Bacteria 1938
138 Ga0157369_12081416 3300013105 Bacteria 576
139 Ga0171462_1029 3300013250 Bacteria 110139
140 Ga0157374_11935603 3300013296 Bacteria 615
141 Ga0163162_10835783 3300013306 Bacteria 1037
142 Ga0157372_10049615 3300013307 Bacteria 4668
143 Ga0157375_10017895 3300013308 Bacteria 6410
144 Ga0163163_10050812 3300014325 Bacteria 4084
145 Ga0157380_10348335 3300014326 Bacteria 1385
146 Ga0157380_11519837 3300014326 Bacteria 723
147 Ga0157379_10632819 3300014968 Bacteria 1000
148 Ga0157379_11173849 3300014968 Bacteria 738
149 Ga0157376_11019441 3300014969 Bacteria 851
150 Ga0157376_11470076 3300014969 Bacteria 714
151 Ga0163161_10267783 3300017792 Bacteria 1336
152 Ga0197907_10991673 3300020069 Bacteria 997
153 Ga0206356_11870219 3300020070 Bacteria 1532
154 Ga0206354_10011937 3300020081 Bacteria 1107
155 Ga0206353_11278172 3300020082 Bacteria 5014
156 Ga0209673_1093374 3300025273 Bacteria 661
157 Ga0209675_1006177 3300025291 Bacteria 4864
158 Ga0209676_1038884 3300025292 Bacteria 1358
159 Ga0209564_1000052 3300025295 Bacteria 356578
160 Ga0209256_1000099 3300025299 Bacteria 203782
161 Ga0207692_10204305 3300025898 Bacteria 1163
162 Ga0207710_10265343 3300025900 Bacteria 861
163 Ga0207685_10334240 3300025905 Bacteria 759
164 Ga0207699_10131581 3300025906 Bacteria 1632
165 Ga0207699_10671945 3300025906 Bacteria 757
166 Ga0207645_10256247 3300025907 Bacteria 1158
167 Ga0207643_10049633 3300025908 Unclassified 2378
168 Ga0207684_10002304 3300025910 Bacteria 19417
169 Ga0207684_11686289 3300025910 Bacteria 511
170 Ga0207654_10360353 3300025911 Bacteria 1003
171 Ga0207695_10046160 3300025913 Bacteria 4619
172 Ga0207671_10004041 3300025914 Bacteria 14229
173 Ga0207693_10149512 3300025915 Bacteria 1837
174 Ga0207663_10065192 3300025916 Bacteria 2327
175 Ga0207660_10541251 3300025917 Bacteria 947
176 Ga0207662_10967020 3300025918 Bacteria 604
177 Ga0207652_10157931 3300025921 Bacteria 2032
178 Ga0207646_10011244 3300025922 Bacteria 8693
179 Ga0207646_10185546 3300025922 Bacteria 1879
180 Ga0207646_10201130 3300025922 Bacteria 1799
181 Ga0207646_11090217 3300025922 Bacteria 703
182 Ga0207681_10001082 3300025923 Bacteria 17666
183 Ga0207681_11829566 3300025923 Bacteria 506
184 Ga0207694_10377895 3300025924 Bacteria 1176
185 Ga0207687_10157574 3300025927 Bacteria 1739
186 Ga0207700_10619927 3300025928 Bacteria 963
187 Ga0207700_10650213 3300025928 Bacteria 940
188 Ga0207664_10107446 3300025929 Bacteria 2315
189 Ga0207664_10386012 3300025929 Bacteria 1244
190 Ga0207690_10692912 3300025932 Bacteria 837
191 Ga0207706_10027919 3300025933 Bacteria 5044
192 Ga0207686_10278505 3300025934 Bacteria 1234
193 Ga0207709_10577565 3300025935 Bacteria 887
194 Ga0207669_10734620 3300025937 Bacteria 814
195 Ga0207691_10172309 3300025940 Bacteria 1894
196 Ga0207661_10161549 3300025944 Bacteria 1944
197 Ga0207667_10085907 3300025949 Bacteria 3256
198 Ga0207651_11484942 3300025960 Bacteria 610
199 Ga0207712_10002684 3300025961 Bacteria 11368
200 Ga0207712_10134892 3300025961 Bacteria 1886
201 Ga0207712_10226906 3300025961 Bacteria 1497
202 Ga0207712_11203576 3300025961 Bacteria 676
203 Ga0207668_10011208 3300025972 Bacteria 5441
204 Ga0207677_10336714 3300026023 Bacteria 1259
205 Ga0207639_11391690 3300026041 Bacteria 658
206 Ga0207678_10460865 3300026067 Unclassified 1106
207 Ga0207678_10558485 3300026067 Bacteria 1002
208 Ga0207708_10000002 3300026075 Bacteria 411071
209 Ga0207708_10526320 3300026075 Bacteria 994
210 Ga0207702_10186879 3300026078 Bacteria 1911
211 Ga0207641_10340728 3300026088 Bacteria 1427
212 Ga0207648_10097107 3300026089 Bacteria 2579
213 Ga0207648_10788173 3300026089 Bacteria 884
214 Ga0207676_10256155 3300026095 Bacteria 1578
215 Ga0207676_10507478 3300026095 Bacteria 1146
216 Ga0207674_10016870 3300026116 Bacteria 7979
217 Ga0207675_100137015 3300026118 Bacteria 2324
218 Ga0207683_10068153 3300026121 Bacteria 3141
219 Ga0207683_10505902 3300026121 Bacteria 1116
220 Ga0207698_10771154 3300026142 Bacteria 962
221 Ga0207698_11395110 3300026142 Bacteria 716
222 Ga0209974_10025424 3300027876 Bacteria 1959
223 Ga0209974_10095785 3300027876 Bacteria 1033
224 Ga0209974_10272912 3300027876 Bacteria 641
225 Ga0207428_10431291 3300027907 Bacteria 962
226 Ga0268265_10015988 3300028380 Bacteria 5148
227 Ga0268265_10108314 3300028380 Bacteria 2262
228 Ga0268264_10140319 3300028381 Bacteria 2154
229 Ga0268264_10353647 3300028381 Bacteria 1399
230 Ga0265334_10023452 3300028573 Bacteria 2509
231 Ga0307515_10010929 3300028794 Bacteria 17310
232 Ga0307515_10116703 3300028794 Bacteria 3062
233 Ga0265331_10573949 3300031250 Unclassified 509
234 Ga0265316_10957208 3300031344 Bacteria 597
235 Ga0307513_10009552 3300031456 Bacteria 12262
236 Ga0307513_10262634 3300031456 Bacteria 1515
237 Ga0307408_100957549 3300031548 Bacteria 787
238 Ga0307516_10021238 3300031730 Bacteria 6688
239 Ga0307516_10028507 3300031730 Bacteria 5649
240 Ga0307516_10571681 3300031730 Bacteria 784
241 Ga0307405_10166588 3300031731 Bacteria 1567
242 Ga0307405_11855033 3300031731 Bacteria 537
243 Ga0307413_11160670 3300031824 Bacteria 670
244 Ga0307410_10422311 3300031852 Bacteria 1082
245 Ga0307410_11555962 3300031852 Bacteria 583
246 Ga0326468_10057957 3300031889 Bacteria 608
247 Ga0307406_11084595 3300031901 Bacteria 691
248 Ga0307407_11007017 3300031903 Bacteria 644
249 Ga0307412_10809714 3300031911 Bacteria 814
250 Ga0307412_11105022 3300031911 Bacteria 706
251 Ga0307409_100172794 3300031995 Bacteria 1904
252 Ga0307409_100365739 3300031995 Bacteria 1366
253 Ga0307409_101616491 3300031995 Bacteria 676
254 Ga0307409_102436463 3300031995 Bacteria 552
255 Ga0307416_102925912 3300032002 Bacteria 571
256 Ga0307416_103182637 3300032002 Bacteria 549
257 Ga0307414_10215147 3300032004 Bacteria 1574
258 Ga0307414_10604510 3300032004 Bacteria 984
259 Ga0307414_11248052 3300032004 Bacteria 689
260 Ga0307411_10786304 3300032005 Bacteria 837
261 Ga0307411_11677736 3300032005 Bacteria 588
262 Ga0307411_12210205 3300032005 Unclassified 516
263 Ga0307415_100086024 3300032126 Bacteria 2261
264 Ga0307415_100731166 3300032126 Bacteria 896
265 Ga0307415_101249187 3300032126 Bacteria 702
266 Ga0307415_101270190 3300032126 Unclassified 696
267 Ga0307415_102004711 3300032126 Bacteria 564
268 Ga0373935_0198295 3300035692 Bacteria 1386
269 Ga0373935_0600969 3300035692 Bacteria 804
270 Ga0373937_0149320 3300036401 Bacteria 2189
271 Ga0373925_0671147 3300037068 Bacteria 854
272 Ga0395900_0135473 3300037418 Bacteria 2523
273 Ga0395900_0162434 3300037418 Bacteria 2278
274 Ga0395900_0577204 3300037418 Bacteria 1067
275 Ga0395898_0133625 3300037466 Bacteria 2376
276 Ga0395898_1266628 3300037466 Bacteria 667
277 Ga0436364_0385737 3300037853 Bacteria 692
278 Ga0395901_0114429 3300038443 Bacteria 2834
279 Ga0237816_04283 3300039145 Bacteria 999
280 Ga0439466_0112035 3300041411 Bacteria 846
281 Ga0439465_0144445 3300041413 Bacteria 847
282 Ga0439465_0285535 3300041413 Bacteria 615
283 Ga0451791_0730496 3300041451 Bacteria 1020
284 Ga0451793_0055040 3300041452 Bacteria 866
285 Ga0451802_1961840 3300041460 Bacteria 1081
286 Ga0451807_1343908 3300041486 Bacteria 859
287 Ga0451833_0723785 3300041491 Bacteria 793
288 Ga0451833_0831283 3300041491 Bacteria 1160
289 Ga0451835_0713824 3300041492 Bacteria 826
290 Ga0451853_0708726 3300041512 Bacteria 893
291 Ga0451853_3356586 3300041512 Bacteria 666
292 Ga0439431_0153847 3300041997 Bacteria 655
293 Ga0450923_126994 3300042125 Bacteria 605
294 Ga0466969_0112142 3300044656 Bacteria 1275
295 Ga0466969_0391306 3300044656 Bacteria 631
296 Ga0466965_0039416 3300044683 Bacteria 2322
297 Ga0466965_0138422 3300044683 Bacteria 1266
298 Ga0466965_0218974 3300044683 Bacteria 1014
299 Ga0466965_0305182 3300044683 Bacteria 864
300 Ga0466965_0764441 3300044683 Bacteria 557
301 Ga0466965_0926587 3300044683 Bacteria 509
302 Ga0466966_0008856 3300044684 Bacteria 6665
303 Ga0466966_0109186 3300044684 Bacteria 1706
304 Ga0466966_0110494 3300044684 Bacteria 1695
305 Ga0466966_0196254 3300044684 Bacteria 1222
306 Ga0466966_0226949 3300044684 Bacteria 1127
307 Ga0466961_0033686 3300044693 Bacteria 3290
308 Ga0466961_0092211 3300044693 Bacteria 1912
309 Ga0466961_0332836 3300044693 Bacteria 925
310 Ga0466961_0603622 3300044693 Bacteria 660
311 Ga0466961_0709409 3300044693 Bacteria 602
312 Ga0466963_0027914 3300044694 Bacteria 3618
313 Ga0466963_0250685 3300044694 Bacteria 1242
314 Ga0466963_0630538 3300044694 Bacteria 757
315 Ga0466964_0142124 3300044706 Bacteria 1104
316 Ga0466964_0583870 3300044706 Bacteria 611
317 Ga0466971_0027718 3300044719 Bacteria 2537
318 Ga0466971_0284492 3300044719 Bacteria 792
319 Ga0466970_0011348 3300044765 Bacteria 4542
320 Ga0466970_0037211 3300044765 Bacteria 2579
321 Ga0466970_0319872 3300044765 Bacteria 877
322 Ga0466970_0326319 3300044765 Bacteria 868
323 Ga0466970_0415708 3300044765 Bacteria 768
324 Ga0466970_0653177 3300044765 Bacteria 612
325 Ga0466957_0018000 3300044842 Bacteria 4144
326 Ga0466957_0037376 3300044842 Bacteria 2923
327 Ga0466957_0077177 3300044842 Bacteria 2069
328 Ga0466957_0123081 3300044842 Bacteria 1655
329 Ga0466957_0132231 3300044842 Bacteria 1600
330 Ga0466957_0521076 3300044842 Bacteria 826
331 Ga0466957_1019471 3300044842 Bacteria 595
332 Ga0466960_0005472 3300044901 Bacteria 5034
333 Ga0466960_0115408 3300044901 Bacteria 1400
334 Ga0466960_0121662 3300044901 Bacteria 1368
335 Ga0466960_0138226 3300044901 Bacteria 1292
336 Ga0466960_0187298 3300044901 Bacteria 1125
337 Ga0466960_0230829 3300044901 Bacteria 1021
338 Ga0466960_0414553 3300044901 Bacteria 778
339 Ga0466960_0562311 3300044901 Bacteria 674
340 Ga0466960_0720069 3300044901 Bacteria 600
341 Ga0466959_0020677 3300045049 Bacteria 4850
342 Ga0466959_0096572 3300045049 Bacteria 2118
343 Ga0466959_1051948 3300045049 Bacteria 542
344 Ga0466958_0087038 3300045836 Bacteria 1929
345 Ga0466958_0417123 3300045836 Bacteria 867
346 Ga0466958_0908241 3300045836 Bacteria 574
347 Ga0466967_0002638 3300045976 Bacteria 11299
348 Ga0466967_0096782 3300045976 Bacteria 2693
349 Ga0466967_0113994 3300045976 Bacteria 2488
350 Ga0466967_0308261 3300045976 Bacteria 1524
351 Ga0466967_0650535 3300045976 Bacteria 1042
352 Ga0466967_0747803 3300045976 Bacteria 970
353 Ga0466967_1010354 3300045976 Bacteria 828
354 Ga0466967_1788938 3300045976 Bacteria 612
355 Ga0466967_1850291 3300045976 Bacteria 601
356 Ga0466967_2046776 3300045976 Bacteria 569
357 Ga0495592_0157299 3300046454 Bacteria 1566
358 Ga0495629_0004304 3300046459 Bacteria 10671
359 Ga0495629_0004365 3300046459 Bacteria 10601
360 Ga0495651_0010100 3300046462 Bacteria 7251
361 Ga0495653_0001107 3300046463 Bacteria 20791
362 Ga0495580_0067930 3300046472 Bacteria 2493
363 Ga0495582_0002354 3300046473 Bacteria 10576
364 Ga0495582_0019705 3300046473 Bacteria 3689
365 Ga0495582_0817212 3300046473 Bacteria 539
366 Ga0495639_0002659 3300046475 Bacteria 7756
367 Ga0495662_0001100 3300046476 Bacteria 13301
368 Ga0495664_0007808 3300046477 Bacteria 5953
369 Ga0495594_0000283 3300046499 Bacteria 24954
370 Ga0495594_0002017 3300046499 Bacteria 10573
371 Ga0495610_0066437 3300046512 Bacteria 1698
372 Ga0495618_0088116 3300046514 Bacteria 1985
373 Ga0495628_0032569 3300046516 Bacteria 4207
374 Ga0495632_0030686 3300046519 Bacteria 2787
375 Ga0495643_0223466 3300046522 Bacteria 892
376 Ga0495666_0000599 3300046526 Bacteria 16125
377 Ga0495652_0141101 3300046529 Bacteria 1894
378 Ga0495665_0004376 3300046531 Bacteria 7625
379 Ga0495586_0001932 3300046535 Bacteria 11293
380 Ga0495587_0102036 3300046536 Bacteria 1652
381 Ga0495597_0011512 3300046542 Bacteria 4288
382 Ga0495645_0009238 3300046543 Bacteria 6890
383 Ga0495622_0150000 3300046557 Bacteria 1055
384 Ga0495622_0215768 3300046557 Bacteria 851
385 Ga0495667_0008812 3300046559 Bacteria 6860
386 Ga0495656_0784222 3300046615 Bacteria 515
387 Ga0495634_0000716 3300046642 Bacteria 32120
388 Ga0495625_0001726 3300046660 Bacteria 25344
389 Ga0495635_0013349 3300046663 Bacteria 5750
390 Ga0495657_0279991 3300046675 Unclassified 998
391 Ga0495599_0006273 3300046678 Bacteria 7166
392 Ga0495623_0013841 3300046679 Bacteria 5230
393 Ga0495646_0029421 3300046680 Bacteria 3433
394 Ga0495647_0256865 3300046681 Bacteria 779
395 Ga0495613_0018991 3300046689 Bacteria 5121
396 Ga0495613_0069338 3300046689 Bacteria 2570
397 Ga0495624_0078089 3300046690 Bacteria 2054
398 Ga0495600_0009995 3300046809 Bacteria 5881
399 Ga0495581_0006788 3300047315 Bacteria 6636
400 Ga0495581_0021354 3300047315 Bacteria 3754
401 Ga0495604_0078251 3300047317 Bacteria 2482
402 Ga0495674_0092753 3300047319 Bacteria 2577
403 Ga0495676_0004731 3300047321 Bacteria 12460
404 Ga0495676_0727269 3300047321 Bacteria 641
405 Ga0495680_0020406 3300047322 Bacteria 5575
406 Ga0495687_000350 3300047443 Bacteria 59063
407 Ga0495675_0003952 3300047444 Bacteria 8985
408 Ga0495684_0070685 3300047471 Bacteria 2653
409 Ga0495684_0121129 3300047471 Bacteria 1970
410 Ga0495686_0113101 3300047472 Bacteria 1626
411 Ga0495593_0105486 3300047673 Bacteria 1442
412 Ga0495593_0147563 3300047673 Bacteria 1190
413 Ga0495614_0003981 3300048089 Bacteria 6630
414 Ga0495614_0139527 3300048089 Bacteria 1076
415 Ga0496101_1408177 3300048904 Bacteria 544
416 Ga0496102_1728901 3300048905 Bacteria 543
417 Ga0496103_0002784 3300048906 Bacteria 10882
418 Ga0496106_0010627 3300048909 Bacteria 6802
419 Ga0496107_0586943 3300048910 Bacteria 824
420 Ga0496108_0148804 3300048911 Bacteria 2020
421 Ga0496108_0552250 3300048911 Bacteria 1005
422 Ga0496109_1951428 3300048912 Bacteria 519
423 Ga0496110_1576685 3300048913 Bacteria 567
424 Ga0496111_0942886 3300048914 Bacteria 620
425 Ga0496112_0712550 3300048915 Bacteria 931
426 Ga0496114_0146134 3300048917 Bacteria 2050
427 Ga0496122_0049207 3300048925 Bacteria 3231
428 Ga0496123_0165268 3300048926 Bacteria 1174
429 Ga0496126_0032030 3300048929 Bacteria 4959
430 Ga0501299_102000 3300049522 Unclassified 667
431 Ga0501031_0176337 3300049568 Bacteria 1396
432 Ga0501032_0232780 3300049569 Bacteria 1198
433 Ga0501033_1155912 3300049570 Unclassified 514
434 Ga0501034_0136659 3300049571 Bacteria 2432
435 Ga0501036_0135072 3300049572 Bacteria 2082
436 Ga0501036_0795247 3300049572 Unclassified 779
437 Ga0501037_0235573 3300049573 Bacteria 1284
438 Ga0501039_0089674 3300049575 Bacteria 2396
439 Ga0501039_0374902 3300049575 Unclassified 1118
440 Ga0501040_0028166 3300049576 Bacteria 3786
441 Ga0501041_0057856 3300049577 Bacteria 2371
442 Ga0501042_0237350 3300049578 Bacteria 1315
443 Ga0501046_1268308 3300049580 Bacteria 504
444 Ga0501048_0079673 3300049582 Bacteria 2311
445 Ga0501048_0421285 3300049582 Bacteria 955
446 Ga0501067_0008625 3300049583 Bacteria 5650
447 Ga0501068_0219068 3300049584 Unclassified 1210
448 Ga0501068_0256383 3300049584 Bacteria 1115
449 Ga0501069_0014518 3300049585 Bacteria 4212
450 Ga0501071_0181164 3300049587 Bacteria 1578
451 Ga0501071_1084040 3300049587 Unclassified 619
452 Ga0501072_0104306 3300049588 Bacteria 2254
453 Ga0501073_0250332 3300049589 Bacteria 1223
454 Ga0501074_0141499 3300049590 Bacteria 1721
455 Ga0501074_1127288 3300049590 Unclassified 551
456 Ga0501075_0183613 3300049591 Bacteria 1596
457 Ga0501075_0605318 3300049591 Unclassified 836
458 Ga0501076_0196378 3300049592 Bacteria 1647
459 Ga0501076_0213491 3300049592 Unclassified 1577
460 Ga0501076_1582460 3300049592 Bacteria 538
461 Ga0501077_0127680 3300049593 Bacteria 1612
462 Ga0501202_096701 3300049652 Unclassified 713
463 Ga0501217_105795 3300049661 Unclassified 804
464 Ga0501250_109022 3300049680 Unclassified 501
465 Ga0501079_0014179 3300049741 Bacteria 6077
466 Ga0501080_0020074 3300049742 Bacteria 6185
467 Ga0501081_0137891 3300049743 Bacteria 1747
468 Ga0501081_1308560 3300049743 Unclassified 550
469 Ga0501283_015198 3300049779 Bacteria 1183
470 Ga0501035_0030346 3300049822 Bacteria 4929
471 Ga0501035_1074265 3300049822 Bacteria 630
472 Ga0501044_0390176 3300049823 Bacteria 1306
473 Ga0501044_0399000 3300049823 Bacteria 1288
474 Ga0501045_0032770 3300049824 Bacteria 3766
475 Ga0501045_0042712 3300049824 Bacteria 3301
476 nmdc:mga03683_9518_c1 3300050489 Bacteria 3460
477 nmdc:mga03n38_225731_c1 3300050490 Bacteria 980
478 nmdc:mga00v17_15325_c1 3300050491 Bacteria 4302
479 nmdc:mga0yw44_383302_c1 3300050492 Bacteria 949
480 nmdc:mga0yw44_592336_c1 3300050492 Bacteria 753
481 nmdc:mga0k408_130378_c1 3300050493 Bacteria 1493
482 nmdc:mga0k408_25759_c1 3300050493 Bacteria 3333
483 nmdc:mga0k408_607750_c1 3300050493 Bacteria 645
484 nmdc:mga06z11_9515_c1 3300050494 Bacteria 4099
485 nmdc:mga07m45_106124_c1 3300050496 Bacteria 1616
486 nmdc:mga07m45_66877_c1 3300050496 Bacteria 2042
487 nmdc:mga05p37_1476654_c1 3300050507 Bacteria 679
488 nmdc:mga05p37_77658_c1 3300050507 Bacteria 1414
489 nmdc:mga06r32_1864395_c1 3300050510 Bacteria 536
490 nmdc:mga08y16_765383_c1 3300050511 Bacteria 961
491 nmdc:mga0a205_133497_c1 3300050515 Bacteria 2383
492 nmdc:mga0sz30_117996_c2 3300050516 Bacteria 565
493 nmdc:mga0sz30_131849_c1 3300050516 Bacteria 1101
494 nmdc:mga0sz30_6208_c1 3300050516 Bacteria 4428
495 Ga0500644_0012095 3300053088 Bacteria 2378
496 Ga0500562_012525 3300053108 Bacteria 2158
497 Ga0500593_001868 3300053117 Bacteria 7576
498 Ga0500658_0061688 3300053134 Bacteria 1560
499 Ga0500587_047608 3300053739 Bacteria 629
500 Ga0501084_0154964 3300054114 Unclassified 1932
501 Ga0501084_0249831 3300054114 Bacteria 1497
502 Ga0501084_0275722 3300054114 Bacteria 1420
503 Ga0501082_0041030 3300060353 Bacteria 3990
504 Ga0466962_0019793 3300061719 Bacteria 3233
505 Ga0466962_0067280 3300061719 Bacteria 1710
506 Ga0466962_0389989 3300061719 Bacteria 696
507 Ga0530510_0059970 3300061734 Bacteria 2753
508 Ga0530510_0146314 3300061734 Bacteria 1743
509 Ga0530510_0174683 3300061734 Bacteria 1592

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0006788 Ga0495581_0006788_6293_6604 83
2 3300048089 Ga0495614_0003981 Ga0495614_0003981_6287_6598 83
3 3300035692 Ga0373935_0600969 Ga0373935_0600969_387_755 102
4 3300037068 Ga0373925_0671147 Ga0373925_0671147_66_434 102
5 3300046454 Ga0495592_0157299 Ga0495592_0157299_896_1264 102
6 3300046459 Ga0495629_0004304 Ga0495629_0004304_1186_1554 102
7 3300046459 Ga0495629_0004365 Ga0495629_0004365_6382_6750 102
8 3300046462 Ga0495651_0010100 Ga0495651_0010100_3714_4082 102
9 3300046463 Ga0495653_0001107 Ga0495653_0001107_15271_15639 102
10 3300046472 Ga0495580_0067930 Ga0495580_0067930_498_866 102
11 3300046473 Ga0495582_0002354 Ga0495582_0002354_9738_10106 102
12 3300046473 Ga0495582_0019705 Ga0495582_0019705_188_556 102
13 3300046475 Ga0495639_0002659 Ga0495639_0002659_6818_7186 102
14 3300046476 Ga0495662_0001100 Ga0495662_0001100_3416_3784 102
15 3300046477 Ga0495664_0007808 Ga0495664_0007808_639_1007 102
16 3300046499 Ga0495594_0000283 Ga0495594_0000283_7981_8349 102
17 3300046499 Ga0495594_0002017 Ga0495594_0002017_5298_5666 102
18 3300046514 Ga0495618_0088116 Ga0495618_0088116_1115_1483 102
19 3300046516 Ga0495628_0032569 Ga0495628_0032569_798_1166 102
20 3300046526 Ga0495666_0000599 Ga0495666_0000599_14456_14824 102
21 3300046529 Ga0495652_0141101 Ga0495652_0141101_202_570 102
22 3300046531 Ga0495665_0004376 Ga0495665_0004376_165_533 102
23 3300046535 Ga0495586_0001932 Ga0495586_0001932_4004_4372 102
24 3300046536 Ga0495587_0102036 Ga0495587_0102036_815_1183 102
25 3300046543 Ga0495645_0009238 Ga0495645_0009238_6507_6875 102
26 3300046557 Ga0495622_0150000 Ga0495622_0150000_185_553 102
27 3300046557 Ga0495622_0215768 Ga0495622_0215768_450_818 102
28 3300046559 Ga0495667_0008812 Ga0495667_0008812_5962_6330 102
29 3300046642 Ga0495634_0000716 Ga0495634_0000716_8055_8423 102
30 3300046663 Ga0495635_0013349 Ga0495635_0013349_5207_5575 102
31 3300046675 Ga0495657_0279991 Ga0495657_0279991_429_797 102
32 3300046678 Ga0495599_0006273 Ga0495599_0006273_6584_6952 102
33 3300046679 Ga0495623_0013841 Ga0495623_0013841_538_906 102
34 3300046680 Ga0495646_0029421 Ga0495646_0029421_1633_2001 102
35 3300046681 Ga0495647_0256865 Ga0495647_0256865_287_655 102
36 3300046689 Ga0495613_0018991 Ga0495613_0018991_16_384 102
37 3300046689 Ga0495613_0069338 Ga0495613_0069338_2188_2556 102
38 3300046690 Ga0495624_0078089 Ga0495624_0078089_1179_1547 102
39 3300046809 Ga0495600_0009995 Ga0495600_0009995_1511_1879 102
40 3300047315 Ga0495581_0021354 Ga0495581_0021354_589_957 102
41 3300047317 Ga0495604_0078251 Ga0495604_0078251_1445_1813 102
42 3300047319 Ga0495674_0092753 Ga0495674_0092753_166_534 102
43 3300047321 Ga0495676_0004731 Ga0495676_0004731_9087_9455 102
44 3300047321 Ga0495676_0727269 Ga0495676_0727269_70_438 102
45 3300047322 Ga0495680_0020406 Ga0495680_0020406_2891_3259 102
46 3300047444 Ga0495675_0003952 Ga0495675_0003952_7933_8301 102
47 3300047471 Ga0495684_0070685 Ga0495684_0070685_2016_2384 102
48 3300047471 Ga0495684_0121129 Ga0495684_0121129_1261_1629 102
49 3300047673 Ga0495593_0105486 Ga0495593_0105486_883_1251 102
50 3300047673 Ga0495593_0147563 Ga0495593_0147563_704_1072 102
51 3300048089 Ga0495614_0139527 Ga0495614_0139527_424_792 102
52 3300044683 Ga0466965_0138422 Ga0466965_0138422_940_1251 103
53 3300046522 Ga0495643_0223466 Ga0495643_0223466_472_846 104
54 3300046542 Ga0495597_0011512 Ga0495597_0011512_2378_2752 104
55 3300047443 Ga0495687_000350 Ga0495687_000350_37084_37458 104
56 3300005337 Ga0070682_101322552 Ga0070682_1013225522 108
57 3300005618 Ga0068864_101435181 Ga0068864_1014351812 108
58 3300005985 Ga0081539_10026515 Ga0081539_100265153 108
59 3300006852 Ga0075433_11058422 Ga0075433_110584222 108
60 3300009147 Ga0114129_10232236 Ga0114129_102322361 108
61 3300009147 Ga0114129_11210195 Ga0114129_112101952 108
62 3300041413 Ga0439465_0144445 Ga0439465_0144445_124_465 108
63 3300050507 nmdc:mga05p37_1476654_c1 nmdc:mga05p37_1476654_c1_160_519 108
64 3300050515 nmdc:mga0a205_133497_c1 nmdc:mga0a205_133497_c1_251_610 108
65 3300005343 Ga0070687_101182895 Ga0070687_1011828951 109
66 3300005440 Ga0070705_100023787 Ga0070705_1000237874 109
67 3300005444 Ga0070694_100541872 Ga0070694_1005418721 109
68 3300005468 Ga0070707_101043591 Ga0070707_1010435911 109
69 3300005471 Ga0070698_100106145 Ga0070698_1001061455 109
70 3300005536 Ga0070697_100662218 Ga0070697_1006622182 109
71 3300005546 Ga0070696_100047743 Ga0070696_1000477433 109
72 3300005549 Ga0070704_100053024 Ga0070704_1000530241 109
73 3300006353 Ga0075370_10051313 Ga0075370_100513132 109
74 3300009098 Ga0105245_10801101 Ga0105245_108011012 109
75 3300009147 Ga0114129_10362183 Ga0114129_103621832 109
76 3300009147 Ga0114129_11497041 Ga0114129_114970411 109
77 3300009148 Ga0105243_10127652 Ga0105243_101276523 109
78 3300009174 Ga0105241_11020082 Ga0105241_110200822 109
79 3300009176 Ga0105242_10270728 Ga0105242_102707281 109
80 3300014968 Ga0157379_11173849 Ga0157379_111738491 109
81 3300025905 Ga0207685_10334240 Ga0207685_103342401 109
82 3300025911 Ga0207654_10360353 Ga0207654_103603531 109
83 3300025922 Ga0207646_11090217 Ga0207646_110902171 109
84 3300025934 Ga0207686_10278505 Ga0207686_102785053 109
85 3300026067 Ga0207678_10558485 Ga0207678_105584852 109
86 3300031911 Ga0307412_11105022 Ga0307412_111050222 109
87 3300032002 Ga0307416_102925912 Ga0307416_1029259121 109
88 3300035692 Ga0373935_0198295 Ga0373935_0198295_131_499 109
89 3300036401 Ga0373937_0149320 Ga0373937_0149320_1654_2022 109
90 3300037853 Ga0436364_0385737 Ga0436364_0385737_85_444 109
91 3300041486 Ga0451807_1343908 Ga0451807_1343908_430_825 109
92 3300041491 Ga0451833_0723785 Ga0451833_0723785_248_619 109
93 3300048906 Ga0496103_0002784 Ga0496103_0002784_703_1089 109
94 3300048909 Ga0496106_0010627 Ga0496106_0010627_569_955 109
95 3300049589 Ga0501073_0250332 Ga0501073_0250332_131_535 109
96 3300050496 nmdc:mga07m45_66877_c1 nmdc:mga07m45_66877_c1_613_972 109
97 3300050507 nmdc:mga05p37_77658_c1 nmdc:mga05p37_77658_c1_952_1311 109
98 3300005617 Ga0068859_100874412 Ga0068859_1008744122 110
99 3300005981 Ga0081538_10017285 Ga0081538_100172854 110
100 3300005981 Ga0081538_10028702 Ga0081538_100287024 110
101 3300006177 Ga0075362_10392720 Ga0075362_103927202 110
102 3300006846 Ga0075430_100065222 Ga0075430_1000652223 110
103 3300006931 Ga0097620_100874380 Ga0097620_1008743802 110
104 3300025928 Ga0207700_10650213 Ga0207700_106502131 110
105 3300028794 Ga0307515_10010929 Ga0307515_100109294 110
106 3300031456 Ga0307513_10009552 Ga0307513_100095529 110
107 3300031456 Ga0307513_10262634 Ga0307513_102626342 110
108 3300031730 Ga0307516_10028507 Ga0307516_100285076 110
109 3300041451 Ga0451791_0730496 Ga0451791_0730496_263_613 110
110 3300041491 Ga0451833_0831283 Ga0451833_0831283_331_681 110
111 3300041492 Ga0451835_0713824 Ga0451835_0713824_13_363 110
112 3300041512 Ga0451853_3356586 Ga0451853_3356586_67_417 110
113 3300046512 Ga0495610_0066437 Ga0495610_0066437_544_894 110
114 3300046519 Ga0495632_0030686 Ga0495632_0030686_502_852 110
115 3300046660 Ga0495625_0001726 Ga0495625_0001726_12835_13185 110
116 3300047472 Ga0495686_0113101 Ga0495686_0113101_664_1014 110
117 3300050493 nmdc:mga0k408_607750_c1 nmdc:mga0k408_607750_c1_215_565 110
118 3300053134 Ga0500658_0061688 Ga0500658_0061688_455_805 110
119 3300053739 Ga0500587_047608 Ga0500587_047608_174_524 110
120 3300003578 Ga0006562J51391_1136862 Ga0006562J51391_11368621 111
121 3300005468 Ga0070707_100089840 Ga0070707_1000898402 111
122 3300005471 Ga0070698_100146996 Ga0070698_1001469963 111
123 3300005518 Ga0070699_100880049 Ga0070699_1008800491 111
124 3300005549 Ga0070704_100544529 Ga0070704_1005445292 111
125 3300005842 Ga0068858_100769663 Ga0068858_1007696632 111
126 3300006038 Ga0075365_10846714 Ga0075365_108467141 111
127 3300009148 Ga0105243_10410618 Ga0105243_104106181 111
128 3300011119 Ga0105246_10763302 Ga0105246_107633022 111
129 3300013250 Ga0171462_1029 Ga0171462_102918 111
130 3300025292 Ga0209676_1038884 Ga0209676_10388842 111
131 3300025910 Ga0207684_11686289 Ga0207684_116862892 111
132 3300025922 Ga0207646_10201130 Ga0207646_102011303 111
133 3300025935 Ga0207709_10577565 Ga0207709_105775651 111
134 3300026095 Ga0207676_10256155 Ga0207676_102561551 111
135 3300028794 Ga0307515_10116703 Ga0307515_101167034 111
136 3300032004 Ga0307414_10215147 Ga0307414_102151472 111
137 3300032004 Ga0307414_10604510 Ga0307414_106045101 111
138 3300039145 Ga0237816_04283 Ga0237816_04283_27_374 111
139 3300045976 Ga0466967_1788938 Ga0466967_1788938_216_551 111
140 3300048925 Ga0496122_0049207 Ga0496122_0049207_1532_1879 111
141 3300048926 Ga0496123_0165268 Ga0496123_0165268_223_570 111
142 3300048929 Ga0496126_0032030 Ga0496126_0032030_1955_2302 111
143 3300049572 Ga0501036_0795247 Ga0501036_0795247_207_584 111
144 3300050492 nmdc:mga0yw44_383302_c1 nmdc:mga0yw44_383302_c1_41_388 111
145 3300050516 nmdc:mga0sz30_117996_c2 nmdc:mga0sz30_117996_c2_182_529 111
146 3300050516 nmdc:mga0sz30_131849_c1 nmdc:mga0sz30_131849_c1_90_437 111
147 3300053088 Ga0500644_0012095 Ga0500644_0012095_1554_1955 111
148 3300053108 Ga0500562_012525 Ga0500562_012525_531_932 111
149 3300003775 Ga0055524_1000251 Ga0055524_100025134 112
150 3300003784 Ga0055534_1048317 Ga0055534_10483171 112
151 3300005331 Ga0070670_101250460 Ga0070670_1012504601 112
152 3300005338 Ga0068868_100338521 Ga0068868_1003385212 112
153 3300005339 Ga0070660_100801231 Ga0070660_1008012312 112
154 3300005345 Ga0070692_10244844 Ga0070692_102448442 112
155 3300005345 Ga0070692_10264340 Ga0070692_102643402 112
156 3300005356 Ga0070674_100543089 Ga0070674_1005430892 112
157 3300005364 Ga0070673_101342522 Ga0070673_1013425221 112
158 3300005365 Ga0070688_100202916 Ga0070688_1002029162 112
159 3300005438 Ga0070701_10023734 Ga0070701_100237342 112
160 3300005440 Ga0070705_100367374 Ga0070705_1003673742 112
161 3300005440 Ga0070705_100460605 Ga0070705_1004606052 112
162 3300005441 Ga0070700_100000003 Ga0070700_10000000316 112
163 3300005444 Ga0070694_100190734 Ga0070694_1001907341 112
164 3300005455 Ga0070663_100571594 Ga0070663_1005715942 112
165 3300005455 Ga0070663_100719201 Ga0070663_1007192012 112
166 3300005456 Ga0070678_100773853 Ga0070678_1007738532 112
167 3300005457 Ga0070662_100113697 Ga0070662_1001136971 112
168 3300005457 Ga0070662_101512147 Ga0070662_1015121471 112
169 3300005459 Ga0068867_100060729 Ga0068867_1000607292 112
170 3300005459 Ga0068867_100951345 Ga0068867_1009513451 112
171 3300005468 Ga0070707_100002617 Ga0070707_10000261715 112
172 3300005468 Ga0070707_100181519 Ga0070707_1001815193 112
173 3300005471 Ga0070698_100698146 Ga0070698_1006981462 112
174 3300005518 Ga0070699_101203285 Ga0070699_1012032852 112
175 3300005536 Ga0070697_100222502 Ga0070697_1002225021 112
176 3300005539 Ga0068853_100814963 Ga0068853_1008149632 112
177 3300005543 Ga0070672_100145565 Ga0070672_1001455652 112
178 3300005543 Ga0070672_100180286 Ga0070672_1001802862 112
179 3300005545 Ga0070695_100412967 Ga0070695_1004129671 112
180 3300005546 Ga0070696_100040043 Ga0070696_1000400432 112
181 3300005548 Ga0070665_101260463 Ga0070665_1012604632 112
182 3300005549 Ga0070704_100191226 Ga0070704_1001912262 112
183 3300005563 Ga0068855_100763609 Ga0068855_1007636092 112
184 3300005577 Ga0068857_100008928 Ga0068857_1000089285 112
185 3300005617 Ga0068859_100212086 Ga0068859_1002120863 112
186 3300005618 Ga0068864_100586313 Ga0068864_1005863132 112
187 3300005719 Ga0068861_100157124 Ga0068861_1001571243 112
188 3300005840 Ga0068870_10009964 Ga0068870_100099643 112
189 3300005841 Ga0068863_100178250 Ga0068863_1001782501 112
190 3300005843 Ga0068860_100537735 Ga0068860_1005377353 112
191 3300005844 Ga0068862_100001624 Ga0068862_1000016248 112
192 3300005844 Ga0068862_100095847 Ga0068862_1000958472 112
193 3300006844 Ga0075428_101145915 Ga0075428_1011459152 112
194 3300006846 Ga0075430_100635849 Ga0075430_1006358492 112
195 3300006880 Ga0075429_100173056 Ga0075429_1001730561 112
196 3300006931 Ga0097620_100212096 Ga0097620_1002120963 112
197 3300009093 Ga0105240_10014731 Ga0105240_100147319 112
198 3300009094 Ga0111539_10621246 Ga0111539_106212462 112
199 3300009098 Ga0105245_10086216 Ga0105245_100862162 112
200 3300009101 Ga0105247_10117647 Ga0105247_101176472 112
201 3300009148 Ga0105243_11264286 Ga0105243_112642862 112
202 3300009176 Ga0105242_12239422 Ga0105242_122394222 112
203 3300009545 Ga0105237_10000523 Ga0105237_1000052322 112
204 3300009551 Ga0105238_10003906 Ga0105238_100039062 112
205 3300009553 Ga0105249_10003530 Ga0105249_100035302 112
206 3300009553 Ga0105249_10312034 Ga0105249_103120342 112
207 3300009553 Ga0105249_10403408 Ga0105249_104034083 112
208 3300010375 Ga0105239_10007336 Ga0105239_100073366 112
209 3300010375 Ga0105239_11391132 Ga0105239_113911321 112
210 3300010375 Ga0105239_11595400 Ga0105239_115954002 112
211 3300013296 Ga0157374_11935603 Ga0157374_119356031 112
212 3300013306 Ga0163162_10835783 Ga0163162_108357832 112
213 3300013308 Ga0157375_10017895 Ga0157375_100178953 112
214 3300014325 Ga0163163_10050812 Ga0163163_100508123 112
215 3300014326 Ga0157380_10348335 Ga0157380_103483352 112
216 3300014968 Ga0157379_10632819 Ga0157379_106328192 112
217 3300014969 Ga0157376_11019441 Ga0157376_110194412 112
218 3300017792 Ga0163161_10267783 Ga0163161_102677832 112
219 3300025273 Ga0209673_1093374 Ga0209673_10933742 112
220 3300025291 Ga0209675_1006177 Ga0209675_10061772 112
221 3300025295 Ga0209564_1000052 Ga0209564_1000052186 112
222 3300025299 Ga0209256_1000099 Ga0209256_100009935 112
223 3300025900 Ga0207710_10265343 Ga0207710_102653432 112
224 3300025907 Ga0207645_10256247 Ga0207645_102562471 112
225 3300025908 Ga0207643_10049633 Ga0207643_100496331 112
226 3300025910 Ga0207684_10002304 Ga0207684_100023044 112
227 3300025913 Ga0207695_10046160 Ga0207695_100461604 112
228 3300025914 Ga0207671_10004041 Ga0207671_100040417 112
229 3300025917 Ga0207660_10541251 Ga0207660_105412511 112
230 3300025918 Ga0207662_10967020 Ga0207662_109670201 112
231 3300025922 Ga0207646_10011244 Ga0207646_1001124410 112
232 3300025922 Ga0207646_10185546 Ga0207646_101855462 112
233 3300025923 Ga0207681_10001082 Ga0207681_100010829 112
234 3300025923 Ga0207681_11829566 Ga0207681_118295662 112
235 3300025924 Ga0207694_10377895 Ga0207694_103778952 112
236 3300025927 Ga0207687_10157574 Ga0207687_101575742 112
237 3300025932 Ga0207690_10692912 Ga0207690_106929122 112
238 3300025933 Ga0207706_10027919 Ga0207706_100279193 112
239 3300025937 Ga0207669_10734620 Ga0207669_107346201 112
240 3300025940 Ga0207691_10172309 Ga0207691_101723091 112
241 3300025949 Ga0207667_10085907 Ga0207667_100859072 112
242 3300025960 Ga0207651_11484942 Ga0207651_114849421 112
243 3300025961 Ga0207712_10002684 Ga0207712_100026846 112
244 3300025961 Ga0207712_10134892 Ga0207712_101348924 112
245 3300025961 Ga0207712_10226906 Ga0207712_102269063 112
246 3300025972 Ga0207668_10011208 Ga0207668_100112083 112
247 3300026023 Ga0207677_10336714 Ga0207677_103367143 112
248 3300026041 Ga0207639_11391690 Ga0207639_113916902 112
249 3300026067 Ga0207678_10460865 Ga0207678_104608652 112
250 3300026075 Ga0207708_10000002 Ga0207708_10000002156 112
251 3300026075 Ga0207708_10526320 Ga0207708_105263202 112
252 3300026088 Ga0207641_10340728 Ga0207641_103407281 112
253 3300026089 Ga0207648_10097107 Ga0207648_100971072 112
254 3300026089 Ga0207648_10788173 Ga0207648_107881732 112
255 3300026095 Ga0207676_10507478 Ga0207676_105074781 112
256 3300026116 Ga0207674_10016870 Ga0207674_100168703 112
257 3300026118 Ga0207675_100137015 Ga0207675_1001370152 112
258 3300026121 Ga0207683_10068153 Ga0207683_100681533 112
259 3300026121 Ga0207683_10505902 Ga0207683_105059021 112
260 3300026142 Ga0207698_10771154 Ga0207698_107711541 112
261 3300026142 Ga0207698_11395110 Ga0207698_113951102 112
262 3300027876 Ga0209974_10025424 Ga0209974_100254242 112
263 3300027876 Ga0209974_10095785 Ga0209974_100957852 112
264 3300027876 Ga0209974_10272912 Ga0209974_102729122 112
265 3300027907 Ga0207428_10431291 Ga0207428_104312912 112
266 3300028380 Ga0268265_10015988 Ga0268265_100159883 112
267 3300028380 Ga0268265_10108314 Ga0268265_101083144 112
268 3300028381 Ga0268264_10353647 Ga0268264_103536473 112
269 3300031250 Ga0265331_10573949 Ga0265331_105739492 112
270 3300031548 Ga0307408_100957549 Ga0307408_1009575491 112
271 3300031731 Ga0307405_11855033 Ga0307405_118550332 112
272 3300032005 Ga0307411_12210205 Ga0307411_122102051 112
273 3300032126 Ga0307415_101270190 Ga0307415_1012701901 112
274 3300032126 Ga0307415_102004711 Ga0307415_1020047111 112
275 3300041411 Ga0439466_0112035 Ga0439466_0112035_339_716 112
276 3300041413 Ga0439465_0285535 Ga0439465_0285535_209_586 112
277 3300041452 Ga0451793_0055040 Ga0451793_0055040_143_529 112
278 3300041460 Ga0451802_1961840 Ga0451802_1961840_303_689 112
279 3300041512 Ga0451853_0708726 Ga0451853_0708726_306_692 112
280 3300041997 Ga0439431_0153847 Ga0439431_0153847_85_462 112
281 3300042125 Ga0450923_126994 Ga0450923_126994_74_451 112
282 3300046473 Ga0495582_0817212 Ga0495582_0817212_37_387 112
283 3300046615 Ga0495656_0784222 Ga0495656_0784222_47_433 112
284 3300048904 Ga0496101_1408177 Ga0496101_1408177_133_519 112
285 3300048911 Ga0496108_0148804 Ga0496108_0148804_1593_1979 112
286 3300048912 Ga0496109_1951428 Ga0496109_1951428_17_403 112
287 3300048915 Ga0496112_0712550 Ga0496112_0712550_213_599 112
288 3300048917 Ga0496114_0146134 Ga0496114_0146134_1149_1535 112
289 3300049522 Ga0501299_102000 Ga0501299_102000_33_386 112
290 3300049570 Ga0501033_1155912 Ga0501033_1155912_108_488 112
291 3300049571 Ga0501034_0136659 Ga0501034_0136659_706_1059 112
292 3300049591 Ga0501075_0183613 Ga0501075_0183613_38_424 112
293 3300049592 Ga0501076_1582460 Ga0501076_1582460_35_421 112
294 3300049652 Ga0501202_096701 Ga0501202_096701_321_671 112
295 3300049661 Ga0501217_105795 Ga0501217_105795_48_398 112
296 3300049680 Ga0501250_109022 Ga0501250_109022_116_466 112
297 3300049779 Ga0501283_015198 Ga0501283_015198_792_1142 112
298 3300050492 nmdc:mga0yw44_592336_c1 nmdc:mga0yw44_592336_c1_184_534 112
299 3300050510 nmdc:mga06r32_1864395_c1 nmdc:mga06r32_1864395_c1_166_516 112
300 3300050511 nmdc:mga08y16_765383_c1 nmdc:mga08y16_765383_c1_128_478 112
301 3300054114 Ga0501084_0275722 Ga0501084_0275722_21_392 112
302 3300006048 Ga0075363_100078432 Ga0075363_1000784322 113
303 3300006051 Ga0075364_10039235 Ga0075364_100392352 113
304 3300006177 Ga0075362_10002166 Ga0075362_100021669 113
305 3300006178 Ga0075367_10001770 Ga0075367_100017709 113
306 3300006186 Ga0075369_10045986 Ga0075369_100459862 113
307 3300006195 Ga0075366_10030141 Ga0075366_100301416 113
308 3300006195 Ga0075366_10384340 Ga0075366_103843402 113
309 3300006353 Ga0075370_10001219 Ga0075370_1000121914 113
310 3300006931 Ga0097620_101317300 Ga0097620_1013173002 113
311 3300028381 Ga0268264_10140319 Ga0268264_101403192 113
312 3300031730 Ga0307516_10021238 Ga0307516_100212389 113
313 3300031730 Ga0307516_10571681 Ga0307516_105716812 113
314 3300045976 Ga0466967_2046776 Ga0466967_2046776_20_361 113
315 3300049575 Ga0501039_0374902 Ga0501039_0374902_326_709 113
316 3300049582 Ga0501048_0421285 Ga0501048_0421285_66_449 113
317 3300049584 Ga0501068_0219068 Ga0501068_0219068_12_395 113
318 3300049587 Ga0501071_1084040 Ga0501071_1084040_127_510 113
319 3300049590 Ga0501074_1127288 Ga0501074_1127288_67_450 113
320 3300049591 Ga0501075_0605318 Ga0501075_0605318_371_754 113
321 3300049592 Ga0501076_0213491 Ga0501076_0213491_220_603 113
322 3300049743 Ga0501081_1308560 Ga0501081_1308560_107_487 113
323 3300049824 Ga0501045_0032770 Ga0501045_0032770_1350_1733 113
324 3300050489 nmdc:mga03683_9518_c1 nmdc:mga03683_9518_c1_1761_2129 113
325 3300050490 nmdc:mga03n38_225731_c1 nmdc:mga03n38_225731_c1_442_810 113
326 3300050491 nmdc:mga00v17_15325_c1 nmdc:mga00v17_15325_c1_171_539 113
327 3300050493 nmdc:mga0k408_130378_c1 nmdc:mga0k408_130378_c1_856_1221 113
328 3300050493 nmdc:mga0k408_25759_c1 nmdc:mga0k408_25759_c1_1205_1573 113
329 3300050494 nmdc:mga06z11_9515_c1 nmdc:mga06z11_9515_c1_171_539 113
330 3300050496 nmdc:mga07m45_106124_c1 nmdc:mga07m45_106124_c1_1205_1573 113
331 3300050516 nmdc:mga0sz30_6208_c1 nmdc:mga0sz30_6208_c1_2559_2927 113
332 3300053117 Ga0500593_001868 Ga0500593_001868_6098_6487 113
333 3300054114 Ga0501084_0154964 Ga0501084_0154964_1230_1613 113
334 3300005434 Ga0070709_10141216 Ga0070709_101412162 114
335 3300005435 Ga0070714_100009814 Ga0070714_1000098144 114
336 3300005436 Ga0070713_100769209 Ga0070713_1007692092 114
337 3300005437 Ga0070710_10010663 Ga0070710_100106634 114
338 3300005439 Ga0070711_100126338 Ga0070711_1001263383 114
339 3300006028 Ga0070717_10161546 Ga0070717_101615461 114
340 3300006175 Ga0070712_100189071 Ga0070712_1001890713 114
341 3300006880 Ga0075429_100470611 Ga0075429_1004706112 114
342 3300014969 Ga0157376_11470076 Ga0157376_114700762 114
343 3300025898 Ga0207692_10204305 Ga0207692_102043051 114
344 3300025906 Ga0207699_10131581 Ga0207699_101315813 114
345 3300025915 Ga0207693_10149512 Ga0207693_101495123 114
346 3300025916 Ga0207663_10065192 Ga0207663_100651924 114
347 3300025928 Ga0207700_10619927 Ga0207700_106199271 114
348 3300025929 Ga0207664_10107446 Ga0207664_101074464 114
349 3300028573 Ga0265334_10023452 Ga0265334_100234521 114
350 3300044656 Ga0466969_0112142 Ga0466969_0112142_165_530 114
351 3300044683 Ga0466965_0039416 Ga0466965_0039416_86_451 114
352 3300044684 Ga0466966_0008856 Ga0466966_0008856_1801_2166 114
353 3300044684 Ga0466966_0226949 Ga0466966_0226949_555_899 114
354 3300044693 Ga0466961_0033686 Ga0466961_0033686_567_932 114
355 3300044706 Ga0466964_0583870 Ga0466964_0583870_44_388 114
356 3300044765 Ga0466970_0011348 Ga0466970_0011348_2809_3174 114
357 3300044765 Ga0466970_0037211 Ga0466970_0037211_476_820 114
358 3300044842 Ga0466957_0077177 Ga0466957_0077177_333_698 114
359 3300044901 Ga0466960_0115408 Ga0466960_0115408_816_1160 114
360 3300044901 Ga0466960_0138226 Ga0466960_0138226_399_743 114
361 3300045836 Ga0466958_0417123 Ga0466958_0417123_285_650 114
362 3300045976 Ga0466967_0308261 Ga0466967_0308261_1058_1423 114
363 3300045976 Ga0466967_0650535 Ga0466967_0650535_51_419 114
364 3300045976 Ga0466967_1010354 Ga0466967_1010354_415_765 114
365 3300049568 Ga0501031_0176337 Ga0501031_0176337_165_509 114
366 3300049569 Ga0501032_0232780 Ga0501032_0232780_91_435 114
367 3300049572 Ga0501036_0135072 Ga0501036_0135072_1527_1871 114
368 3300049573 Ga0501037_0235573 Ga0501037_0235573_96_440 114
369 3300049575 Ga0501039_0089674 Ga0501039_0089674_154_498 114
370 3300049576 Ga0501040_0028166 Ga0501040_0028166_3019_3363 114
371 3300049577 Ga0501041_0057856 Ga0501041_0057856_1089_1433 114
372 3300049578 Ga0501042_0237350 Ga0501042_0237350_901_1245 114
373 3300049580 Ga0501046_1268308 Ga0501046_1268308_84_428 114
374 3300049582 Ga0501048_0079673 Ga0501048_0079673_1907_2251 114
375 3300049584 Ga0501068_0256383 Ga0501068_0256383_564_908 114
376 3300049587 Ga0501071_0181164 Ga0501071_0181164_164_508 114
377 3300049588 Ga0501072_0104306 Ga0501072_0104306_57_401 114
378 3300049590 Ga0501074_0141499 Ga0501074_0141499_34_378 114
379 3300049592 Ga0501076_0196378 Ga0501076_0196378_1121_1465 114
380 3300049593 Ga0501077_0127680 Ga0501077_0127680_1251_1595 114
381 3300049741 Ga0501079_0014179 Ga0501079_0014179_5524_5868 114
382 3300049742 Ga0501080_0020074 Ga0501080_0020074_3994_4338 114
383 3300049743 Ga0501081_0137891 Ga0501081_0137891_751_1095 114
384 3300049822 Ga0501035_1074265 Ga0501035_1074265_244_588 114
385 3300049823 Ga0501044_0399000 Ga0501044_0399000_70_414 114
386 3300049824 Ga0501045_0042712 Ga0501045_0042712_1698_2042 114
387 3300054114 Ga0501084_0249831 Ga0501084_0249831_141_485 114
388 3300060353 Ga0501082_0041030 Ga0501082_0041030_2663_3007 114
389 3300061719 Ga0466962_0019793 Ga0466962_0019793_164_529 114
390 3300061734 Ga0530510_0146314 Ga0530510_0146314_1269_1613 114
391 3300003320 rootH2_10020274 rootH2_100202746 115
392 3300003320 rootH2_10087120 rootH2_100871203 115
393 3300005337 Ga0070682_101267448 Ga0070682_1012674481 115
394 3300005337 Ga0070682_101594457 Ga0070682_1015944572 115
395 3300005338 Ga0068868_102084602 Ga0068868_1020846021 115
396 3300005339 Ga0070660_100727153 Ga0070660_1007271532 115
397 3300005347 Ga0070668_101950299 Ga0070668_1019502991 115
398 3300005434 Ga0070709_10867400 Ga0070709_108674002 115
399 3300005435 Ga0070714_100650491 Ga0070714_1006504911 115
400 3300005438 Ga0070701_11156279 Ga0070701_111562791 115
401 3300005530 Ga0070679_100022892 Ga0070679_1000228927 115
402 3300005547 Ga0070693_100762685 Ga0070693_1007626852 115
403 3300005614 Ga0068856_100085538 Ga0068856_1000855384 115
404 3300005616 Ga0068852_102373049 Ga0068852_1023730491 115
405 3300005718 Ga0068866_10378436 Ga0068866_103784362 115
406 3300009098 Ga0105245_11023893 Ga0105245_110238931 115
407 3300009148 Ga0105243_10910174 Ga0105243_109101741 115
408 3300009174 Ga0105241_10783968 Ga0105241_107839682 115
409 3300009177 Ga0105248_12760778 Ga0105248_127607782 115
410 3300009551 Ga0105238_11441909 Ga0105238_114419092 115
411 3300013105 Ga0157369_10030265 Ga0157369_100302658 115
412 3300013105 Ga0157369_10230226 Ga0157369_102302262 115
413 3300013105 Ga0157369_12081416 Ga0157369_120814161 115
414 3300013307 Ga0157372_10049615 Ga0157372_100496151 115
415 3300014326 Ga0157380_11519837 Ga0157380_115198371 115
416 3300020069 Ga0197907_10991673 Ga0197907_109916732 115
417 3300020070 Ga0206356_11870219 Ga0206356_118702192 115
418 3300020081 Ga0206354_10011937 Ga0206354_100119372 115
419 3300020082 Ga0206353_11278172 Ga0206353_112781724 115
420 3300025906 Ga0207699_10671945 Ga0207699_106719452 115
421 3300025921 Ga0207652_10157931 Ga0207652_101579313 115
422 3300025929 Ga0207664_10386012 Ga0207664_103860122 115
423 3300025944 Ga0207661_10161549 Ga0207661_101615492 115
424 3300025961 Ga0207712_11203576 Ga0207712_112035761 115
425 3300026078 Ga0207702_10186879 Ga0207702_101868791 115
426 3300031344 Ga0265316_10957208 Ga0265316_109572082 115
427 3300031731 Ga0307405_10166588 Ga0307405_101665882 115
428 3300031824 Ga0307413_11160670 Ga0307413_111606701 115
429 3300031852 Ga0307410_10422311 Ga0307410_104223112 115
430 3300031852 Ga0307410_11555962 Ga0307410_115559622 115
431 3300031889 Ga0326468_10057957 Ga0326468_100579571 115
432 3300031901 Ga0307406_11084595 Ga0307406_110845952 115
433 3300031903 Ga0307407_11007017 Ga0307407_110070172 115
434 3300031911 Ga0307412_10809714 Ga0307412_108097142 115
435 3300031995 Ga0307409_100172794 Ga0307409_1001727941 115
436 3300031995 Ga0307409_100365739 Ga0307409_1003657393 115
437 3300031995 Ga0307409_101616491 Ga0307409_1016164912 115
438 3300031995 Ga0307409_102436463 Ga0307409_1024364631 115
439 3300032002 Ga0307416_103182637 Ga0307416_1031826371 115
440 3300032004 Ga0307414_11248052 Ga0307414_112480522 115
441 3300032005 Ga0307411_10786304 Ga0307411_107863042 115
442 3300032005 Ga0307411_11677736 Ga0307411_116777362 115
443 3300032126 Ga0307415_100086024 Ga0307415_1000860242 115
444 3300032126 Ga0307415_100731166 Ga0307415_1007311662 115
445 3300032126 Ga0307415_101249187 Ga0307415_1012491872 115
446 3300037418 Ga0395900_0135473 Ga0395900_0135473_2003_2365 115
447 3300037418 Ga0395900_0162434 Ga0395900_0162434_1786_2133 115
448 3300037418 Ga0395900_0577204 Ga0395900_0577204_348_707 115
449 3300037466 Ga0395898_0133625 Ga0395898_0133625_1107_1454 115
450 3300037466 Ga0395898_1266628 Ga0395898_1266628_140_502 115
451 3300038443 Ga0395901_0114429 Ga0395901_0114429_1411_1758 115
452 3300044656 Ga0466969_0391306 Ga0466969_0391306_42_389 115
453 3300044683 Ga0466965_0218974 Ga0466965_0218974_122_469 115
454 3300044683 Ga0466965_0305182 Ga0466965_0305182_364_711 115
455 3300044683 Ga0466965_0764441 Ga0466965_0764441_33_392 115
456 3300044683 Ga0466965_0926587 Ga0466965_0926587_25_372 115
457 3300044684 Ga0466966_0109186 Ga0466966_0109186_637_984 115
458 3300044684 Ga0466966_0110494 Ga0466966_0110494_983_1330 115
459 3300044684 Ga0466966_0196254 Ga0466966_0196254_660_1007 115
460 3300044693 Ga0466961_0092211 Ga0466961_0092211_1323_1670 115
461 3300044693 Ga0466961_0332836 Ga0466961_0332836_257_604 115
462 3300044693 Ga0466961_0603622 Ga0466961_0603622_170_541 115
463 3300044693 Ga0466961_0709409 Ga0466961_0709409_49_396 115
464 3300044694 Ga0466963_0027914 Ga0466963_0027914_2847_3194 115
465 3300044694 Ga0466963_0250685 Ga0466963_0250685_157_516 115
466 3300044694 Ga0466963_0630538 Ga0466963_0630538_185_532 115
467 3300044706 Ga0466964_0142124 Ga0466964_0142124_36_383 115
468 3300044719 Ga0466971_0027718 Ga0466971_0027718_663_1010 115
469 3300044719 Ga0466971_0284492 Ga0466971_0284492_296_655 115
470 3300044765 Ga0466970_0319872 Ga0466970_0319872_199_567 115
471 3300044765 Ga0466970_0326319 Ga0466970_0326319_312_659 115
472 3300044765 Ga0466970_0415708 Ga0466970_0415708_168_515 115
473 3300044765 Ga0466970_0653177 Ga0466970_0653177_35_382 115
474 3300044842 Ga0466957_0018000 Ga0466957_0018000_1020_1367 115
475 3300044842 Ga0466957_0037376 Ga0466957_0037376_1239_1586 115
476 3300044842 Ga0466957_0123081 Ga0466957_0123081_275_622 115
477 3300044842 Ga0466957_0132231 Ga0466957_0132231_613_972 115
478 3300044842 Ga0466957_0521076 Ga0466957_0521076_162_539 115
479 3300044842 Ga0466957_1019471 Ga0466957_1019471_125_472 115
480 3300044901 Ga0466960_0005472 Ga0466960_0005472_3875_4234 115
481 3300044901 Ga0466960_0121662 Ga0466960_0121662_844_1191 115
482 3300044901 Ga0466960_0187298 Ga0466960_0187298_94_441 115
483 3300044901 Ga0466960_0230829 Ga0466960_0230829_290_643 115
484 3300044901 Ga0466960_0414553 Ga0466960_0414553_282_629 115
485 3300044901 Ga0466960_0562311 Ga0466960_0562311_206_553 115
486 3300044901 Ga0466960_0720069 Ga0466960_0720069_56_415 115
487 3300045049 Ga0466959_0020677 Ga0466959_0020677_4133_4480 115
488 3300045049 Ga0466959_0096572 Ga0466959_0096572_582_941 115
489 3300045049 Ga0466959_1051948 Ga0466959_1051948_43_390 115
490 3300045836 Ga0466958_0087038 Ga0466958_0087038_1540_1899 115
491 3300045836 Ga0466958_0908241 Ga0466958_0908241_102_449 115
492 3300045976 Ga0466967_0002638 Ga0466967_0002638_4598_4945 115
493 3300045976 Ga0466967_0096782 Ga0466967_0096782_1465_1812 115
494 3300045976 Ga0466967_0113994 Ga0466967_0113994_1174_1533 115
495 3300045976 Ga0466967_0747803 Ga0466967_0747803_441_788 115
496 3300045976 Ga0466967_1850291 Ga0466967_1850291_20_367 115
497 3300048905 Ga0496102_1728901 Ga0496102_1728901_75_422 115
498 3300048910 Ga0496107_0586943 Ga0496107_0586943_354_701 115
499 3300048911 Ga0496108_0552250 Ga0496108_0552250_272_649 115
500 3300048913 Ga0496110_1576685 Ga0496110_1576685_171_518 115
501 3300048914 Ga0496111_0942886 Ga0496111_0942886_88_441 115
502 3300049583 Ga0501067_0008625 Ga0501067_0008625_1544_1891 115
503 3300049585 Ga0501069_0014518 Ga0501069_0014518_449_796 115
504 3300049822 Ga0501035_0030346 Ga0501035_0030346_2843_3208 115
505 3300049823 Ga0501044_0390176 Ga0501044_0390176_525_890 115
506 3300061719 Ga0466962_0067280 Ga0466962_0067280_719_1066 115
507 3300061719 Ga0466962_0389989 Ga0466962_0389989_336_683 115
508 3300061734 Ga0530510_0059970 Ga0530510_0059970_2275_2622 115
509 3300061734 Ga0530510_0174683 Ga0530510_0174683_1226_1573 115

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

29

75

0.97

PF12840

HTH_20

Helix-turn-helix domain

27

75

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9375 8 90
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9303 20 77
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9238 8 91
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9228 9 96
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9215 7 91
ID Description Score Start End Superfamily
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9566 19 64 1.10.10.10
af_P0ACL0_1_57_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9523 20 66 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9515 21 77 1.10.10.10
af_P15082_1_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9476 20 76 1.10.10.10
af_K7LWV0_206_275_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9327 35 64 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5A9ZWG5-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9783 10 88 GO:0003700
AF-D3R293-F1-model_v4 Transcriptional regulator, ArsR family 0.9765 3 90 GO:0003700
AF-A0A7C6VFE1-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9757 9 93 GO:0003700
AF-H1S4V4-F1-model_v4 ArsR family transcriptional regulator 0.9749 9 88 GO:0003700
AF-A0A7U5A5Q2-F1-model_v4 deleted 0.9743 2 89

Feature Viewer

pLDDT pTM Quality
91.35 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map