F456985
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 509 | 317 | 509 | 119 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_11519837|Ga0157380_115198371 |
| Length | 125 |
| Sequence | LIKHLLEYRTVTTTMDDERLDAMFAALADRTRRDIVARLSEGEATVKELAAPYGMTMQAVSQHIGVLERCGLISRGRHRQTRPCRLEPQALEEAVSWIEHSRRVWAERMDRLEAHLDRLQEDQQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 3 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 162 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 179 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 180 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 181 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 186 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 187 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 188 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 189 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 190 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 197 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 198 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 199 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 262 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 263 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 264 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 265 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 288 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 289 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 290 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 294 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 298 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 299 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 302 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 309 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 311 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 312 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 313 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.02 |
| Metatranscriptomes | 0.98 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.27 |
| Nodule | 0 |
| Rhizoplane | 3.14 |
| Rhizosphere | 85.66 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10020274 | 3300003320 | Bacteria | 4190 |
| 2 | rootH2_10087120 | 3300003320 | Bacteria | 1616 |
| 3 | Ga0006562J51391_1136862 | 3300003578 | Bacteria | 1060 |
| 4 | Ga0055524_1000251 | 3300003775 | Bacteria | 55840 |
| 5 | Ga0055534_1048317 | 3300003784 | Bacteria | 610 |
| 6 | Ga0070670_101250460 | 3300005331 | Bacteria | 679 |
| 7 | Ga0070682_101267448 | 3300005337 | Unclassified | 625 |
| 8 | Ga0070682_101322552 | 3300005337 | Bacteria | 613 |
| 9 | Ga0070682_101594457 | 3300005337 | Bacteria | 564 |
| 10 | Ga0068868_100338521 | 3300005338 | Bacteria | 1286 |
| 11 | Ga0068868_102084602 | 3300005338 | Bacteria | 539 |
| 12 | Ga0070660_100727153 | 3300005339 | Bacteria | 833 |
| 13 | Ga0070660_100801231 | 3300005339 | Bacteria | 792 |
| 14 | Ga0070687_101182895 | 3300005343 | Bacteria | 563 |
| 15 | Ga0070692_10244844 | 3300005345 | Bacteria | 1070 |
| 16 | Ga0070692_10264340 | 3300005345 | Bacteria | 1036 |
| 17 | Ga0070668_101950299 | 3300005347 | Bacteria | 541 |
| 18 | Ga0070674_100543089 | 3300005356 | Bacteria | 974 |
| 19 | Ga0070673_101342522 | 3300005364 | Bacteria | 672 |
| 20 | Ga0070688_100202916 | 3300005365 | Bacteria | 1388 |
| 21 | Ga0070709_10141216 | 3300005434 | Bacteria | 1655 |
| 22 | Ga0070709_10867400 | 3300005434 | Bacteria | 712 |
| 23 | Ga0070714_100009814 | 3300005435 | Bacteria | 7546 |
| 24 | Ga0070714_100650491 | 3300005435 | Bacteria | 1015 |
| 25 | Ga0070713_100769209 | 3300005436 | Bacteria | 922 |
| 26 | Ga0070710_10010663 | 3300005437 | Bacteria | 4519 |
| 27 | Ga0070701_10023734 | 3300005438 | Bacteria | 2958 |
| 28 | Ga0070701_11156279 | 3300005438 | Unclassified | 547 |
| 29 | Ga0070711_100126338 | 3300005439 | Bacteria | 1899 |
| 30 | Ga0070705_100023787 | 3300005440 | Bacteria | 3296 |
| 31 | Ga0070705_100367374 | 3300005440 | Bacteria | 1055 |
| 32 | Ga0070705_100460605 | 3300005440 | Bacteria | 956 |
| 33 | Ga0070700_100000003 | 3300005441 | Bacteria | 261247 |
| 34 | Ga0070694_100190734 | 3300005444 | Bacteria | 1522 |
| 35 | Ga0070694_100541872 | 3300005444 | Bacteria | 931 |
| 36 | Ga0070663_100571594 | 3300005455 | Bacteria | 947 |
| 37 | Ga0070663_100719201 | 3300005455 | Bacteria | 850 |
| 38 | Ga0070678_100773853 | 3300005456 | Bacteria | 870 |
| 39 | Ga0070662_100113697 | 3300005457 | Bacteria | 2066 |
| 40 | Ga0070662_101512147 | 3300005457 | Bacteria | 579 |
| 41 | Ga0068867_100060729 | 3300005459 | Bacteria | 2805 |
| 42 | Ga0068867_100951345 | 3300005459 | Bacteria | 776 |
| 43 | Ga0070707_100002617 | 3300005468 | Bacteria | 17105 |
| 44 | Ga0070707_100089840 | 3300005468 | Bacteria | 2973 |
| 45 | Ga0070707_100181519 | 3300005468 | Bacteria | 2052 |
| 46 | Ga0070707_101043591 | 3300005468 | Bacteria | 783 |
| 47 | Ga0070698_100106145 | 3300005471 | Bacteria | 2778 |
| 48 | Ga0070698_100146996 | 3300005471 | Bacteria | 2306 |
| 49 | Ga0070698_100698146 | 3300005471 | Bacteria | 957 |
| 50 | Ga0070699_100880049 | 3300005518 | Bacteria | 820 |
| 51 | Ga0070699_101203285 | 3300005518 | Bacteria | 695 |
| 52 | Ga0070679_100022892 | 3300005530 | Bacteria | 6111 |
| 53 | Ga0070697_100222502 | 3300005536 | Bacteria | 1609 |
| 54 | Ga0070697_100662218 | 3300005536 | Bacteria | 920 |
| 55 | Ga0068853_100814963 | 3300005539 | Bacteria | 894 |
| 56 | Ga0070672_100145565 | 3300005543 | Bacteria | 1958 |
| 57 | Ga0070672_100180286 | 3300005543 | Bacteria | 1760 |
| 58 | Ga0070695_100412967 | 3300005545 | Bacteria | 1026 |
| 59 | Ga0070696_100040043 | 3300005546 | Bacteria | 3235 |
| 60 | Ga0070696_100047743 | 3300005546 | Bacteria | 2971 |
| 61 | Ga0070693_100762685 | 3300005547 | Bacteria | 714 |
| 62 | Ga0070665_101260463 | 3300005548 | Bacteria | 749 |
| 63 | Ga0070704_100053024 | 3300005549 | Bacteria | 2865 |
| 64 | Ga0070704_100191226 | 3300005549 | Bacteria | 1645 |
| 65 | Ga0070704_100544529 | 3300005549 | Bacteria | 1013 |
| 66 | Ga0068855_100763609 | 3300005563 | Bacteria | 1030 |
| 67 | Ga0068857_100008928 | 3300005577 | Bacteria | 8684 |
| 68 | Ga0068856_100085538 | 3300005614 | Bacteria | 3132 |
| 69 | Ga0068852_102373049 | 3300005616 | Bacteria | 551 |
| 70 | Ga0068859_100212086 | 3300005617 | Bacteria | 2023 |
| 71 | Ga0068859_100874412 | 3300005617 | Bacteria | 984 |
| 72 | Ga0068864_100586313 | 3300005618 | Bacteria | 1081 |
| 73 | Ga0068864_101435181 | 3300005618 | Bacteria | 692 |
| 74 | Ga0068866_10378436 | 3300005718 | Bacteria | 907 |
| 75 | Ga0068861_100157124 | 3300005719 | Bacteria | 1872 |
| 76 | Ga0068870_10009964 | 3300005840 | Bacteria | 4344 |
| 77 | Ga0068863_100178250 | 3300005841 | Bacteria | 2040 |
| 78 | Ga0068858_100769663 | 3300005842 | Bacteria | 938 |
| 79 | Ga0068860_100537735 | 3300005843 | Bacteria | 1170 |
| 80 | Ga0068862_100001624 | 3300005844 | Bacteria | 20473 |
| 81 | Ga0068862_100095847 | 3300005844 | Bacteria | 2589 |
| 82 | Ga0081538_10017285 | 3300005981 | Bacteria | 5482 |
| 83 | Ga0081538_10028702 | 3300005981 | Bacteria | 3819 |
| 84 | Ga0081539_10026515 | 3300005985 | Bacteria | 3696 |
| 85 | Ga0070717_10161546 | 3300006028 | Bacteria | 1944 |
| 86 | Ga0075365_10846714 | 3300006038 | Bacteria | 645 |
| 87 | Ga0075363_100078432 | 3300006048 | Bacteria | 1803 |
| 88 | Ga0075364_10039235 | 3300006051 | Bacteria | 3069 |
| 89 | Ga0070712_100189071 | 3300006175 | Bacteria | 1610 |
| 90 | Ga0075362_10002166 | 3300006177 | Bacteria | 6502 |
| 91 | Ga0075362_10392720 | 3300006177 | Bacteria | 699 |
| 92 | Ga0075367_10001770 | 3300006178 | Bacteria | 9489 |
| 93 | Ga0075369_10045986 | 3300006186 | Bacteria | 1878 |
| 94 | Ga0075366_10030141 | 3300006195 | Bacteria | 3188 |
| 95 | Ga0075366_10384340 | 3300006195 | Bacteria | 863 |
| 96 | Ga0075370_10001219 | 3300006353 | Bacteria | 10879 |
| 97 | Ga0075370_10051313 | 3300006353 | Bacteria | 2340 |
| 98 | Ga0075428_101145915 | 3300006844 | Bacteria | 821 |
| 99 | Ga0075430_100065222 | 3300006846 | Bacteria | 3059 |
| 100 | Ga0075430_100635849 | 3300006846 | Bacteria | 880 |
| 101 | Ga0075433_11058422 | 3300006852 | Bacteria | 706 |
| 102 | Ga0075429_100173056 | 3300006880 | Bacteria | 1891 |
| 103 | Ga0075429_100470611 | 3300006880 | Bacteria | 1101 |
| 104 | Ga0097620_100212096 | 3300006931 | Bacteria | 2023 |
| 105 | Ga0097620_100874380 | 3300006931 | Bacteria | 984 |
| 106 | Ga0097620_101317300 | 3300006931 | Bacteria | 796 |
| 107 | Ga0105240_10014731 | 3300009093 | Bacteria | 10667 |
| 108 | Ga0111539_10621246 | 3300009094 | Bacteria | 1258 |
| 109 | Ga0105245_10086216 | 3300009098 | Bacteria | 2880 |
| 110 | Ga0105245_10801101 | 3300009098 | Bacteria | 980 |
| 111 | Ga0105245_11023893 | 3300009098 | Unclassified | 871 |
| 112 | Ga0105247_10117647 | 3300009101 | Bacteria | 1718 |
| 113 | Ga0114129_10232236 | 3300009147 | Bacteria | 2484 |
| 114 | Ga0114129_10362183 | 3300009147 | Bacteria | 1918 |
| 115 | Ga0114129_11210195 | 3300009147 | Bacteria | 940 |
| 116 | Ga0114129_11497041 | 3300009147 | Bacteria | 829 |
| 117 | Ga0105243_10127652 | 3300009148 | Bacteria | 2154 |
| 118 | Ga0105243_10410618 | 3300009148 | Bacteria | 1260 |
| 119 | Ga0105243_10910174 | 3300009148 | Bacteria | 876 |
| 120 | Ga0105243_11264286 | 3300009148 | Bacteria | 754 |
| 121 | Ga0105241_10783968 | 3300009174 | Bacteria | 877 |
| 122 | Ga0105241_11020082 | 3300009174 | Bacteria | 775 |
| 123 | Ga0105242_10270728 | 3300009176 | Bacteria | 1538 |
| 124 | Ga0105242_12239422 | 3300009176 | Bacteria | 592 |
| 125 | Ga0105248_12760778 | 3300009177 | Bacteria | 560 |
| 126 | Ga0105237_10000523 | 3300009545 | Bacteria | 54108 |
| 127 | Ga0105238_10003906 | 3300009551 | Bacteria | 14804 |
| 128 | Ga0105238_11441909 | 3300009551 | Bacteria | 716 |
| 129 | Ga0105249_10003530 | 3300009553 | Bacteria | 13520 |
| 130 | Ga0105249_10312034 | 3300009553 | Bacteria | 1581 |
| 131 | Ga0105249_10403408 | 3300009553 | Bacteria | 1398 |
| 132 | Ga0105239_10007336 | 3300010375 | Bacteria | 12660 |
| 133 | Ga0105239_11391132 | 3300010375 | Bacteria | 810 |
| 134 | Ga0105239_11595400 | 3300010375 | Bacteria | 755 |
| 135 | Ga0105246_10763302 | 3300011119 | Bacteria | 854 |
| 136 | Ga0157369_10030265 | 3300013105 | Bacteria | 5973 |
| 137 | Ga0157369_10230226 | 3300013105 | Bacteria | 1938 |
| 138 | Ga0157369_12081416 | 3300013105 | Bacteria | 576 |
| 139 | Ga0171462_1029 | 3300013250 | Bacteria | 110139 |
| 140 | Ga0157374_11935603 | 3300013296 | Bacteria | 615 |
| 141 | Ga0163162_10835783 | 3300013306 | Bacteria | 1037 |
| 142 | Ga0157372_10049615 | 3300013307 | Bacteria | 4668 |
| 143 | Ga0157375_10017895 | 3300013308 | Bacteria | 6410 |
| 144 | Ga0163163_10050812 | 3300014325 | Bacteria | 4084 |
| 145 | Ga0157380_10348335 | 3300014326 | Bacteria | 1385 |
| 146 | Ga0157380_11519837 | 3300014326 | Bacteria | 723 |
| 147 | Ga0157379_10632819 | 3300014968 | Bacteria | 1000 |
| 148 | Ga0157379_11173849 | 3300014968 | Bacteria | 738 |
| 149 | Ga0157376_11019441 | 3300014969 | Bacteria | 851 |
| 150 | Ga0157376_11470076 | 3300014969 | Bacteria | 714 |
| 151 | Ga0163161_10267783 | 3300017792 | Bacteria | 1336 |
| 152 | Ga0197907_10991673 | 3300020069 | Bacteria | 997 |
| 153 | Ga0206356_11870219 | 3300020070 | Bacteria | 1532 |
| 154 | Ga0206354_10011937 | 3300020081 | Bacteria | 1107 |
| 155 | Ga0206353_11278172 | 3300020082 | Bacteria | 5014 |
| 156 | Ga0209673_1093374 | 3300025273 | Bacteria | 661 |
| 157 | Ga0209675_1006177 | 3300025291 | Bacteria | 4864 |
| 158 | Ga0209676_1038884 | 3300025292 | Bacteria | 1358 |
| 159 | Ga0209564_1000052 | 3300025295 | Bacteria | 356578 |
| 160 | Ga0209256_1000099 | 3300025299 | Bacteria | 203782 |
| 161 | Ga0207692_10204305 | 3300025898 | Bacteria | 1163 |
| 162 | Ga0207710_10265343 | 3300025900 | Bacteria | 861 |
| 163 | Ga0207685_10334240 | 3300025905 | Bacteria | 759 |
| 164 | Ga0207699_10131581 | 3300025906 | Bacteria | 1632 |
| 165 | Ga0207699_10671945 | 3300025906 | Bacteria | 757 |
| 166 | Ga0207645_10256247 | 3300025907 | Bacteria | 1158 |
| 167 | Ga0207643_10049633 | 3300025908 | Unclassified | 2378 |
| 168 | Ga0207684_10002304 | 3300025910 | Bacteria | 19417 |
| 169 | Ga0207684_11686289 | 3300025910 | Bacteria | 511 |
| 170 | Ga0207654_10360353 | 3300025911 | Bacteria | 1003 |
| 171 | Ga0207695_10046160 | 3300025913 | Bacteria | 4619 |
| 172 | Ga0207671_10004041 | 3300025914 | Bacteria | 14229 |
| 173 | Ga0207693_10149512 | 3300025915 | Bacteria | 1837 |
| 174 | Ga0207663_10065192 | 3300025916 | Bacteria | 2327 |
| 175 | Ga0207660_10541251 | 3300025917 | Bacteria | 947 |
| 176 | Ga0207662_10967020 | 3300025918 | Bacteria | 604 |
| 177 | Ga0207652_10157931 | 3300025921 | Bacteria | 2032 |
| 178 | Ga0207646_10011244 | 3300025922 | Bacteria | 8693 |
| 179 | Ga0207646_10185546 | 3300025922 | Bacteria | 1879 |
| 180 | Ga0207646_10201130 | 3300025922 | Bacteria | 1799 |
| 181 | Ga0207646_11090217 | 3300025922 | Bacteria | 703 |
| 182 | Ga0207681_10001082 | 3300025923 | Bacteria | 17666 |
| 183 | Ga0207681_11829566 | 3300025923 | Bacteria | 506 |
| 184 | Ga0207694_10377895 | 3300025924 | Bacteria | 1176 |
| 185 | Ga0207687_10157574 | 3300025927 | Bacteria | 1739 |
| 186 | Ga0207700_10619927 | 3300025928 | Bacteria | 963 |
| 187 | Ga0207700_10650213 | 3300025928 | Bacteria | 940 |
| 188 | Ga0207664_10107446 | 3300025929 | Bacteria | 2315 |
| 189 | Ga0207664_10386012 | 3300025929 | Bacteria | 1244 |
| 190 | Ga0207690_10692912 | 3300025932 | Bacteria | 837 |
| 191 | Ga0207706_10027919 | 3300025933 | Bacteria | 5044 |
| 192 | Ga0207686_10278505 | 3300025934 | Bacteria | 1234 |
| 193 | Ga0207709_10577565 | 3300025935 | Bacteria | 887 |
| 194 | Ga0207669_10734620 | 3300025937 | Bacteria | 814 |
| 195 | Ga0207691_10172309 | 3300025940 | Bacteria | 1894 |
| 196 | Ga0207661_10161549 | 3300025944 | Bacteria | 1944 |
| 197 | Ga0207667_10085907 | 3300025949 | Bacteria | 3256 |
| 198 | Ga0207651_11484942 | 3300025960 | Bacteria | 610 |
| 199 | Ga0207712_10002684 | 3300025961 | Bacteria | 11368 |
| 200 | Ga0207712_10134892 | 3300025961 | Bacteria | 1886 |
| 201 | Ga0207712_10226906 | 3300025961 | Bacteria | 1497 |
| 202 | Ga0207712_11203576 | 3300025961 | Bacteria | 676 |
| 203 | Ga0207668_10011208 | 3300025972 | Bacteria | 5441 |
| 204 | Ga0207677_10336714 | 3300026023 | Bacteria | 1259 |
| 205 | Ga0207639_11391690 | 3300026041 | Bacteria | 658 |
| 206 | Ga0207678_10460865 | 3300026067 | Unclassified | 1106 |
| 207 | Ga0207678_10558485 | 3300026067 | Bacteria | 1002 |
| 208 | Ga0207708_10000002 | 3300026075 | Bacteria | 411071 |
| 209 | Ga0207708_10526320 | 3300026075 | Bacteria | 994 |
| 210 | Ga0207702_10186879 | 3300026078 | Bacteria | 1911 |
| 211 | Ga0207641_10340728 | 3300026088 | Bacteria | 1427 |
| 212 | Ga0207648_10097107 | 3300026089 | Bacteria | 2579 |
| 213 | Ga0207648_10788173 | 3300026089 | Bacteria | 884 |
| 214 | Ga0207676_10256155 | 3300026095 | Bacteria | 1578 |
| 215 | Ga0207676_10507478 | 3300026095 | Bacteria | 1146 |
| 216 | Ga0207674_10016870 | 3300026116 | Bacteria | 7979 |
| 217 | Ga0207675_100137015 | 3300026118 | Bacteria | 2324 |
| 218 | Ga0207683_10068153 | 3300026121 | Bacteria | 3141 |
| 219 | Ga0207683_10505902 | 3300026121 | Bacteria | 1116 |
| 220 | Ga0207698_10771154 | 3300026142 | Bacteria | 962 |
| 221 | Ga0207698_11395110 | 3300026142 | Bacteria | 716 |
| 222 | Ga0209974_10025424 | 3300027876 | Bacteria | 1959 |
| 223 | Ga0209974_10095785 | 3300027876 | Bacteria | 1033 |
| 224 | Ga0209974_10272912 | 3300027876 | Bacteria | 641 |
| 225 | Ga0207428_10431291 | 3300027907 | Bacteria | 962 |
| 226 | Ga0268265_10015988 | 3300028380 | Bacteria | 5148 |
| 227 | Ga0268265_10108314 | 3300028380 | Bacteria | 2262 |
| 228 | Ga0268264_10140319 | 3300028381 | Bacteria | 2154 |
| 229 | Ga0268264_10353647 | 3300028381 | Bacteria | 1399 |
| 230 | Ga0265334_10023452 | 3300028573 | Bacteria | 2509 |
| 231 | Ga0307515_10010929 | 3300028794 | Bacteria | 17310 |
| 232 | Ga0307515_10116703 | 3300028794 | Bacteria | 3062 |
| 233 | Ga0265331_10573949 | 3300031250 | Unclassified | 509 |
| 234 | Ga0265316_10957208 | 3300031344 | Bacteria | 597 |
| 235 | Ga0307513_10009552 | 3300031456 | Bacteria | 12262 |
| 236 | Ga0307513_10262634 | 3300031456 | Bacteria | 1515 |
| 237 | Ga0307408_100957549 | 3300031548 | Bacteria | 787 |
| 238 | Ga0307516_10021238 | 3300031730 | Bacteria | 6688 |
| 239 | Ga0307516_10028507 | 3300031730 | Bacteria | 5649 |
| 240 | Ga0307516_10571681 | 3300031730 | Bacteria | 784 |
| 241 | Ga0307405_10166588 | 3300031731 | Bacteria | 1567 |
| 242 | Ga0307405_11855033 | 3300031731 | Bacteria | 537 |
| 243 | Ga0307413_11160670 | 3300031824 | Bacteria | 670 |
| 244 | Ga0307410_10422311 | 3300031852 | Bacteria | 1082 |
| 245 | Ga0307410_11555962 | 3300031852 | Bacteria | 583 |
| 246 | Ga0326468_10057957 | 3300031889 | Bacteria | 608 |
| 247 | Ga0307406_11084595 | 3300031901 | Bacteria | 691 |
| 248 | Ga0307407_11007017 | 3300031903 | Bacteria | 644 |
| 249 | Ga0307412_10809714 | 3300031911 | Bacteria | 814 |
| 250 | Ga0307412_11105022 | 3300031911 | Bacteria | 706 |
| 251 | Ga0307409_100172794 | 3300031995 | Bacteria | 1904 |
| 252 | Ga0307409_100365739 | 3300031995 | Bacteria | 1366 |
| 253 | Ga0307409_101616491 | 3300031995 | Bacteria | 676 |
| 254 | Ga0307409_102436463 | 3300031995 | Bacteria | 552 |
| 255 | Ga0307416_102925912 | 3300032002 | Bacteria | 571 |
| 256 | Ga0307416_103182637 | 3300032002 | Bacteria | 549 |
| 257 | Ga0307414_10215147 | 3300032004 | Bacteria | 1574 |
| 258 | Ga0307414_10604510 | 3300032004 | Bacteria | 984 |
| 259 | Ga0307414_11248052 | 3300032004 | Bacteria | 689 |
| 260 | Ga0307411_10786304 | 3300032005 | Bacteria | 837 |
| 261 | Ga0307411_11677736 | 3300032005 | Bacteria | 588 |
| 262 | Ga0307411_12210205 | 3300032005 | Unclassified | 516 |
| 263 | Ga0307415_100086024 | 3300032126 | Bacteria | 2261 |
| 264 | Ga0307415_100731166 | 3300032126 | Bacteria | 896 |
| 265 | Ga0307415_101249187 | 3300032126 | Bacteria | 702 |
| 266 | Ga0307415_101270190 | 3300032126 | Unclassified | 696 |
| 267 | Ga0307415_102004711 | 3300032126 | Bacteria | 564 |
| 268 | Ga0373935_0198295 | 3300035692 | Bacteria | 1386 |
| 269 | Ga0373935_0600969 | 3300035692 | Bacteria | 804 |
| 270 | Ga0373937_0149320 | 3300036401 | Bacteria | 2189 |
| 271 | Ga0373925_0671147 | 3300037068 | Bacteria | 854 |
| 272 | Ga0395900_0135473 | 3300037418 | Bacteria | 2523 |
| 273 | Ga0395900_0162434 | 3300037418 | Bacteria | 2278 |
| 274 | Ga0395900_0577204 | 3300037418 | Bacteria | 1067 |
| 275 | Ga0395898_0133625 | 3300037466 | Bacteria | 2376 |
| 276 | Ga0395898_1266628 | 3300037466 | Bacteria | 667 |
| 277 | Ga0436364_0385737 | 3300037853 | Bacteria | 692 |
| 278 | Ga0395901_0114429 | 3300038443 | Bacteria | 2834 |
| 279 | Ga0237816_04283 | 3300039145 | Bacteria | 999 |
| 280 | Ga0439466_0112035 | 3300041411 | Bacteria | 846 |
| 281 | Ga0439465_0144445 | 3300041413 | Bacteria | 847 |
| 282 | Ga0439465_0285535 | 3300041413 | Bacteria | 615 |
| 283 | Ga0451791_0730496 | 3300041451 | Bacteria | 1020 |
| 284 | Ga0451793_0055040 | 3300041452 | Bacteria | 866 |
| 285 | Ga0451802_1961840 | 3300041460 | Bacteria | 1081 |
| 286 | Ga0451807_1343908 | 3300041486 | Bacteria | 859 |
| 287 | Ga0451833_0723785 | 3300041491 | Bacteria | 793 |
| 288 | Ga0451833_0831283 | 3300041491 | Bacteria | 1160 |
| 289 | Ga0451835_0713824 | 3300041492 | Bacteria | 826 |
| 290 | Ga0451853_0708726 | 3300041512 | Bacteria | 893 |
| 291 | Ga0451853_3356586 | 3300041512 | Bacteria | 666 |
| 292 | Ga0439431_0153847 | 3300041997 | Bacteria | 655 |
| 293 | Ga0450923_126994 | 3300042125 | Bacteria | 605 |
| 294 | Ga0466969_0112142 | 3300044656 | Bacteria | 1275 |
| 295 | Ga0466969_0391306 | 3300044656 | Bacteria | 631 |
| 296 | Ga0466965_0039416 | 3300044683 | Bacteria | 2322 |
| 297 | Ga0466965_0138422 | 3300044683 | Bacteria | 1266 |
| 298 | Ga0466965_0218974 | 3300044683 | Bacteria | 1014 |
| 299 | Ga0466965_0305182 | 3300044683 | Bacteria | 864 |
| 300 | Ga0466965_0764441 | 3300044683 | Bacteria | 557 |
| 301 | Ga0466965_0926587 | 3300044683 | Bacteria | 509 |
| 302 | Ga0466966_0008856 | 3300044684 | Bacteria | 6665 |
| 303 | Ga0466966_0109186 | 3300044684 | Bacteria | 1706 |
| 304 | Ga0466966_0110494 | 3300044684 | Bacteria | 1695 |
| 305 | Ga0466966_0196254 | 3300044684 | Bacteria | 1222 |
| 306 | Ga0466966_0226949 | 3300044684 | Bacteria | 1127 |
| 307 | Ga0466961_0033686 | 3300044693 | Bacteria | 3290 |
| 308 | Ga0466961_0092211 | 3300044693 | Bacteria | 1912 |
| 309 | Ga0466961_0332836 | 3300044693 | Bacteria | 925 |
| 310 | Ga0466961_0603622 | 3300044693 | Bacteria | 660 |
| 311 | Ga0466961_0709409 | 3300044693 | Bacteria | 602 |
| 312 | Ga0466963_0027914 | 3300044694 | Bacteria | 3618 |
| 313 | Ga0466963_0250685 | 3300044694 | Bacteria | 1242 |
| 314 | Ga0466963_0630538 | 3300044694 | Bacteria | 757 |
| 315 | Ga0466964_0142124 | 3300044706 | Bacteria | 1104 |
| 316 | Ga0466964_0583870 | 3300044706 | Bacteria | 611 |
| 317 | Ga0466971_0027718 | 3300044719 | Bacteria | 2537 |
| 318 | Ga0466971_0284492 | 3300044719 | Bacteria | 792 |
| 319 | Ga0466970_0011348 | 3300044765 | Bacteria | 4542 |
| 320 | Ga0466970_0037211 | 3300044765 | Bacteria | 2579 |
| 321 | Ga0466970_0319872 | 3300044765 | Bacteria | 877 |
| 322 | Ga0466970_0326319 | 3300044765 | Bacteria | 868 |
| 323 | Ga0466970_0415708 | 3300044765 | Bacteria | 768 |
| 324 | Ga0466970_0653177 | 3300044765 | Bacteria | 612 |
| 325 | Ga0466957_0018000 | 3300044842 | Bacteria | 4144 |
| 326 | Ga0466957_0037376 | 3300044842 | Bacteria | 2923 |
| 327 | Ga0466957_0077177 | 3300044842 | Bacteria | 2069 |
| 328 | Ga0466957_0123081 | 3300044842 | Bacteria | 1655 |
| 329 | Ga0466957_0132231 | 3300044842 | Bacteria | 1600 |
| 330 | Ga0466957_0521076 | 3300044842 | Bacteria | 826 |
| 331 | Ga0466957_1019471 | 3300044842 | Bacteria | 595 |
| 332 | Ga0466960_0005472 | 3300044901 | Bacteria | 5034 |
| 333 | Ga0466960_0115408 | 3300044901 | Bacteria | 1400 |
| 334 | Ga0466960_0121662 | 3300044901 | Bacteria | 1368 |
| 335 | Ga0466960_0138226 | 3300044901 | Bacteria | 1292 |
| 336 | Ga0466960_0187298 | 3300044901 | Bacteria | 1125 |
| 337 | Ga0466960_0230829 | 3300044901 | Bacteria | 1021 |
| 338 | Ga0466960_0414553 | 3300044901 | Bacteria | 778 |
| 339 | Ga0466960_0562311 | 3300044901 | Bacteria | 674 |
| 340 | Ga0466960_0720069 | 3300044901 | Bacteria | 600 |
| 341 | Ga0466959_0020677 | 3300045049 | Bacteria | 4850 |
| 342 | Ga0466959_0096572 | 3300045049 | Bacteria | 2118 |
| 343 | Ga0466959_1051948 | 3300045049 | Bacteria | 542 |
| 344 | Ga0466958_0087038 | 3300045836 | Bacteria | 1929 |
| 345 | Ga0466958_0417123 | 3300045836 | Bacteria | 867 |
| 346 | Ga0466958_0908241 | 3300045836 | Bacteria | 574 |
| 347 | Ga0466967_0002638 | 3300045976 | Bacteria | 11299 |
| 348 | Ga0466967_0096782 | 3300045976 | Bacteria | 2693 |
| 349 | Ga0466967_0113994 | 3300045976 | Bacteria | 2488 |
| 350 | Ga0466967_0308261 | 3300045976 | Bacteria | 1524 |
| 351 | Ga0466967_0650535 | 3300045976 | Bacteria | 1042 |
| 352 | Ga0466967_0747803 | 3300045976 | Bacteria | 970 |
| 353 | Ga0466967_1010354 | 3300045976 | Bacteria | 828 |
| 354 | Ga0466967_1788938 | 3300045976 | Bacteria | 612 |
| 355 | Ga0466967_1850291 | 3300045976 | Bacteria | 601 |
| 356 | Ga0466967_2046776 | 3300045976 | Bacteria | 569 |
| 357 | Ga0495592_0157299 | 3300046454 | Bacteria | 1566 |
| 358 | Ga0495629_0004304 | 3300046459 | Bacteria | 10671 |
| 359 | Ga0495629_0004365 | 3300046459 | Bacteria | 10601 |
| 360 | Ga0495651_0010100 | 3300046462 | Bacteria | 7251 |
| 361 | Ga0495653_0001107 | 3300046463 | Bacteria | 20791 |
| 362 | Ga0495580_0067930 | 3300046472 | Bacteria | 2493 |
| 363 | Ga0495582_0002354 | 3300046473 | Bacteria | 10576 |
| 364 | Ga0495582_0019705 | 3300046473 | Bacteria | 3689 |
| 365 | Ga0495582_0817212 | 3300046473 | Bacteria | 539 |
| 366 | Ga0495639_0002659 | 3300046475 | Bacteria | 7756 |
| 367 | Ga0495662_0001100 | 3300046476 | Bacteria | 13301 |
| 368 | Ga0495664_0007808 | 3300046477 | Bacteria | 5953 |
| 369 | Ga0495594_0000283 | 3300046499 | Bacteria | 24954 |
| 370 | Ga0495594_0002017 | 3300046499 | Bacteria | 10573 |
| 371 | Ga0495610_0066437 | 3300046512 | Bacteria | 1698 |
| 372 | Ga0495618_0088116 | 3300046514 | Bacteria | 1985 |
| 373 | Ga0495628_0032569 | 3300046516 | Bacteria | 4207 |
| 374 | Ga0495632_0030686 | 3300046519 | Bacteria | 2787 |
| 375 | Ga0495643_0223466 | 3300046522 | Bacteria | 892 |
| 376 | Ga0495666_0000599 | 3300046526 | Bacteria | 16125 |
| 377 | Ga0495652_0141101 | 3300046529 | Bacteria | 1894 |
| 378 | Ga0495665_0004376 | 3300046531 | Bacteria | 7625 |
| 379 | Ga0495586_0001932 | 3300046535 | Bacteria | 11293 |
| 380 | Ga0495587_0102036 | 3300046536 | Bacteria | 1652 |
| 381 | Ga0495597_0011512 | 3300046542 | Bacteria | 4288 |
| 382 | Ga0495645_0009238 | 3300046543 | Bacteria | 6890 |
| 383 | Ga0495622_0150000 | 3300046557 | Bacteria | 1055 |
| 384 | Ga0495622_0215768 | 3300046557 | Bacteria | 851 |
| 385 | Ga0495667_0008812 | 3300046559 | Bacteria | 6860 |
| 386 | Ga0495656_0784222 | 3300046615 | Bacteria | 515 |
| 387 | Ga0495634_0000716 | 3300046642 | Bacteria | 32120 |
| 388 | Ga0495625_0001726 | 3300046660 | Bacteria | 25344 |
| 389 | Ga0495635_0013349 | 3300046663 | Bacteria | 5750 |
| 390 | Ga0495657_0279991 | 3300046675 | Unclassified | 998 |
| 391 | Ga0495599_0006273 | 3300046678 | Bacteria | 7166 |
| 392 | Ga0495623_0013841 | 3300046679 | Bacteria | 5230 |
| 393 | Ga0495646_0029421 | 3300046680 | Bacteria | 3433 |
| 394 | Ga0495647_0256865 | 3300046681 | Bacteria | 779 |
| 395 | Ga0495613_0018991 | 3300046689 | Bacteria | 5121 |
| 396 | Ga0495613_0069338 | 3300046689 | Bacteria | 2570 |
| 397 | Ga0495624_0078089 | 3300046690 | Bacteria | 2054 |
| 398 | Ga0495600_0009995 | 3300046809 | Bacteria | 5881 |
| 399 | Ga0495581_0006788 | 3300047315 | Bacteria | 6636 |
| 400 | Ga0495581_0021354 | 3300047315 | Bacteria | 3754 |
| 401 | Ga0495604_0078251 | 3300047317 | Bacteria | 2482 |
| 402 | Ga0495674_0092753 | 3300047319 | Bacteria | 2577 |
| 403 | Ga0495676_0004731 | 3300047321 | Bacteria | 12460 |
| 404 | Ga0495676_0727269 | 3300047321 | Bacteria | 641 |
| 405 | Ga0495680_0020406 | 3300047322 | Bacteria | 5575 |
| 406 | Ga0495687_000350 | 3300047443 | Bacteria | 59063 |
| 407 | Ga0495675_0003952 | 3300047444 | Bacteria | 8985 |
| 408 | Ga0495684_0070685 | 3300047471 | Bacteria | 2653 |
| 409 | Ga0495684_0121129 | 3300047471 | Bacteria | 1970 |
| 410 | Ga0495686_0113101 | 3300047472 | Bacteria | 1626 |
| 411 | Ga0495593_0105486 | 3300047673 | Bacteria | 1442 |
| 412 | Ga0495593_0147563 | 3300047673 | Bacteria | 1190 |
| 413 | Ga0495614_0003981 | 3300048089 | Bacteria | 6630 |
| 414 | Ga0495614_0139527 | 3300048089 | Bacteria | 1076 |
| 415 | Ga0496101_1408177 | 3300048904 | Bacteria | 544 |
| 416 | Ga0496102_1728901 | 3300048905 | Bacteria | 543 |
| 417 | Ga0496103_0002784 | 3300048906 | Bacteria | 10882 |
| 418 | Ga0496106_0010627 | 3300048909 | Bacteria | 6802 |
| 419 | Ga0496107_0586943 | 3300048910 | Bacteria | 824 |
| 420 | Ga0496108_0148804 | 3300048911 | Bacteria | 2020 |
| 421 | Ga0496108_0552250 | 3300048911 | Bacteria | 1005 |
| 422 | Ga0496109_1951428 | 3300048912 | Bacteria | 519 |
| 423 | Ga0496110_1576685 | 3300048913 | Bacteria | 567 |
| 424 | Ga0496111_0942886 | 3300048914 | Bacteria | 620 |
| 425 | Ga0496112_0712550 | 3300048915 | Bacteria | 931 |
| 426 | Ga0496114_0146134 | 3300048917 | Bacteria | 2050 |
| 427 | Ga0496122_0049207 | 3300048925 | Bacteria | 3231 |
| 428 | Ga0496123_0165268 | 3300048926 | Bacteria | 1174 |
| 429 | Ga0496126_0032030 | 3300048929 | Bacteria | 4959 |
| 430 | Ga0501299_102000 | 3300049522 | Unclassified | 667 |
| 431 | Ga0501031_0176337 | 3300049568 | Bacteria | 1396 |
| 432 | Ga0501032_0232780 | 3300049569 | Bacteria | 1198 |
| 433 | Ga0501033_1155912 | 3300049570 | Unclassified | 514 |
| 434 | Ga0501034_0136659 | 3300049571 | Bacteria | 2432 |
| 435 | Ga0501036_0135072 | 3300049572 | Bacteria | 2082 |
| 436 | Ga0501036_0795247 | 3300049572 | Unclassified | 779 |
| 437 | Ga0501037_0235573 | 3300049573 | Bacteria | 1284 |
| 438 | Ga0501039_0089674 | 3300049575 | Bacteria | 2396 |
| 439 | Ga0501039_0374902 | 3300049575 | Unclassified | 1118 |
| 440 | Ga0501040_0028166 | 3300049576 | Bacteria | 3786 |
| 441 | Ga0501041_0057856 | 3300049577 | Bacteria | 2371 |
| 442 | Ga0501042_0237350 | 3300049578 | Bacteria | 1315 |
| 443 | Ga0501046_1268308 | 3300049580 | Bacteria | 504 |
| 444 | Ga0501048_0079673 | 3300049582 | Bacteria | 2311 |
| 445 | Ga0501048_0421285 | 3300049582 | Bacteria | 955 |
| 446 | Ga0501067_0008625 | 3300049583 | Bacteria | 5650 |
| 447 | Ga0501068_0219068 | 3300049584 | Unclassified | 1210 |
| 448 | Ga0501068_0256383 | 3300049584 | Bacteria | 1115 |
| 449 | Ga0501069_0014518 | 3300049585 | Bacteria | 4212 |
| 450 | Ga0501071_0181164 | 3300049587 | Bacteria | 1578 |
| 451 | Ga0501071_1084040 | 3300049587 | Unclassified | 619 |
| 452 | Ga0501072_0104306 | 3300049588 | Bacteria | 2254 |
| 453 | Ga0501073_0250332 | 3300049589 | Bacteria | 1223 |
| 454 | Ga0501074_0141499 | 3300049590 | Bacteria | 1721 |
| 455 | Ga0501074_1127288 | 3300049590 | Unclassified | 551 |
| 456 | Ga0501075_0183613 | 3300049591 | Bacteria | 1596 |
| 457 | Ga0501075_0605318 | 3300049591 | Unclassified | 836 |
| 458 | Ga0501076_0196378 | 3300049592 | Bacteria | 1647 |
| 459 | Ga0501076_0213491 | 3300049592 | Unclassified | 1577 |
| 460 | Ga0501076_1582460 | 3300049592 | Bacteria | 538 |
| 461 | Ga0501077_0127680 | 3300049593 | Bacteria | 1612 |
| 462 | Ga0501202_096701 | 3300049652 | Unclassified | 713 |
| 463 | Ga0501217_105795 | 3300049661 | Unclassified | 804 |
| 464 | Ga0501250_109022 | 3300049680 | Unclassified | 501 |
| 465 | Ga0501079_0014179 | 3300049741 | Bacteria | 6077 |
| 466 | Ga0501080_0020074 | 3300049742 | Bacteria | 6185 |
| 467 | Ga0501081_0137891 | 3300049743 | Bacteria | 1747 |
| 468 | Ga0501081_1308560 | 3300049743 | Unclassified | 550 |
| 469 | Ga0501283_015198 | 3300049779 | Bacteria | 1183 |
| 470 | Ga0501035_0030346 | 3300049822 | Bacteria | 4929 |
| 471 | Ga0501035_1074265 | 3300049822 | Bacteria | 630 |
| 472 | Ga0501044_0390176 | 3300049823 | Bacteria | 1306 |
| 473 | Ga0501044_0399000 | 3300049823 | Bacteria | 1288 |
| 474 | Ga0501045_0032770 | 3300049824 | Bacteria | 3766 |
| 475 | Ga0501045_0042712 | 3300049824 | Bacteria | 3301 |
| 476 | nmdc:mga03683_9518_c1 | 3300050489 | Bacteria | 3460 |
| 477 | nmdc:mga03n38_225731_c1 | 3300050490 | Bacteria | 980 |
| 478 | nmdc:mga00v17_15325_c1 | 3300050491 | Bacteria | 4302 |
| 479 | nmdc:mga0yw44_383302_c1 | 3300050492 | Bacteria | 949 |
| 480 | nmdc:mga0yw44_592336_c1 | 3300050492 | Bacteria | 753 |
| 481 | nmdc:mga0k408_130378_c1 | 3300050493 | Bacteria | 1493 |
| 482 | nmdc:mga0k408_25759_c1 | 3300050493 | Bacteria | 3333 |
| 483 | nmdc:mga0k408_607750_c1 | 3300050493 | Bacteria | 645 |
| 484 | nmdc:mga06z11_9515_c1 | 3300050494 | Bacteria | 4099 |
| 485 | nmdc:mga07m45_106124_c1 | 3300050496 | Bacteria | 1616 |
| 486 | nmdc:mga07m45_66877_c1 | 3300050496 | Bacteria | 2042 |
| 487 | nmdc:mga05p37_1476654_c1 | 3300050507 | Bacteria | 679 |
| 488 | nmdc:mga05p37_77658_c1 | 3300050507 | Bacteria | 1414 |
| 489 | nmdc:mga06r32_1864395_c1 | 3300050510 | Bacteria | 536 |
| 490 | nmdc:mga08y16_765383_c1 | 3300050511 | Bacteria | 961 |
| 491 | nmdc:mga0a205_133497_c1 | 3300050515 | Bacteria | 2383 |
| 492 | nmdc:mga0sz30_117996_c2 | 3300050516 | Bacteria | 565 |
| 493 | nmdc:mga0sz30_131849_c1 | 3300050516 | Bacteria | 1101 |
| 494 | nmdc:mga0sz30_6208_c1 | 3300050516 | Bacteria | 4428 |
| 495 | Ga0500644_0012095 | 3300053088 | Bacteria | 2378 |
| 496 | Ga0500562_012525 | 3300053108 | Bacteria | 2158 |
| 497 | Ga0500593_001868 | 3300053117 | Bacteria | 7576 |
| 498 | Ga0500658_0061688 | 3300053134 | Bacteria | 1560 |
| 499 | Ga0500587_047608 | 3300053739 | Bacteria | 629 |
| 500 | Ga0501084_0154964 | 3300054114 | Unclassified | 1932 |
| 501 | Ga0501084_0249831 | 3300054114 | Bacteria | 1497 |
| 502 | Ga0501084_0275722 | 3300054114 | Bacteria | 1420 |
| 503 | Ga0501082_0041030 | 3300060353 | Bacteria | 3990 |
| 504 | Ga0466962_0019793 | 3300061719 | Bacteria | 3233 |
| 505 | Ga0466962_0067280 | 3300061719 | Bacteria | 1710 |
| 506 | Ga0466962_0389989 | 3300061719 | Bacteria | 696 |
| 507 | Ga0530510_0059970 | 3300061734 | Bacteria | 2753 |
| 508 | Ga0530510_0146314 | 3300061734 | Bacteria | 1743 |
| 509 | Ga0530510_0174683 | 3300061734 | Bacteria | 1592 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047315 | Ga0495581_0006788 | Ga0495581_0006788_6293_6604 | 83 |
| 2 | 3300048089 | Ga0495614_0003981 | Ga0495614_0003981_6287_6598 | 83 |
| 3 | 3300035692 | Ga0373935_0600969 | Ga0373935_0600969_387_755 | 102 |
| 4 | 3300037068 | Ga0373925_0671147 | Ga0373925_0671147_66_434 | 102 |
| 5 | 3300046454 | Ga0495592_0157299 | Ga0495592_0157299_896_1264 | 102 |
| 6 | 3300046459 | Ga0495629_0004304 | Ga0495629_0004304_1186_1554 | 102 |
| 7 | 3300046459 | Ga0495629_0004365 | Ga0495629_0004365_6382_6750 | 102 |
| 8 | 3300046462 | Ga0495651_0010100 | Ga0495651_0010100_3714_4082 | 102 |
| 9 | 3300046463 | Ga0495653_0001107 | Ga0495653_0001107_15271_15639 | 102 |
| 10 | 3300046472 | Ga0495580_0067930 | Ga0495580_0067930_498_866 | 102 |
| 11 | 3300046473 | Ga0495582_0002354 | Ga0495582_0002354_9738_10106 | 102 |
| 12 | 3300046473 | Ga0495582_0019705 | Ga0495582_0019705_188_556 | 102 |
| 13 | 3300046475 | Ga0495639_0002659 | Ga0495639_0002659_6818_7186 | 102 |
| 14 | 3300046476 | Ga0495662_0001100 | Ga0495662_0001100_3416_3784 | 102 |
| 15 | 3300046477 | Ga0495664_0007808 | Ga0495664_0007808_639_1007 | 102 |
| 16 | 3300046499 | Ga0495594_0000283 | Ga0495594_0000283_7981_8349 | 102 |
| 17 | 3300046499 | Ga0495594_0002017 | Ga0495594_0002017_5298_5666 | 102 |
| 18 | 3300046514 | Ga0495618_0088116 | Ga0495618_0088116_1115_1483 | 102 |
| 19 | 3300046516 | Ga0495628_0032569 | Ga0495628_0032569_798_1166 | 102 |
| 20 | 3300046526 | Ga0495666_0000599 | Ga0495666_0000599_14456_14824 | 102 |
| 21 | 3300046529 | Ga0495652_0141101 | Ga0495652_0141101_202_570 | 102 |
| 22 | 3300046531 | Ga0495665_0004376 | Ga0495665_0004376_165_533 | 102 |
| 23 | 3300046535 | Ga0495586_0001932 | Ga0495586_0001932_4004_4372 | 102 |
| 24 | 3300046536 | Ga0495587_0102036 | Ga0495587_0102036_815_1183 | 102 |
| 25 | 3300046543 | Ga0495645_0009238 | Ga0495645_0009238_6507_6875 | 102 |
| 26 | 3300046557 | Ga0495622_0150000 | Ga0495622_0150000_185_553 | 102 |
| 27 | 3300046557 | Ga0495622_0215768 | Ga0495622_0215768_450_818 | 102 |
| 28 | 3300046559 | Ga0495667_0008812 | Ga0495667_0008812_5962_6330 | 102 |
| 29 | 3300046642 | Ga0495634_0000716 | Ga0495634_0000716_8055_8423 | 102 |
| 30 | 3300046663 | Ga0495635_0013349 | Ga0495635_0013349_5207_5575 | 102 |
| 31 | 3300046675 | Ga0495657_0279991 | Ga0495657_0279991_429_797 | 102 |
| 32 | 3300046678 | Ga0495599_0006273 | Ga0495599_0006273_6584_6952 | 102 |
| 33 | 3300046679 | Ga0495623_0013841 | Ga0495623_0013841_538_906 | 102 |
| 34 | 3300046680 | Ga0495646_0029421 | Ga0495646_0029421_1633_2001 | 102 |
| 35 | 3300046681 | Ga0495647_0256865 | Ga0495647_0256865_287_655 | 102 |
| 36 | 3300046689 | Ga0495613_0018991 | Ga0495613_0018991_16_384 | 102 |
| 37 | 3300046689 | Ga0495613_0069338 | Ga0495613_0069338_2188_2556 | 102 |
| 38 | 3300046690 | Ga0495624_0078089 | Ga0495624_0078089_1179_1547 | 102 |
| 39 | 3300046809 | Ga0495600_0009995 | Ga0495600_0009995_1511_1879 | 102 |
| 40 | 3300047315 | Ga0495581_0021354 | Ga0495581_0021354_589_957 | 102 |
| 41 | 3300047317 | Ga0495604_0078251 | Ga0495604_0078251_1445_1813 | 102 |
| 42 | 3300047319 | Ga0495674_0092753 | Ga0495674_0092753_166_534 | 102 |
| 43 | 3300047321 | Ga0495676_0004731 | Ga0495676_0004731_9087_9455 | 102 |
| 44 | 3300047321 | Ga0495676_0727269 | Ga0495676_0727269_70_438 | 102 |
| 45 | 3300047322 | Ga0495680_0020406 | Ga0495680_0020406_2891_3259 | 102 |
| 46 | 3300047444 | Ga0495675_0003952 | Ga0495675_0003952_7933_8301 | 102 |
| 47 | 3300047471 | Ga0495684_0070685 | Ga0495684_0070685_2016_2384 | 102 |
| 48 | 3300047471 | Ga0495684_0121129 | Ga0495684_0121129_1261_1629 | 102 |
| 49 | 3300047673 | Ga0495593_0105486 | Ga0495593_0105486_883_1251 | 102 |
| 50 | 3300047673 | Ga0495593_0147563 | Ga0495593_0147563_704_1072 | 102 |
| 51 | 3300048089 | Ga0495614_0139527 | Ga0495614_0139527_424_792 | 102 |
| 52 | 3300044683 | Ga0466965_0138422 | Ga0466965_0138422_940_1251 | 103 |
| 53 | 3300046522 | Ga0495643_0223466 | Ga0495643_0223466_472_846 | 104 |
| 54 | 3300046542 | Ga0495597_0011512 | Ga0495597_0011512_2378_2752 | 104 |
| 55 | 3300047443 | Ga0495687_000350 | Ga0495687_000350_37084_37458 | 104 |
| 56 | 3300005337 | Ga0070682_101322552 | Ga0070682_1013225522 | 108 |
| 57 | 3300005618 | Ga0068864_101435181 | Ga0068864_1014351812 | 108 |
| 58 | 3300005985 | Ga0081539_10026515 | Ga0081539_100265153 | 108 |
| 59 | 3300006852 | Ga0075433_11058422 | Ga0075433_110584222 | 108 |
| 60 | 3300009147 | Ga0114129_10232236 | Ga0114129_102322361 | 108 |
| 61 | 3300009147 | Ga0114129_11210195 | Ga0114129_112101952 | 108 |
| 62 | 3300041413 | Ga0439465_0144445 | Ga0439465_0144445_124_465 | 108 |
| 63 | 3300050507 | nmdc:mga05p37_1476654_c1 | nmdc:mga05p37_1476654_c1_160_519 | 108 |
| 64 | 3300050515 | nmdc:mga0a205_133497_c1 | nmdc:mga0a205_133497_c1_251_610 | 108 |
| 65 | 3300005343 | Ga0070687_101182895 | Ga0070687_1011828951 | 109 |
| 66 | 3300005440 | Ga0070705_100023787 | Ga0070705_1000237874 | 109 |
| 67 | 3300005444 | Ga0070694_100541872 | Ga0070694_1005418721 | 109 |
| 68 | 3300005468 | Ga0070707_101043591 | Ga0070707_1010435911 | 109 |
| 69 | 3300005471 | Ga0070698_100106145 | Ga0070698_1001061455 | 109 |
| 70 | 3300005536 | Ga0070697_100662218 | Ga0070697_1006622182 | 109 |
| 71 | 3300005546 | Ga0070696_100047743 | Ga0070696_1000477433 | 109 |
| 72 | 3300005549 | Ga0070704_100053024 | Ga0070704_1000530241 | 109 |
| 73 | 3300006353 | Ga0075370_10051313 | Ga0075370_100513132 | 109 |
| 74 | 3300009098 | Ga0105245_10801101 | Ga0105245_108011012 | 109 |
| 75 | 3300009147 | Ga0114129_10362183 | Ga0114129_103621832 | 109 |
| 76 | 3300009147 | Ga0114129_11497041 | Ga0114129_114970411 | 109 |
| 77 | 3300009148 | Ga0105243_10127652 | Ga0105243_101276523 | 109 |
| 78 | 3300009174 | Ga0105241_11020082 | Ga0105241_110200822 | 109 |
| 79 | 3300009176 | Ga0105242_10270728 | Ga0105242_102707281 | 109 |
| 80 | 3300014968 | Ga0157379_11173849 | Ga0157379_111738491 | 109 |
| 81 | 3300025905 | Ga0207685_10334240 | Ga0207685_103342401 | 109 |
| 82 | 3300025911 | Ga0207654_10360353 | Ga0207654_103603531 | 109 |
| 83 | 3300025922 | Ga0207646_11090217 | Ga0207646_110902171 | 109 |
| 84 | 3300025934 | Ga0207686_10278505 | Ga0207686_102785053 | 109 |
| 85 | 3300026067 | Ga0207678_10558485 | Ga0207678_105584852 | 109 |
| 86 | 3300031911 | Ga0307412_11105022 | Ga0307412_111050222 | 109 |
| 87 | 3300032002 | Ga0307416_102925912 | Ga0307416_1029259121 | 109 |
| 88 | 3300035692 | Ga0373935_0198295 | Ga0373935_0198295_131_499 | 109 |
| 89 | 3300036401 | Ga0373937_0149320 | Ga0373937_0149320_1654_2022 | 109 |
| 90 | 3300037853 | Ga0436364_0385737 | Ga0436364_0385737_85_444 | 109 |
| 91 | 3300041486 | Ga0451807_1343908 | Ga0451807_1343908_430_825 | 109 |
| 92 | 3300041491 | Ga0451833_0723785 | Ga0451833_0723785_248_619 | 109 |
| 93 | 3300048906 | Ga0496103_0002784 | Ga0496103_0002784_703_1089 | 109 |
| 94 | 3300048909 | Ga0496106_0010627 | Ga0496106_0010627_569_955 | 109 |
| 95 | 3300049589 | Ga0501073_0250332 | Ga0501073_0250332_131_535 | 109 |
| 96 | 3300050496 | nmdc:mga07m45_66877_c1 | nmdc:mga07m45_66877_c1_613_972 | 109 |
| 97 | 3300050507 | nmdc:mga05p37_77658_c1 | nmdc:mga05p37_77658_c1_952_1311 | 109 |
| 98 | 3300005617 | Ga0068859_100874412 | Ga0068859_1008744122 | 110 |
| 99 | 3300005981 | Ga0081538_10017285 | Ga0081538_100172854 | 110 |
| 100 | 3300005981 | Ga0081538_10028702 | Ga0081538_100287024 | 110 |
| 101 | 3300006177 | Ga0075362_10392720 | Ga0075362_103927202 | 110 |
| 102 | 3300006846 | Ga0075430_100065222 | Ga0075430_1000652223 | 110 |
| 103 | 3300006931 | Ga0097620_100874380 | Ga0097620_1008743802 | 110 |
| 104 | 3300025928 | Ga0207700_10650213 | Ga0207700_106502131 | 110 |
| 105 | 3300028794 | Ga0307515_10010929 | Ga0307515_100109294 | 110 |
| 106 | 3300031456 | Ga0307513_10009552 | Ga0307513_100095529 | 110 |
| 107 | 3300031456 | Ga0307513_10262634 | Ga0307513_102626342 | 110 |
| 108 | 3300031730 | Ga0307516_10028507 | Ga0307516_100285076 | 110 |
| 109 | 3300041451 | Ga0451791_0730496 | Ga0451791_0730496_263_613 | 110 |
| 110 | 3300041491 | Ga0451833_0831283 | Ga0451833_0831283_331_681 | 110 |
| 111 | 3300041492 | Ga0451835_0713824 | Ga0451835_0713824_13_363 | 110 |
| 112 | 3300041512 | Ga0451853_3356586 | Ga0451853_3356586_67_417 | 110 |
| 113 | 3300046512 | Ga0495610_0066437 | Ga0495610_0066437_544_894 | 110 |
| 114 | 3300046519 | Ga0495632_0030686 | Ga0495632_0030686_502_852 | 110 |
| 115 | 3300046660 | Ga0495625_0001726 | Ga0495625_0001726_12835_13185 | 110 |
| 116 | 3300047472 | Ga0495686_0113101 | Ga0495686_0113101_664_1014 | 110 |
| 117 | 3300050493 | nmdc:mga0k408_607750_c1 | nmdc:mga0k408_607750_c1_215_565 | 110 |
| 118 | 3300053134 | Ga0500658_0061688 | Ga0500658_0061688_455_805 | 110 |
| 119 | 3300053739 | Ga0500587_047608 | Ga0500587_047608_174_524 | 110 |
| 120 | 3300003578 | Ga0006562J51391_1136862 | Ga0006562J51391_11368621 | 111 |
| 121 | 3300005468 | Ga0070707_100089840 | Ga0070707_1000898402 | 111 |
| 122 | 3300005471 | Ga0070698_100146996 | Ga0070698_1001469963 | 111 |
| 123 | 3300005518 | Ga0070699_100880049 | Ga0070699_1008800491 | 111 |
| 124 | 3300005549 | Ga0070704_100544529 | Ga0070704_1005445292 | 111 |
| 125 | 3300005842 | Ga0068858_100769663 | Ga0068858_1007696632 | 111 |
| 126 | 3300006038 | Ga0075365_10846714 | Ga0075365_108467141 | 111 |
| 127 | 3300009148 | Ga0105243_10410618 | Ga0105243_104106181 | 111 |
| 128 | 3300011119 | Ga0105246_10763302 | Ga0105246_107633022 | 111 |
| 129 | 3300013250 | Ga0171462_1029 | Ga0171462_102918 | 111 |
| 130 | 3300025292 | Ga0209676_1038884 | Ga0209676_10388842 | 111 |
| 131 | 3300025910 | Ga0207684_11686289 | Ga0207684_116862892 | 111 |
| 132 | 3300025922 | Ga0207646_10201130 | Ga0207646_102011303 | 111 |
| 133 | 3300025935 | Ga0207709_10577565 | Ga0207709_105775651 | 111 |
| 134 | 3300026095 | Ga0207676_10256155 | Ga0207676_102561551 | 111 |
| 135 | 3300028794 | Ga0307515_10116703 | Ga0307515_101167034 | 111 |
| 136 | 3300032004 | Ga0307414_10215147 | Ga0307414_102151472 | 111 |
| 137 | 3300032004 | Ga0307414_10604510 | Ga0307414_106045101 | 111 |
| 138 | 3300039145 | Ga0237816_04283 | Ga0237816_04283_27_374 | 111 |
| 139 | 3300045976 | Ga0466967_1788938 | Ga0466967_1788938_216_551 | 111 |
| 140 | 3300048925 | Ga0496122_0049207 | Ga0496122_0049207_1532_1879 | 111 |
| 141 | 3300048926 | Ga0496123_0165268 | Ga0496123_0165268_223_570 | 111 |
| 142 | 3300048929 | Ga0496126_0032030 | Ga0496126_0032030_1955_2302 | 111 |
| 143 | 3300049572 | Ga0501036_0795247 | Ga0501036_0795247_207_584 | 111 |
| 144 | 3300050492 | nmdc:mga0yw44_383302_c1 | nmdc:mga0yw44_383302_c1_41_388 | 111 |
| 145 | 3300050516 | nmdc:mga0sz30_117996_c2 | nmdc:mga0sz30_117996_c2_182_529 | 111 |
| 146 | 3300050516 | nmdc:mga0sz30_131849_c1 | nmdc:mga0sz30_131849_c1_90_437 | 111 |
| 147 | 3300053088 | Ga0500644_0012095 | Ga0500644_0012095_1554_1955 | 111 |
| 148 | 3300053108 | Ga0500562_012525 | Ga0500562_012525_531_932 | 111 |
| 149 | 3300003775 | Ga0055524_1000251 | Ga0055524_100025134 | 112 |
| 150 | 3300003784 | Ga0055534_1048317 | Ga0055534_10483171 | 112 |
| 151 | 3300005331 | Ga0070670_101250460 | Ga0070670_1012504601 | 112 |
| 152 | 3300005338 | Ga0068868_100338521 | Ga0068868_1003385212 | 112 |
| 153 | 3300005339 | Ga0070660_100801231 | Ga0070660_1008012312 | 112 |
| 154 | 3300005345 | Ga0070692_10244844 | Ga0070692_102448442 | 112 |
| 155 | 3300005345 | Ga0070692_10264340 | Ga0070692_102643402 | 112 |
| 156 | 3300005356 | Ga0070674_100543089 | Ga0070674_1005430892 | 112 |
| 157 | 3300005364 | Ga0070673_101342522 | Ga0070673_1013425221 | 112 |
| 158 | 3300005365 | Ga0070688_100202916 | Ga0070688_1002029162 | 112 |
| 159 | 3300005438 | Ga0070701_10023734 | Ga0070701_100237342 | 112 |
| 160 | 3300005440 | Ga0070705_100367374 | Ga0070705_1003673742 | 112 |
| 161 | 3300005440 | Ga0070705_100460605 | Ga0070705_1004606052 | 112 |
| 162 | 3300005441 | Ga0070700_100000003 | Ga0070700_10000000316 | 112 |
| 163 | 3300005444 | Ga0070694_100190734 | Ga0070694_1001907341 | 112 |
| 164 | 3300005455 | Ga0070663_100571594 | Ga0070663_1005715942 | 112 |
| 165 | 3300005455 | Ga0070663_100719201 | Ga0070663_1007192012 | 112 |
| 166 | 3300005456 | Ga0070678_100773853 | Ga0070678_1007738532 | 112 |
| 167 | 3300005457 | Ga0070662_100113697 | Ga0070662_1001136971 | 112 |
| 168 | 3300005457 | Ga0070662_101512147 | Ga0070662_1015121471 | 112 |
| 169 | 3300005459 | Ga0068867_100060729 | Ga0068867_1000607292 | 112 |
| 170 | 3300005459 | Ga0068867_100951345 | Ga0068867_1009513451 | 112 |
| 171 | 3300005468 | Ga0070707_100002617 | Ga0070707_10000261715 | 112 |
| 172 | 3300005468 | Ga0070707_100181519 | Ga0070707_1001815193 | 112 |
| 173 | 3300005471 | Ga0070698_100698146 | Ga0070698_1006981462 | 112 |
| 174 | 3300005518 | Ga0070699_101203285 | Ga0070699_1012032852 | 112 |
| 175 | 3300005536 | Ga0070697_100222502 | Ga0070697_1002225021 | 112 |
| 176 | 3300005539 | Ga0068853_100814963 | Ga0068853_1008149632 | 112 |
| 177 | 3300005543 | Ga0070672_100145565 | Ga0070672_1001455652 | 112 |
| 178 | 3300005543 | Ga0070672_100180286 | Ga0070672_1001802862 | 112 |
| 179 | 3300005545 | Ga0070695_100412967 | Ga0070695_1004129671 | 112 |
| 180 | 3300005546 | Ga0070696_100040043 | Ga0070696_1000400432 | 112 |
| 181 | 3300005548 | Ga0070665_101260463 | Ga0070665_1012604632 | 112 |
| 182 | 3300005549 | Ga0070704_100191226 | Ga0070704_1001912262 | 112 |
| 183 | 3300005563 | Ga0068855_100763609 | Ga0068855_1007636092 | 112 |
| 184 | 3300005577 | Ga0068857_100008928 | Ga0068857_1000089285 | 112 |
| 185 | 3300005617 | Ga0068859_100212086 | Ga0068859_1002120863 | 112 |
| 186 | 3300005618 | Ga0068864_100586313 | Ga0068864_1005863132 | 112 |
| 187 | 3300005719 | Ga0068861_100157124 | Ga0068861_1001571243 | 112 |
| 188 | 3300005840 | Ga0068870_10009964 | Ga0068870_100099643 | 112 |
| 189 | 3300005841 | Ga0068863_100178250 | Ga0068863_1001782501 | 112 |
| 190 | 3300005843 | Ga0068860_100537735 | Ga0068860_1005377353 | 112 |
| 191 | 3300005844 | Ga0068862_100001624 | Ga0068862_1000016248 | 112 |
| 192 | 3300005844 | Ga0068862_100095847 | Ga0068862_1000958472 | 112 |
| 193 | 3300006844 | Ga0075428_101145915 | Ga0075428_1011459152 | 112 |
| 194 | 3300006846 | Ga0075430_100635849 | Ga0075430_1006358492 | 112 |
| 195 | 3300006880 | Ga0075429_100173056 | Ga0075429_1001730561 | 112 |
| 196 | 3300006931 | Ga0097620_100212096 | Ga0097620_1002120963 | 112 |
| 197 | 3300009093 | Ga0105240_10014731 | Ga0105240_100147319 | 112 |
| 198 | 3300009094 | Ga0111539_10621246 | Ga0111539_106212462 | 112 |
| 199 | 3300009098 | Ga0105245_10086216 | Ga0105245_100862162 | 112 |
| 200 | 3300009101 | Ga0105247_10117647 | Ga0105247_101176472 | 112 |
| 201 | 3300009148 | Ga0105243_11264286 | Ga0105243_112642862 | 112 |
| 202 | 3300009176 | Ga0105242_12239422 | Ga0105242_122394222 | 112 |
| 203 | 3300009545 | Ga0105237_10000523 | Ga0105237_1000052322 | 112 |
| 204 | 3300009551 | Ga0105238_10003906 | Ga0105238_100039062 | 112 |
| 205 | 3300009553 | Ga0105249_10003530 | Ga0105249_100035302 | 112 |
| 206 | 3300009553 | Ga0105249_10312034 | Ga0105249_103120342 | 112 |
| 207 | 3300009553 | Ga0105249_10403408 | Ga0105249_104034083 | 112 |
| 208 | 3300010375 | Ga0105239_10007336 | Ga0105239_100073366 | 112 |
| 209 | 3300010375 | Ga0105239_11391132 | Ga0105239_113911321 | 112 |
| 210 | 3300010375 | Ga0105239_11595400 | Ga0105239_115954002 | 112 |
| 211 | 3300013296 | Ga0157374_11935603 | Ga0157374_119356031 | 112 |
| 212 | 3300013306 | Ga0163162_10835783 | Ga0163162_108357832 | 112 |
| 213 | 3300013308 | Ga0157375_10017895 | Ga0157375_100178953 | 112 |
| 214 | 3300014325 | Ga0163163_10050812 | Ga0163163_100508123 | 112 |
| 215 | 3300014326 | Ga0157380_10348335 | Ga0157380_103483352 | 112 |
| 216 | 3300014968 | Ga0157379_10632819 | Ga0157379_106328192 | 112 |
| 217 | 3300014969 | Ga0157376_11019441 | Ga0157376_110194412 | 112 |
| 218 | 3300017792 | Ga0163161_10267783 | Ga0163161_102677832 | 112 |
| 219 | 3300025273 | Ga0209673_1093374 | Ga0209673_10933742 | 112 |
| 220 | 3300025291 | Ga0209675_1006177 | Ga0209675_10061772 | 112 |
| 221 | 3300025295 | Ga0209564_1000052 | Ga0209564_1000052186 | 112 |
| 222 | 3300025299 | Ga0209256_1000099 | Ga0209256_100009935 | 112 |
| 223 | 3300025900 | Ga0207710_10265343 | Ga0207710_102653432 | 112 |
| 224 | 3300025907 | Ga0207645_10256247 | Ga0207645_102562471 | 112 |
| 225 | 3300025908 | Ga0207643_10049633 | Ga0207643_100496331 | 112 |
| 226 | 3300025910 | Ga0207684_10002304 | Ga0207684_100023044 | 112 |
| 227 | 3300025913 | Ga0207695_10046160 | Ga0207695_100461604 | 112 |
| 228 | 3300025914 | Ga0207671_10004041 | Ga0207671_100040417 | 112 |
| 229 | 3300025917 | Ga0207660_10541251 | Ga0207660_105412511 | 112 |
| 230 | 3300025918 | Ga0207662_10967020 | Ga0207662_109670201 | 112 |
| 231 | 3300025922 | Ga0207646_10011244 | Ga0207646_1001124410 | 112 |
| 232 | 3300025922 | Ga0207646_10185546 | Ga0207646_101855462 | 112 |
| 233 | 3300025923 | Ga0207681_10001082 | Ga0207681_100010829 | 112 |
| 234 | 3300025923 | Ga0207681_11829566 | Ga0207681_118295662 | 112 |
| 235 | 3300025924 | Ga0207694_10377895 | Ga0207694_103778952 | 112 |
| 236 | 3300025927 | Ga0207687_10157574 | Ga0207687_101575742 | 112 |
| 237 | 3300025932 | Ga0207690_10692912 | Ga0207690_106929122 | 112 |
| 238 | 3300025933 | Ga0207706_10027919 | Ga0207706_100279193 | 112 |
| 239 | 3300025937 | Ga0207669_10734620 | Ga0207669_107346201 | 112 |
| 240 | 3300025940 | Ga0207691_10172309 | Ga0207691_101723091 | 112 |
| 241 | 3300025949 | Ga0207667_10085907 | Ga0207667_100859072 | 112 |
| 242 | 3300025960 | Ga0207651_11484942 | Ga0207651_114849421 | 112 |
| 243 | 3300025961 | Ga0207712_10002684 | Ga0207712_100026846 | 112 |
| 244 | 3300025961 | Ga0207712_10134892 | Ga0207712_101348924 | 112 |
| 245 | 3300025961 | Ga0207712_10226906 | Ga0207712_102269063 | 112 |
| 246 | 3300025972 | Ga0207668_10011208 | Ga0207668_100112083 | 112 |
| 247 | 3300026023 | Ga0207677_10336714 | Ga0207677_103367143 | 112 |
| 248 | 3300026041 | Ga0207639_11391690 | Ga0207639_113916902 | 112 |
| 249 | 3300026067 | Ga0207678_10460865 | Ga0207678_104608652 | 112 |
| 250 | 3300026075 | Ga0207708_10000002 | Ga0207708_10000002156 | 112 |
| 251 | 3300026075 | Ga0207708_10526320 | Ga0207708_105263202 | 112 |
| 252 | 3300026088 | Ga0207641_10340728 | Ga0207641_103407281 | 112 |
| 253 | 3300026089 | Ga0207648_10097107 | Ga0207648_100971072 | 112 |
| 254 | 3300026089 | Ga0207648_10788173 | Ga0207648_107881732 | 112 |
| 255 | 3300026095 | Ga0207676_10507478 | Ga0207676_105074781 | 112 |
| 256 | 3300026116 | Ga0207674_10016870 | Ga0207674_100168703 | 112 |
| 257 | 3300026118 | Ga0207675_100137015 | Ga0207675_1001370152 | 112 |
| 258 | 3300026121 | Ga0207683_10068153 | Ga0207683_100681533 | 112 |
| 259 | 3300026121 | Ga0207683_10505902 | Ga0207683_105059021 | 112 |
| 260 | 3300026142 | Ga0207698_10771154 | Ga0207698_107711541 | 112 |
| 261 | 3300026142 | Ga0207698_11395110 | Ga0207698_113951102 | 112 |
| 262 | 3300027876 | Ga0209974_10025424 | Ga0209974_100254242 | 112 |
| 263 | 3300027876 | Ga0209974_10095785 | Ga0209974_100957852 | 112 |
| 264 | 3300027876 | Ga0209974_10272912 | Ga0209974_102729122 | 112 |
| 265 | 3300027907 | Ga0207428_10431291 | Ga0207428_104312912 | 112 |
| 266 | 3300028380 | Ga0268265_10015988 | Ga0268265_100159883 | 112 |
| 267 | 3300028380 | Ga0268265_10108314 | Ga0268265_101083144 | 112 |
| 268 | 3300028381 | Ga0268264_10353647 | Ga0268264_103536473 | 112 |
| 269 | 3300031250 | Ga0265331_10573949 | Ga0265331_105739492 | 112 |
| 270 | 3300031548 | Ga0307408_100957549 | Ga0307408_1009575491 | 112 |
| 271 | 3300031731 | Ga0307405_11855033 | Ga0307405_118550332 | 112 |
| 272 | 3300032005 | Ga0307411_12210205 | Ga0307411_122102051 | 112 |
| 273 | 3300032126 | Ga0307415_101270190 | Ga0307415_1012701901 | 112 |
| 274 | 3300032126 | Ga0307415_102004711 | Ga0307415_1020047111 | 112 |
| 275 | 3300041411 | Ga0439466_0112035 | Ga0439466_0112035_339_716 | 112 |
| 276 | 3300041413 | Ga0439465_0285535 | Ga0439465_0285535_209_586 | 112 |
| 277 | 3300041452 | Ga0451793_0055040 | Ga0451793_0055040_143_529 | 112 |
| 278 | 3300041460 | Ga0451802_1961840 | Ga0451802_1961840_303_689 | 112 |
| 279 | 3300041512 | Ga0451853_0708726 | Ga0451853_0708726_306_692 | 112 |
| 280 | 3300041997 | Ga0439431_0153847 | Ga0439431_0153847_85_462 | 112 |
| 281 | 3300042125 | Ga0450923_126994 | Ga0450923_126994_74_451 | 112 |
| 282 | 3300046473 | Ga0495582_0817212 | Ga0495582_0817212_37_387 | 112 |
| 283 | 3300046615 | Ga0495656_0784222 | Ga0495656_0784222_47_433 | 112 |
| 284 | 3300048904 | Ga0496101_1408177 | Ga0496101_1408177_133_519 | 112 |
| 285 | 3300048911 | Ga0496108_0148804 | Ga0496108_0148804_1593_1979 | 112 |
| 286 | 3300048912 | Ga0496109_1951428 | Ga0496109_1951428_17_403 | 112 |
| 287 | 3300048915 | Ga0496112_0712550 | Ga0496112_0712550_213_599 | 112 |
| 288 | 3300048917 | Ga0496114_0146134 | Ga0496114_0146134_1149_1535 | 112 |
| 289 | 3300049522 | Ga0501299_102000 | Ga0501299_102000_33_386 | 112 |
| 290 | 3300049570 | Ga0501033_1155912 | Ga0501033_1155912_108_488 | 112 |
| 291 | 3300049571 | Ga0501034_0136659 | Ga0501034_0136659_706_1059 | 112 |
| 292 | 3300049591 | Ga0501075_0183613 | Ga0501075_0183613_38_424 | 112 |
| 293 | 3300049592 | Ga0501076_1582460 | Ga0501076_1582460_35_421 | 112 |
| 294 | 3300049652 | Ga0501202_096701 | Ga0501202_096701_321_671 | 112 |
| 295 | 3300049661 | Ga0501217_105795 | Ga0501217_105795_48_398 | 112 |
| 296 | 3300049680 | Ga0501250_109022 | Ga0501250_109022_116_466 | 112 |
| 297 | 3300049779 | Ga0501283_015198 | Ga0501283_015198_792_1142 | 112 |
| 298 | 3300050492 | nmdc:mga0yw44_592336_c1 | nmdc:mga0yw44_592336_c1_184_534 | 112 |
| 299 | 3300050510 | nmdc:mga06r32_1864395_c1 | nmdc:mga06r32_1864395_c1_166_516 | 112 |
| 300 | 3300050511 | nmdc:mga08y16_765383_c1 | nmdc:mga08y16_765383_c1_128_478 | 112 |
| 301 | 3300054114 | Ga0501084_0275722 | Ga0501084_0275722_21_392 | 112 |
| 302 | 3300006048 | Ga0075363_100078432 | Ga0075363_1000784322 | 113 |
| 303 | 3300006051 | Ga0075364_10039235 | Ga0075364_100392352 | 113 |
| 304 | 3300006177 | Ga0075362_10002166 | Ga0075362_100021669 | 113 |
| 305 | 3300006178 | Ga0075367_10001770 | Ga0075367_100017709 | 113 |
| 306 | 3300006186 | Ga0075369_10045986 | Ga0075369_100459862 | 113 |
| 307 | 3300006195 | Ga0075366_10030141 | Ga0075366_100301416 | 113 |
| 308 | 3300006195 | Ga0075366_10384340 | Ga0075366_103843402 | 113 |
| 309 | 3300006353 | Ga0075370_10001219 | Ga0075370_1000121914 | 113 |
| 310 | 3300006931 | Ga0097620_101317300 | Ga0097620_1013173002 | 113 |
| 311 | 3300028381 | Ga0268264_10140319 | Ga0268264_101403192 | 113 |
| 312 | 3300031730 | Ga0307516_10021238 | Ga0307516_100212389 | 113 |
| 313 | 3300031730 | Ga0307516_10571681 | Ga0307516_105716812 | 113 |
| 314 | 3300045976 | Ga0466967_2046776 | Ga0466967_2046776_20_361 | 113 |
| 315 | 3300049575 | Ga0501039_0374902 | Ga0501039_0374902_326_709 | 113 |
| 316 | 3300049582 | Ga0501048_0421285 | Ga0501048_0421285_66_449 | 113 |
| 317 | 3300049584 | Ga0501068_0219068 | Ga0501068_0219068_12_395 | 113 |
| 318 | 3300049587 | Ga0501071_1084040 | Ga0501071_1084040_127_510 | 113 |
| 319 | 3300049590 | Ga0501074_1127288 | Ga0501074_1127288_67_450 | 113 |
| 320 | 3300049591 | Ga0501075_0605318 | Ga0501075_0605318_371_754 | 113 |
| 321 | 3300049592 | Ga0501076_0213491 | Ga0501076_0213491_220_603 | 113 |
| 322 | 3300049743 | Ga0501081_1308560 | Ga0501081_1308560_107_487 | 113 |
| 323 | 3300049824 | Ga0501045_0032770 | Ga0501045_0032770_1350_1733 | 113 |
| 324 | 3300050489 | nmdc:mga03683_9518_c1 | nmdc:mga03683_9518_c1_1761_2129 | 113 |
| 325 | 3300050490 | nmdc:mga03n38_225731_c1 | nmdc:mga03n38_225731_c1_442_810 | 113 |
| 326 | 3300050491 | nmdc:mga00v17_15325_c1 | nmdc:mga00v17_15325_c1_171_539 | 113 |
| 327 | 3300050493 | nmdc:mga0k408_130378_c1 | nmdc:mga0k408_130378_c1_856_1221 | 113 |
| 328 | 3300050493 | nmdc:mga0k408_25759_c1 | nmdc:mga0k408_25759_c1_1205_1573 | 113 |
| 329 | 3300050494 | nmdc:mga06z11_9515_c1 | nmdc:mga06z11_9515_c1_171_539 | 113 |
| 330 | 3300050496 | nmdc:mga07m45_106124_c1 | nmdc:mga07m45_106124_c1_1205_1573 | 113 |
| 331 | 3300050516 | nmdc:mga0sz30_6208_c1 | nmdc:mga0sz30_6208_c1_2559_2927 | 113 |
| 332 | 3300053117 | Ga0500593_001868 | Ga0500593_001868_6098_6487 | 113 |
| 333 | 3300054114 | Ga0501084_0154964 | Ga0501084_0154964_1230_1613 | 113 |
| 334 | 3300005434 | Ga0070709_10141216 | Ga0070709_101412162 | 114 |
| 335 | 3300005435 | Ga0070714_100009814 | Ga0070714_1000098144 | 114 |
| 336 | 3300005436 | Ga0070713_100769209 | Ga0070713_1007692092 | 114 |
| 337 | 3300005437 | Ga0070710_10010663 | Ga0070710_100106634 | 114 |
| 338 | 3300005439 | Ga0070711_100126338 | Ga0070711_1001263383 | 114 |
| 339 | 3300006028 | Ga0070717_10161546 | Ga0070717_101615461 | 114 |
| 340 | 3300006175 | Ga0070712_100189071 | Ga0070712_1001890713 | 114 |
| 341 | 3300006880 | Ga0075429_100470611 | Ga0075429_1004706112 | 114 |
| 342 | 3300014969 | Ga0157376_11470076 | Ga0157376_114700762 | 114 |
| 343 | 3300025898 | Ga0207692_10204305 | Ga0207692_102043051 | 114 |
| 344 | 3300025906 | Ga0207699_10131581 | Ga0207699_101315813 | 114 |
| 345 | 3300025915 | Ga0207693_10149512 | Ga0207693_101495123 | 114 |
| 346 | 3300025916 | Ga0207663_10065192 | Ga0207663_100651924 | 114 |
| 347 | 3300025928 | Ga0207700_10619927 | Ga0207700_106199271 | 114 |
| 348 | 3300025929 | Ga0207664_10107446 | Ga0207664_101074464 | 114 |
| 349 | 3300028573 | Ga0265334_10023452 | Ga0265334_100234521 | 114 |
| 350 | 3300044656 | Ga0466969_0112142 | Ga0466969_0112142_165_530 | 114 |
| 351 | 3300044683 | Ga0466965_0039416 | Ga0466965_0039416_86_451 | 114 |
| 352 | 3300044684 | Ga0466966_0008856 | Ga0466966_0008856_1801_2166 | 114 |
| 353 | 3300044684 | Ga0466966_0226949 | Ga0466966_0226949_555_899 | 114 |
| 354 | 3300044693 | Ga0466961_0033686 | Ga0466961_0033686_567_932 | 114 |
| 355 | 3300044706 | Ga0466964_0583870 | Ga0466964_0583870_44_388 | 114 |
| 356 | 3300044765 | Ga0466970_0011348 | Ga0466970_0011348_2809_3174 | 114 |
| 357 | 3300044765 | Ga0466970_0037211 | Ga0466970_0037211_476_820 | 114 |
| 358 | 3300044842 | Ga0466957_0077177 | Ga0466957_0077177_333_698 | 114 |
| 359 | 3300044901 | Ga0466960_0115408 | Ga0466960_0115408_816_1160 | 114 |
| 360 | 3300044901 | Ga0466960_0138226 | Ga0466960_0138226_399_743 | 114 |
| 361 | 3300045836 | Ga0466958_0417123 | Ga0466958_0417123_285_650 | 114 |
| 362 | 3300045976 | Ga0466967_0308261 | Ga0466967_0308261_1058_1423 | 114 |
| 363 | 3300045976 | Ga0466967_0650535 | Ga0466967_0650535_51_419 | 114 |
| 364 | 3300045976 | Ga0466967_1010354 | Ga0466967_1010354_415_765 | 114 |
| 365 | 3300049568 | Ga0501031_0176337 | Ga0501031_0176337_165_509 | 114 |
| 366 | 3300049569 | Ga0501032_0232780 | Ga0501032_0232780_91_435 | 114 |
| 367 | 3300049572 | Ga0501036_0135072 | Ga0501036_0135072_1527_1871 | 114 |
| 368 | 3300049573 | Ga0501037_0235573 | Ga0501037_0235573_96_440 | 114 |
| 369 | 3300049575 | Ga0501039_0089674 | Ga0501039_0089674_154_498 | 114 |
| 370 | 3300049576 | Ga0501040_0028166 | Ga0501040_0028166_3019_3363 | 114 |
| 371 | 3300049577 | Ga0501041_0057856 | Ga0501041_0057856_1089_1433 | 114 |
| 372 | 3300049578 | Ga0501042_0237350 | Ga0501042_0237350_901_1245 | 114 |
| 373 | 3300049580 | Ga0501046_1268308 | Ga0501046_1268308_84_428 | 114 |
| 374 | 3300049582 | Ga0501048_0079673 | Ga0501048_0079673_1907_2251 | 114 |
| 375 | 3300049584 | Ga0501068_0256383 | Ga0501068_0256383_564_908 | 114 |
| 376 | 3300049587 | Ga0501071_0181164 | Ga0501071_0181164_164_508 | 114 |
| 377 | 3300049588 | Ga0501072_0104306 | Ga0501072_0104306_57_401 | 114 |
| 378 | 3300049590 | Ga0501074_0141499 | Ga0501074_0141499_34_378 | 114 |
| 379 | 3300049592 | Ga0501076_0196378 | Ga0501076_0196378_1121_1465 | 114 |
| 380 | 3300049593 | Ga0501077_0127680 | Ga0501077_0127680_1251_1595 | 114 |
| 381 | 3300049741 | Ga0501079_0014179 | Ga0501079_0014179_5524_5868 | 114 |
| 382 | 3300049742 | Ga0501080_0020074 | Ga0501080_0020074_3994_4338 | 114 |
| 383 | 3300049743 | Ga0501081_0137891 | Ga0501081_0137891_751_1095 | 114 |
| 384 | 3300049822 | Ga0501035_1074265 | Ga0501035_1074265_244_588 | 114 |
| 385 | 3300049823 | Ga0501044_0399000 | Ga0501044_0399000_70_414 | 114 |
| 386 | 3300049824 | Ga0501045_0042712 | Ga0501045_0042712_1698_2042 | 114 |
| 387 | 3300054114 | Ga0501084_0249831 | Ga0501084_0249831_141_485 | 114 |
| 388 | 3300060353 | Ga0501082_0041030 | Ga0501082_0041030_2663_3007 | 114 |
| 389 | 3300061719 | Ga0466962_0019793 | Ga0466962_0019793_164_529 | 114 |
| 390 | 3300061734 | Ga0530510_0146314 | Ga0530510_0146314_1269_1613 | 114 |
| 391 | 3300003320 | rootH2_10020274 | rootH2_100202746 | 115 |
| 392 | 3300003320 | rootH2_10087120 | rootH2_100871203 | 115 |
| 393 | 3300005337 | Ga0070682_101267448 | Ga0070682_1012674481 | 115 |
| 394 | 3300005337 | Ga0070682_101594457 | Ga0070682_1015944572 | 115 |
| 395 | 3300005338 | Ga0068868_102084602 | Ga0068868_1020846021 | 115 |
| 396 | 3300005339 | Ga0070660_100727153 | Ga0070660_1007271532 | 115 |
| 397 | 3300005347 | Ga0070668_101950299 | Ga0070668_1019502991 | 115 |
| 398 | 3300005434 | Ga0070709_10867400 | Ga0070709_108674002 | 115 |
| 399 | 3300005435 | Ga0070714_100650491 | Ga0070714_1006504911 | 115 |
| 400 | 3300005438 | Ga0070701_11156279 | Ga0070701_111562791 | 115 |
| 401 | 3300005530 | Ga0070679_100022892 | Ga0070679_1000228927 | 115 |
| 402 | 3300005547 | Ga0070693_100762685 | Ga0070693_1007626852 | 115 |
| 403 | 3300005614 | Ga0068856_100085538 | Ga0068856_1000855384 | 115 |
| 404 | 3300005616 | Ga0068852_102373049 | Ga0068852_1023730491 | 115 |
| 405 | 3300005718 | Ga0068866_10378436 | Ga0068866_103784362 | 115 |
| 406 | 3300009098 | Ga0105245_11023893 | Ga0105245_110238931 | 115 |
| 407 | 3300009148 | Ga0105243_10910174 | Ga0105243_109101741 | 115 |
| 408 | 3300009174 | Ga0105241_10783968 | Ga0105241_107839682 | 115 |
| 409 | 3300009177 | Ga0105248_12760778 | Ga0105248_127607782 | 115 |
| 410 | 3300009551 | Ga0105238_11441909 | Ga0105238_114419092 | 115 |
| 411 | 3300013105 | Ga0157369_10030265 | Ga0157369_100302658 | 115 |
| 412 | 3300013105 | Ga0157369_10230226 | Ga0157369_102302262 | 115 |
| 413 | 3300013105 | Ga0157369_12081416 | Ga0157369_120814161 | 115 |
| 414 | 3300013307 | Ga0157372_10049615 | Ga0157372_100496151 | 115 |
| 415 | 3300014326 | Ga0157380_11519837 | Ga0157380_115198371 | 115 |
| 416 | 3300020069 | Ga0197907_10991673 | Ga0197907_109916732 | 115 |
| 417 | 3300020070 | Ga0206356_11870219 | Ga0206356_118702192 | 115 |
| 418 | 3300020081 | Ga0206354_10011937 | Ga0206354_100119372 | 115 |
| 419 | 3300020082 | Ga0206353_11278172 | Ga0206353_112781724 | 115 |
| 420 | 3300025906 | Ga0207699_10671945 | Ga0207699_106719452 | 115 |
| 421 | 3300025921 | Ga0207652_10157931 | Ga0207652_101579313 | 115 |
| 422 | 3300025929 | Ga0207664_10386012 | Ga0207664_103860122 | 115 |
| 423 | 3300025944 | Ga0207661_10161549 | Ga0207661_101615492 | 115 |
| 424 | 3300025961 | Ga0207712_11203576 | Ga0207712_112035761 | 115 |
| 425 | 3300026078 | Ga0207702_10186879 | Ga0207702_101868791 | 115 |
| 426 | 3300031344 | Ga0265316_10957208 | Ga0265316_109572082 | 115 |
| 427 | 3300031731 | Ga0307405_10166588 | Ga0307405_101665882 | 115 |
| 428 | 3300031824 | Ga0307413_11160670 | Ga0307413_111606701 | 115 |
| 429 | 3300031852 | Ga0307410_10422311 | Ga0307410_104223112 | 115 |
| 430 | 3300031852 | Ga0307410_11555962 | Ga0307410_115559622 | 115 |
| 431 | 3300031889 | Ga0326468_10057957 | Ga0326468_100579571 | 115 |
| 432 | 3300031901 | Ga0307406_11084595 | Ga0307406_110845952 | 115 |
| 433 | 3300031903 | Ga0307407_11007017 | Ga0307407_110070172 | 115 |
| 434 | 3300031911 | Ga0307412_10809714 | Ga0307412_108097142 | 115 |
| 435 | 3300031995 | Ga0307409_100172794 | Ga0307409_1001727941 | 115 |
| 436 | 3300031995 | Ga0307409_100365739 | Ga0307409_1003657393 | 115 |
| 437 | 3300031995 | Ga0307409_101616491 | Ga0307409_1016164912 | 115 |
| 438 | 3300031995 | Ga0307409_102436463 | Ga0307409_1024364631 | 115 |
| 439 | 3300032002 | Ga0307416_103182637 | Ga0307416_1031826371 | 115 |
| 440 | 3300032004 | Ga0307414_11248052 | Ga0307414_112480522 | 115 |
| 441 | 3300032005 | Ga0307411_10786304 | Ga0307411_107863042 | 115 |
| 442 | 3300032005 | Ga0307411_11677736 | Ga0307411_116777362 | 115 |
| 443 | 3300032126 | Ga0307415_100086024 | Ga0307415_1000860242 | 115 |
| 444 | 3300032126 | Ga0307415_100731166 | Ga0307415_1007311662 | 115 |
| 445 | 3300032126 | Ga0307415_101249187 | Ga0307415_1012491872 | 115 |
| 446 | 3300037418 | Ga0395900_0135473 | Ga0395900_0135473_2003_2365 | 115 |
| 447 | 3300037418 | Ga0395900_0162434 | Ga0395900_0162434_1786_2133 | 115 |
| 448 | 3300037418 | Ga0395900_0577204 | Ga0395900_0577204_348_707 | 115 |
| 449 | 3300037466 | Ga0395898_0133625 | Ga0395898_0133625_1107_1454 | 115 |
| 450 | 3300037466 | Ga0395898_1266628 | Ga0395898_1266628_140_502 | 115 |
| 451 | 3300038443 | Ga0395901_0114429 | Ga0395901_0114429_1411_1758 | 115 |
| 452 | 3300044656 | Ga0466969_0391306 | Ga0466969_0391306_42_389 | 115 |
| 453 | 3300044683 | Ga0466965_0218974 | Ga0466965_0218974_122_469 | 115 |
| 454 | 3300044683 | Ga0466965_0305182 | Ga0466965_0305182_364_711 | 115 |
| 455 | 3300044683 | Ga0466965_0764441 | Ga0466965_0764441_33_392 | 115 |
| 456 | 3300044683 | Ga0466965_0926587 | Ga0466965_0926587_25_372 | 115 |
| 457 | 3300044684 | Ga0466966_0109186 | Ga0466966_0109186_637_984 | 115 |
| 458 | 3300044684 | Ga0466966_0110494 | Ga0466966_0110494_983_1330 | 115 |
| 459 | 3300044684 | Ga0466966_0196254 | Ga0466966_0196254_660_1007 | 115 |
| 460 | 3300044693 | Ga0466961_0092211 | Ga0466961_0092211_1323_1670 | 115 |
| 461 | 3300044693 | Ga0466961_0332836 | Ga0466961_0332836_257_604 | 115 |
| 462 | 3300044693 | Ga0466961_0603622 | Ga0466961_0603622_170_541 | 115 |
| 463 | 3300044693 | Ga0466961_0709409 | Ga0466961_0709409_49_396 | 115 |
| 464 | 3300044694 | Ga0466963_0027914 | Ga0466963_0027914_2847_3194 | 115 |
| 465 | 3300044694 | Ga0466963_0250685 | Ga0466963_0250685_157_516 | 115 |
| 466 | 3300044694 | Ga0466963_0630538 | Ga0466963_0630538_185_532 | 115 |
| 467 | 3300044706 | Ga0466964_0142124 | Ga0466964_0142124_36_383 | 115 |
| 468 | 3300044719 | Ga0466971_0027718 | Ga0466971_0027718_663_1010 | 115 |
| 469 | 3300044719 | Ga0466971_0284492 | Ga0466971_0284492_296_655 | 115 |
| 470 | 3300044765 | Ga0466970_0319872 | Ga0466970_0319872_199_567 | 115 |
| 471 | 3300044765 | Ga0466970_0326319 | Ga0466970_0326319_312_659 | 115 |
| 472 | 3300044765 | Ga0466970_0415708 | Ga0466970_0415708_168_515 | 115 |
| 473 | 3300044765 | Ga0466970_0653177 | Ga0466970_0653177_35_382 | 115 |
| 474 | 3300044842 | Ga0466957_0018000 | Ga0466957_0018000_1020_1367 | 115 |
| 475 | 3300044842 | Ga0466957_0037376 | Ga0466957_0037376_1239_1586 | 115 |
| 476 | 3300044842 | Ga0466957_0123081 | Ga0466957_0123081_275_622 | 115 |
| 477 | 3300044842 | Ga0466957_0132231 | Ga0466957_0132231_613_972 | 115 |
| 478 | 3300044842 | Ga0466957_0521076 | Ga0466957_0521076_162_539 | 115 |
| 479 | 3300044842 | Ga0466957_1019471 | Ga0466957_1019471_125_472 | 115 |
| 480 | 3300044901 | Ga0466960_0005472 | Ga0466960_0005472_3875_4234 | 115 |
| 481 | 3300044901 | Ga0466960_0121662 | Ga0466960_0121662_844_1191 | 115 |
| 482 | 3300044901 | Ga0466960_0187298 | Ga0466960_0187298_94_441 | 115 |
| 483 | 3300044901 | Ga0466960_0230829 | Ga0466960_0230829_290_643 | 115 |
| 484 | 3300044901 | Ga0466960_0414553 | Ga0466960_0414553_282_629 | 115 |
| 485 | 3300044901 | Ga0466960_0562311 | Ga0466960_0562311_206_553 | 115 |
| 486 | 3300044901 | Ga0466960_0720069 | Ga0466960_0720069_56_415 | 115 |
| 487 | 3300045049 | Ga0466959_0020677 | Ga0466959_0020677_4133_4480 | 115 |
| 488 | 3300045049 | Ga0466959_0096572 | Ga0466959_0096572_582_941 | 115 |
| 489 | 3300045049 | Ga0466959_1051948 | Ga0466959_1051948_43_390 | 115 |
| 490 | 3300045836 | Ga0466958_0087038 | Ga0466958_0087038_1540_1899 | 115 |
| 491 | 3300045836 | Ga0466958_0908241 | Ga0466958_0908241_102_449 | 115 |
| 492 | 3300045976 | Ga0466967_0002638 | Ga0466967_0002638_4598_4945 | 115 |
| 493 | 3300045976 | Ga0466967_0096782 | Ga0466967_0096782_1465_1812 | 115 |
| 494 | 3300045976 | Ga0466967_0113994 | Ga0466967_0113994_1174_1533 | 115 |
| 495 | 3300045976 | Ga0466967_0747803 | Ga0466967_0747803_441_788 | 115 |
| 496 | 3300045976 | Ga0466967_1850291 | Ga0466967_1850291_20_367 | 115 |
| 497 | 3300048905 | Ga0496102_1728901 | Ga0496102_1728901_75_422 | 115 |
| 498 | 3300048910 | Ga0496107_0586943 | Ga0496107_0586943_354_701 | 115 |
| 499 | 3300048911 | Ga0496108_0552250 | Ga0496108_0552250_272_649 | 115 |
| 500 | 3300048913 | Ga0496110_1576685 | Ga0496110_1576685_171_518 | 115 |
| 501 | 3300048914 | Ga0496111_0942886 | Ga0496111_0942886_88_441 | 115 |
| 502 | 3300049583 | Ga0501067_0008625 | Ga0501067_0008625_1544_1891 | 115 |
| 503 | 3300049585 | Ga0501069_0014518 | Ga0501069_0014518_449_796 | 115 |
| 504 | 3300049822 | Ga0501035_0030346 | Ga0501035_0030346_2843_3208 | 115 |
| 505 | 3300049823 | Ga0501044_0390176 | Ga0501044_0390176_525_890 | 115 |
| 506 | 3300061719 | Ga0466962_0067280 | Ga0466962_0067280_719_1066 | 115 |
| 507 | 3300061719 | Ga0466962_0389989 | Ga0466962_0389989_336_683 | 115 |
| 508 | 3300061734 | Ga0530510_0059970 | Ga0530510_0059970_2275_2622 | 115 |
| 509 | 3300061734 | Ga0530510_0174683 | Ga0530510_0174683_1226_1573 | 115 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6j05-assembly1.cif.gz_A | structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression | 0.9375 | 8 | 90 |
| 4kmf-assembly1.cif.gz_A-2 | crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna | 0.9303 | 20 | 77 |
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9238 | 8 | 91 |
| 3f6o-assembly1.cif.gz_B | crystal structure of arsr family transcriptional regulator, rha00566 | 0.9228 | 9 | 96 |
| 7p6f-assembly2.cif.gz_CCC-2 | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9215 | 7 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tgnA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9566 | 19 | 64 | 1.10.10.10 |
| af_P0ACL0_1_57_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9523 | 20 | 66 | 1.10.10.10 |
| af_P0ACK8_1_59_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9515 | 21 | 77 | 1.10.10.10 |
| af_P15082_1_58_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9476 | 20 | 76 | 1.10.10.10 |
| af_K7LWV0_206_275_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9327 | 35 | 64 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5A9ZWG5-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9783 | 10 | 88 |
GO:0003700
|
| AF-D3R293-F1-model_v4 | Transcriptional regulator, ArsR family | 0.9765 | 3 | 90 |
GO:0003700
|
| AF-A0A7C6VFE1-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.9757 | 9 | 93 |
GO:0003700
|
| AF-H1S4V4-F1-model_v4 | ArsR family transcriptional regulator | 0.9749 | 9 | 88 |
GO:0003700
|
| AF-A0A7U5A5Q2-F1-model_v4 | deleted | 0.9743 | 2 | 89 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar