F456889

General Info

Members Datasets Scaffolds Average Seq Length
508 224 1016 272

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_139765_c1|nmdc:mga08x19_139765_c1_516_1460
Length 314
Sequence MLVAGVDVGSTQTKAVVMDERRRVLGRSLIDTGGIVTAAAENAFQLACSDAGAARSEVAYVVGTGYGRYKVTFGDTQVTEISCHARGGQYLFPRTRTVLDIGGQDTKAIKIGPEGQVLDFCMNDKCAAGTGRFLGAAAMALDISLGELGPLALVAKNPVKITTTCTVFAETEIINWLARGKKVEDVLMGVHQAIATRSISLLRRVGVEDELTFTGGVTRNVAMVKILEEMLETHLNVSEEAHYMGAIGASLFALEKAMSGAAGAVEAMTVGARLDSTRAAAGDCEVCPELPDRKFRDAQERLIQVGRMSEVPKR

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
131 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
148 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
149 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
150 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
151 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
152 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
153 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
154 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.98
Rhizosphere 93.9
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_139765_c1 3300050514 Bacteria 1635
2 JGI24748J21848_1000031 3300002074 Bacteria 80371
3 JGI24034J26672_10000005 3300002239 Bacteria 404185
4 JGI24742J22300_10011601 3300002244 Bacteria 1465
5 Ga0065714_10081885 3300005288 Bacteria 2341
6 Ga0065704_10009885 3300005289 Bacteria 2650
7 Ga0065712_10011311 3300005290 Bacteria 2436
8 Ga0065707_10005130 3300005295 Bacteria 2949
9 Ga0065707_10118822 3300005295 Bacteria 2176
10 Ga0065707_10318806 3300005295 Unclassified 970
11 Ga0070683_100001598 3300005329 Bacteria 17527
12 Ga0070683_100186691 3300005329 Bacteria 1968
13 Ga0070690_100334664 3300005330 Bacteria 1095
14 Ga0070680_100050168 3300005336 Bacteria 3403
15 Ga0070660_100042864 3300005339 Bacteria 3456
16 Ga0070689_100076516 3300005340 Bacteria 2622
17 Ga0070661_100131677 3300005344 Bacteria 1879
18 Ga0070669_100034394 3300005353 Bacteria 3669
19 Ga0070675_100025107 3300005354 Bacteria 4775
20 Ga0070671_100040739 3300005355 Bacteria 3859
21 Ga0070671_100095768 3300005355 Bacteria 2488
22 Ga0070673_100024586 3300005364 Bacteria 4420
23 Ga0070659_100190526 3300005366 Bacteria 1685
24 Ga0070703_10000194 3300005406 Bacteria 29559
25 Ga0070709_10003103 3300005434 Bacteria 8917
26 Ga0070709_10069989 3300005434 Bacteria 2261
27 Ga0070714_100001346 3300005435 Bacteria 17769
28 Ga0070714_100008997 3300005435 Bacteria 7821
29 Ga0070713_100000338 3300005436 Bacteria 30431
30 Ga0070713_100010303 3300005436 Bacteria 6748
31 Ga0070711_100480419 3300005439 Bacteria 1021
32 Ga0070705_100080374 3300005440 Bacteria 2000
33 Ga0070705_100166720 3300005440 Bacteria 1478
34 Ga0070694_100090266 3300005444 Bacteria 2148
35 Ga0070708_100582348 3300005445 Bacteria 1055
36 Ga0070663_100309539 3300005455 Bacteria 1267
37 Ga0070681_10081559 3300005458 Bacteria 3190
38 Ga0070681_10131512 3300005458 Bacteria 2435
39 Ga0070706_100000611 3300005467 Bacteria 41308
40 Ga0070706_100038810 3300005467 Bacteria 4395
41 Ga0070706_100046495 3300005467 Bacteria 4006
42 Ga0070707_100127121 3300005468 Bacteria 2477
43 Ga0070698_100028619 3300005471 Bacteria 5786
44 Ga0070699_100141033 3300005518 Bacteria 2128
45 Ga0070699_100315740 3300005518 Bacteria 1404
46 Ga0070679_100009393 3300005530 Bacteria 9250
47 Ga0070679_100009515 3300005530 Bacteria 9191
48 Ga0070684_100000337 3300005535 Bacteria 32508
49 Ga0070684_100077330 3300005535 Bacteria 2939
50 Ga0070684_100230434 3300005535 Bacteria 1691
51 Ga0070697_100020863 3300005536 Bacteria 5187
52 Ga0068853_100041333 3300005539 Bacteria 3937
53 Ga0068853_100367223 3300005539 Bacteria 1342
54 Ga0070672_100620480 3300005543 Bacteria 943
55 Ga0070686_100074661 3300005544 Bacteria 2229
56 Ga0070686_100229474 3300005544 Bacteria 1346
57 Ga0070695_100074406 3300005545 Bacteria 2232
58 Ga0070695_100177140 3300005545 Bacteria 1508
59 Ga0070695_100192282 3300005545 Unclassified 1453
60 Ga0070696_100025283 3300005546 Bacteria 4036
61 Ga0068855_100592184 3300005563 Bacteria 1197
62 Ga0070664_100027184 3300005564 Bacteria 4753
63 Ga0068857_100000911 3300005577 Bacteria 22320
64 Ga0068857_100198556 3300005577 Bacteria 1828
65 Ga0068857_100328508 3300005577 Unclassified 1413
66 Ga0068856_100001688 3300005614 Bacteria 23088
67 Ga0068856_100212057 3300005614 Bacteria 1952
68 Ga0068859_100000239 3300005617 Bacteria 54214
69 Ga0068863_100210128 3300005841 Bacteria 1874
70 Ga0068858_100003055 3300005842 Bacteria 16771
71 Ga0068858_100349570 3300005842 Bacteria 1416
72 Ga0081455_10000506 3300005937 Bacteria 50493
73 Ga0070717_10014098 3300006028 Bacteria 6144
74 Ga0070717_10300770 3300006028 Bacteria 1426
75 Ga0070716_100025625 3300006173 Bacteria 3149
76 Ga0070716_100115037 3300006173 Bacteria 1674
77 Ga0075430_100023035 3300006846 Bacteria 5298
78 Ga0075431_100000319 3300006847 Bacteria 37947
79 Ga0075431_100066354 3300006847 Bacteria 3726
80 Ga0075431_100159586 3300006847 Bacteria 2319
81 Ga0075431_100642510 3300006847 Bacteria 1042
82 Ga0075433_10000304 3300006852 Bacteria 29655
83 Ga0075433_10006080 3300006852 Bacteria 9508
84 Ga0075433_10275010 3300006852 Bacteria 1493
85 Ga0075434_100000675 3300006871 Bacteria 26532
86 Ga0075434_100007118 3300006871 Bacteria 10333
87 Ga0075434_100053307 3300006871 Bacteria 4019
88 Ga0075434_100252444 3300006871 Bacteria 1783
89 Ga0075429_100007123 3300006880 Bacteria 9713
90 Ga0075429_100202617 3300006880 Unclassified 1739
91 Ga0075429_100203607 3300006880 Bacteria 1734
92 Ga0075429_100240040 3300006880 Bacteria 1587
93 Ga0075429_100347154 3300006880 Bacteria 1299
94 Ga0075436_100000007 3300006914 Bacteria 288785
95 Ga0075436_100010737 3300006914 Bacteria 6282
96 Ga0075436_100205417 3300006914 Bacteria 1396
97 Ga0097620_100000239 3300006931 Bacteria 54214
98 Ga0075435_100000276 3300007076 Bacteria 31955
99 Ga0075435_100018254 3300007076 Bacteria 5329
100 Ga0075435_100031325 3300007076 Bacteria 4188
101 Ga0075435_100204646 3300007076 Bacteria 1673
102 Ga0111539_10006761 3300009094 Bacteria 14755
103 Ga0111539_10093054 3300009094 Unclassified 3541
104 Ga0111539_10494120 3300009094 Bacteria 1425
105 Ga0105245_10479449 3300009098 Unclassified 1257
106 Ga0105247_10000033 3300009101 Bacteria 184433
107 Ga0114129_10070727 3300009147 Bacteria 4865
108 Ga0105248_10527414 3300009177 Bacteria 1332
109 Ga0105237_10036891 3300009545 Bacteria 4944
110 Ga0105237_10082953 3300009545 Bacteria 3197
111 Ga0105239_10171681 3300010375 Bacteria 2425
112 Ga0105246_10113859 3300011119 Unclassified 1992
113 Ga0157371_10501690 3300013102 Bacteria 896
114 Ga0157370_10231288 3300013104 Bacteria 1711
115 Ga0157369_10009138 3300013105 Bacteria 11341
116 Ga0157378_10017936 3300013297 Bacteria 6214
117 Ga0157378_10771730 3300013297 Unclassified 985
118 Ga0163163_10336872 3300014325 Bacteria 1563
119 Ga0182008_10062831 3300014497 Bacteria 1829
120 Ga0207672_1000120 3300025223 Bacteria 10573
121 Ga0207697_10007491 3300025315 Bacteria 4864
122 Ga0207653_10000264 3300025885 Bacteria 31899
123 Ga0207710_10000001 3300025900 Bacteria 1797433
124 Ga0207699_10009537 3300025906 Bacteria 4838
125 Ga0207705_10129392 3300025909 Bacteria 1878
126 Ga0207684_10000230 3300025910 Bacteria 85141
127 Ga0207684_10027110 3300025910 Bacteria 4886
128 Ga0207707_10021850 3300025912 Bacteria 5592
129 Ga0207671_10216580 3300025914 Bacteria 1499
130 Ga0207663_10372842 3300025916 Bacteria 1086
131 Ga0207662_10083659 3300025918 Bacteria 1951
132 Ga0207657_10008815 3300025919 Bacteria 10204
133 Ga0207657_10029699 3300025919 Bacteria 4972
134 Ga0207649_10172577 3300025920 Bacteria 1507
135 Ga0207652_10169384 3300025921 Bacteria 1959
136 Ga0207681_10030980 3300025923 Bacteria 3491
137 Ga0207700_10000824 3300025928 Bacteria 17927
138 Ga0207700_10007090 3300025928 Bacteria 6824
139 Ga0207664_10034316 3300025929 Bacteria 3907
140 Ga0207644_10185376 3300025931 Bacteria 1633
141 Ga0207690_10409519 3300025932 Bacteria 1083
142 Ga0207706_10049349 3300025933 Bacteria 3719
143 Ga0207665_10023944 3300025939 Bacteria 4023
144 Ga0207689_10269084 3300025942 Bacteria 1411
145 Ga0207661_10000644 3300025944 Bacteria 22510
146 Ga0207679_10018041 3300025945 Bacteria 4718
147 Ga0207679_10272182 3300025945 Bacteria 1449
148 Ga0207668_10156316 3300025972 Bacteria 1772
149 Ga0207703_10000700 3300026035 Bacteria 33180
150 Ga0207703_10214332 3300026035 Bacteria 1718
151 Ga0207639_10342742 3300026041 Bacteria 1333
152 Ga0207678_10114286 3300026067 Bacteria 2303
153 Ga0207702_10000572 3300026078 Bacteria 40906
154 Ga0207702_10260399 3300026078 Bacteria 1633
155 Ga0207676_10598095 3300026095 Bacteria 1059
156 Ga0207674_10000316 3300026116 Bacteria 61727
157 Ga0207674_10014485 3300026116 Bacteria 8707
158 Ga0207674_10384015 3300026116 Bacteria 1358
159 Ga0207683_10016281 3300026121 Bacteria 6327
160 Ga0207698_10740595 3300026142 Bacteria 981
161 Ga0209968_1007264 3300027526 Bacteria 1676
162 Ga0209999_1018345 3300027543 Bacteria 1280
163 Ga0209982_1002103 3300027552 Bacteria 2767
164 Ga0209974_10036826 3300027876 Bacteria 1625
165 Ga0207428_10002542 3300027907 Bacteria 18216
166 Ga0268265_10524853 3300028380 Bacteria 1120
167 Ga0265338_10047956 3300028800 Bacteria 3893
168 Ga0265340_10042594 3300031247 Bacteria 2228
169 Ga0265339_10007118 3300031249 Bacteria 7264
170 Ga0265339_10009573 3300031249 Bacteria 6074
171 Ga0307408_100093206 3300031548 Bacteria 2278
172 Ga0307408_100098298 3300031548 Bacteria 2225
173 Ga0316575_10005147 3300031665 Bacteria 4646
174 Ga0316579_10013563 3300031691 Bacteria 3507
175 Ga0316576_10044132 3300031727 Bacteria 3220
176 Ga0316576_10123892 3300031727 Bacteria 1942
177 Ga0316576_10375331 3300031727 Unclassified 1056
178 Ga0316578_10021675 3300031728 Bacteria 3569
179 Ga0316578_10051911 3300031728 Bacteria 2401
180 Ga0307405_10311269 3300031731 Bacteria 1199
181 Ga0316577_10012552 3300031733 Bacteria 4616
182 Ga0307410_10008139 3300031852 Bacteria 5795
183 Ga0307406_10032780 3300031901 Bacteria 3174
184 Ga0307412_10604385 3300031911 Bacteria 929
185 Ga0307416_100002187 3300032002 Bacteria 11103
186 Ga0307414_10010668 3300032004 Bacteria 5347
187 Ga0307411_10027404 3300032005 Bacteria 3447
188 Ga0307415_100080579 3300032126 Bacteria 2323
189 Ga0316580_10078817 3300032139 Bacteria 1008
190 Ga0316596_1058487 3300033541 Bacteria 1026
191 Ga0373934_0003463 3300035086 Bacteria 5788
192 Ga0373940_0095548 3300035088 Unclassified 896
193 Ga0373923_0034705 3300035111 Bacteria 2049
194 Ga0373939_0028590 3300035114 Bacteria 1588
195 Ga0373953_0017090 3300035117 Bacteria 2660
196 Ga0373954_0038060 3300035118 Bacteria 2236
197 Ga0373954_0112568 3300035118 Bacteria 1317
198 Ga0373956_0007508 3300035119 Bacteria 4392
199 Ga0373956_0030179 3300035119 Bacteria 2368
200 Ga0373957_0003736 3300035120 Bacteria 4553
201 Ga0373955_0008227 3300035172 Bacteria 4835
202 Ga0373961_0044976 3300035241 Unclassified 1290
203 Ga0373931_0017164 3300035691 Unclassified 3575
204 Ga0373933_0013884 3300035724 Bacteria 4469
205 Ga0316582_0031963 3300036647 Bacteria 3221
206 Ga0316582_0034804 3300036647 Bacteria 3104
207 Ga0316582_0259013 3300036647 Bacteria 1193
208 Ga0316584_0031316 3300036712 Bacteria 3933
209 Ga0316584_0100168 3300036712 Bacteria 2170
210 Ga0373925_0047936 3300037068 Bacteria 3182
211 Ga0400484_07749 3300038725 Bacteria 2408
212 Ga0400484_11644 3300038725 Bacteria 14368
213 Ga0400490_04289 3300038726 Bacteria 19957
214 Ga0400490_43919 3300038726 Bacteria 4925
215 Ga0400490_47450 3300038726 Bacteria 16415
216 Ga0400485_00533 3300038735 Bacteria 3241
217 Ga0400485_08952 3300038735 Bacteria 2185
218 Ga0400488_20252 3300038741 Bacteria 9697
219 Ga0400488_35767 3300038741 Bacteria 7812
220 Ga0400488_62639 3300038741 Bacteria 3525
221 Ga0400486_05468 3300038742 Bacteria 3779
222 Ga0400486_19007 3300038742 Bacteria 2261
223 Ga0400486_25816 3300038742 Unclassified 1190
224 Ga0400483_053205 3300039062 Bacteria 2687
225 Ga0400483_120526 3300039062 Bacteria 1684
226 Ga0400483_133284 3300039062 Bacteria 4874
227 Ga0400483_151310 3300039062 Bacteria 5732
228 Ga0400483_195952 3300039062 Bacteria 2277
229 Ga0400483_239420 3300039062 Unclassified 1622
230 Ga0400483_259948 3300039062 Bacteria 16470
231 Ga0400489_12348 3300039093 Bacteria 1595
232 Ga0400489_58662 3300039093 Bacteria 1283
233 Ga0400489_82775 3300039093 Bacteria 6865
234 Ga0400489_87695 3300039093 Bacteria 12683
235 Ga0400487_00540 3300039110 Bacteria 34222
236 Ga0400487_65956 3300039110 Bacteria 2665
237 Ga0436360_0433083 3300039438 Unclassified 4059
238 Ga0451795_0235973 3300041456 Unclassified 1338
239 Ga0451577_0042758 3300042876 Bacteria 4062
240 Ga0451577_0179311 3300042876 Bacteria 1909
241 Ga0451577_0238119 3300042876 Bacteria 1647
242 Ga0451577_0469178 3300042876 Bacteria 1143
243 Ga0451577_0658493 3300042876 Unclassified 949
244 Ga0453684_0005616 3300044712 Bacteria 24665
245 Ga0453684_0010598 3300044712 Bacteria 15722
246 Ga0453684_0030512 3300044712 Bacteria 7614
247 Ga0453684_0046903 3300044712 Bacteria 5739
248 Ga0453684_0133208 3300044712 Bacteria 2979
249 Ga0453684_0297315 3300044712 Bacteria 1836
250 Ga0451576_0028015 3300045051 Bacteria 6039
251 Ga0451576_0049044 3300045051 Bacteria 4431
252 Ga0451576_0066210 3300045051 Bacteria 3761
253 Ga0451576_0100951 3300045051 Bacteria 3000
254 Ga0451576_0188264 3300045051 Bacteria 2155
255 Ga0451576_0257305 3300045051 Bacteria 1825
256 Ga0451576_0261067 3300045051 Bacteria 1810
257 Ga0451576_0849740 3300045051 Bacteria 958
258 Ga0495592_0031918 3300046454 Bacteria 3978
259 Ga0495651_0073641 3300046462 Unclassified 2592
260 Ga0495653_0136222 3300046463 Bacteria 1732
261 Ga0495580_0000165 3300046472 Bacteria 49068
262 Ga0495580_0102642 3300046472 Bacteria 1988
263 Ga0495580_0151079 3300046472 Bacteria 1609
264 Ga0495594_0022173 3300046499 Bacteria 3396
265 Ga0495628_0215401 3300046516 Bacteria 1443
266 Ga0495587_0138537 3300046536 Bacteria 1389
267 Ga0495621_0094881 3300046539 Bacteria 1129
268 Ga0495667_0051993 3300046559 Bacteria 2700
269 Ga0495635_0191845 3300046663 Bacteria 1387
270 Ga0495657_0041358 3300046675 Bacteria 3154
271 Ga0495658_0118883 3300046683 Bacteria 1596
272 Ga0495604_0102418 3300047317 Bacteria 2102
273 Ga0495680_0148070 3300047322 Bacteria 1713
274 Ga0495675_0007251 3300047444 Bacteria 6829
275 Ga0495684_0001628 3300047471 Bacteria 18022
276 Ga0496101_0249448 3300048904 Bacteria 1383
277 Ga0496109_0048111 3300048912 Bacteria 3880
278 Ga0496110_0124917 3300048913 Bacteria 2321
279 Ga0496112_0152724 3300048915 Unclassified 2276
280 Ga0501031_0005809 3300049568 Bacteria 8041
281 Ga0501031_0078233 3300049568 Bacteria 2155
282 Ga0501032_0025426 3300049569 Unclassified 4081
283 Ga0501032_0386895 3300049569 Bacteria 899
284 Ga0501033_0041231 3300049570 Bacteria 3445
285 Ga0501033_0121385 3300049570 Bacteria 1896
286 Ga0501033_0253007 3300049570 Bacteria 1248
287 Ga0501033_0312115 3300049570 Bacteria 1105
288 Ga0501034_0105819 3300049571 Unclassified 2806
289 Ga0501034_0464014 3300049571 Bacteria 1183
290 Ga0501036_0006813 3300049572 Bacteria 9282
291 Ga0501036_0017908 3300049572 Bacteria 5930
292 Ga0501036_0021049 3300049572 Bacteria 5477
293 Ga0501036_0107666 3300049572 Bacteria 2357
294 Ga0501037_0032074 3300049573 Unclassified 3878
295 Ga0501037_0121118 3300049573 Bacteria 1881
296 Ga0501038_0000888 3300049574 Bacteria 26501
297 Ga0501038_0005012 3300049574 Bacteria 12292
298 Ga0501038_0005696 3300049574 Bacteria 11558
299 Ga0501038_0024344 3300049574 Bacteria 5402
300 Ga0501038_0057683 3300049574 Bacteria 3333
301 Ga0501039_0044256 3300049575 Bacteria 3438
302 Ga0501039_0105027 3300049575 Bacteria 2205
303 Ga0501039_0253838 3300049575 Bacteria 1382
304 Ga0501039_0407407 3300049575 Bacteria 1068
305 Ga0501040_0000027 3300049576 Bacteria 65684
306 Ga0501040_0001997 3300049576 Bacteria 13159
307 Ga0501040_0004162 3300049576 Bacteria 9418
308 Ga0501040_0017152 3300049576 Bacteria 4805
309 Ga0501040_0021340 3300049576 Bacteria 4325
310 Ga0501040_0023771 3300049576 Bacteria 4109
311 Ga0501040_0072925 3300049576 Bacteria 2372
312 Ga0501040_0084661 3300049576 Bacteria 2200
313 Ga0501040_0230067 3300049576 Bacteria 1320
314 Ga0501040_0288073 3300049576 Bacteria 1173
315 Ga0501041_0000169 3300049577 Bacteria 29146
316 Ga0501041_0000368 3300049577 Bacteria 22429
317 Ga0501041_0033987 3300049577 Bacteria 3086
318 Ga0501041_0081921 3300049577 Bacteria 1987
319 Ga0501041_0111666 3300049577 Bacteria 1696
320 Ga0501041_0329322 3300049577 Bacteria 964
321 Ga0501042_0002978 3300049578 Bacteria 10538
322 Ga0501042_0042223 3300049578 Bacteria 3245
323 Ga0501042_0078024 3300049578 Bacteria 2372
324 Ga0501042_0257319 3300049578 Unclassified 1260
325 Ga0501043_0049571 3300049579 Bacteria 3301
326 Ga0501046_0014076 3300049580 Bacteria 6755
327 Ga0501046_0027090 3300049580 Bacteria 4680
328 Ga0501046_0027848 3300049580 Unclassified 4606
329 Ga0501046_0099604 3300049580 Bacteria 2231
330 Ga0501046_0180658 3300049580 Bacteria 1578
331 Ga0501046_0198025 3300049580 Bacteria 1495
332 Ga0501046_0203420 3300049580 Bacteria 1473
333 Ga0501046_0218505 3300049580 Bacteria 1412
334 Ga0501046_0325120 3300049580 Bacteria 1120
335 Ga0501046_0331068 3300049580 Bacteria 1108
336 Ga0501047_0088704 3300049581 Bacteria 2970
337 Ga0501048_0018940 3300049582 Bacteria 5059
338 Ga0501048_0021683 3300049582 Bacteria 4701
339 Ga0501048_0023118 3300049582 Bacteria 4544
340 Ga0501048_0091560 3300049582 Bacteria 2145
341 Ga0501068_0002670 3300049584 Bacteria 9443
342 Ga0501068_0014340 3300049584 Bacteria 4529
343 Ga0501068_0044607 3300049584 Bacteria 2670
344 Ga0501068_0049282 3300049584 Bacteria 2543
345 Ga0501069_0107352 3300049585 Bacteria 1588
346 Ga0501070_0013468 3300049586 Bacteria 6894
347 Ga0501070_0212168 3300049586 Bacteria 1589
348 Ga0501071_0047974 3300049587 Bacteria 3069
349 Ga0501071_0053811 3300049587 Bacteria 2904
350 Ga0501071_0198145 3300049587 Bacteria 1508
351 Ga0501071_0235430 3300049587 Bacteria 1380
352 Ga0501072_0001034 3300049588 Bacteria 20590
353 Ga0501072_0001987 3300049588 Bacteria 15229
354 Ga0501072_0007826 3300049588 Bacteria 8116
355 Ga0501072_0021456 3300049588 Bacteria 5008
356 Ga0501072_0022742 3300049588 Bacteria 4865
357 Ga0501072_0049042 3300049588 Bacteria 3324
358 Ga0501072_0063361 3300049588 Bacteria 2916
359 Ga0501072_0087295 3300049588 Bacteria 2475
360 Ga0501072_0210191 3300049588 Bacteria 1551
361 Ga0501072_0256490 3300049588 Bacteria 1392
362 Ga0501072_0498261 3300049588 Bacteria 963
363 Ga0501073_0017499 3300049589 Bacteria 5192
364 Ga0501073_0040511 3300049589 Bacteria 3296
365 Ga0501073_0121785 3300049589 Bacteria 1808
366 Ga0501074_0011181 3300049590 Bacteria 6520
367 Ga0501074_0025201 3300049590 Bacteria 4321
368 Ga0501074_0061725 3300049590 Bacteria 2700
369 Ga0501074_0128909 3300049590 Bacteria 1810
370 Ga0501075_0002276 3300049591 Bacteria 12727
371 Ga0501075_0005440 3300049591 Bacteria 8710
372 Ga0501075_0006564 3300049591 Bacteria 8012
373 Ga0501075_0012091 3300049591 Bacteria 6127
374 Ga0501075_0013270 3300049591 Bacteria 5878
375 Ga0501075_0043195 3300049591 Bacteria 3380
376 Ga0501075_0053317 3300049591 Unclassified 3041
377 Ga0501075_0059798 3300049591 Bacteria 2871
378 Ga0501075_0070245 3300049591 Bacteria 2646
379 Ga0501075_0082224 3300049591 Bacteria 2439
380 Ga0501075_0082467 3300049591 Bacteria 2436
381 Ga0501075_0092867 3300049591 Bacteria 2291
382 Ga0501075_0182342 3300049591 Bacteria 1602
383 Ga0501075_0266984 3300049591 Bacteria 1304
384 Ga0501076_0000003 3300049592 Bacteria 154391
385 Ga0501076_0002561 3300049592 Bacteria 12506
386 Ga0501076_0003859 3300049592 Bacteria 10557
387 Ga0501076_0009553 3300049592 Bacteria 7158
388 Ga0501076_0023868 3300049592 Unclassified 4718
389 Ga0501076_0026925 3300049592 Bacteria 4458
390 Ga0501076_0028420 3300049592 Bacteria 4342
391 Ga0501076_0060724 3300049592 Bacteria 3008
392 Ga0501076_0063579 3300049592 Bacteria 2940
393 Ga0501076_0178101 3300049592 Bacteria 1733
394 Ga0501076_0208003 3300049592 Bacteria 1598
395 Ga0501076_0231572 3300049592 Bacteria 1510
396 Ga0501077_0001855 3300049593 Bacteria 12774
397 Ga0501077_0017446 3300049593 Bacteria 4531
398 Ga0501077_0064461 3300049593 Bacteria 2324
399 Ga0501077_0092694 3300049593 Bacteria 1914
400 Ga0501077_0160419 3300049593 Bacteria 1427
401 Ga0501077_0175652 3300049593 Bacteria 1361
402 Ga0501077_0176049 3300049593 Bacteria 1359
403 Ga0501077_0181463 3300049593 Bacteria 1338
404 Ga0501079_0001310 3300049741 Bacteria 17515
405 Ga0501079_0002589 3300049741 Bacteria 13145
406 Ga0501079_0004039 3300049741 Bacteria 10864
407 Ga0501079_0031232 3300049741 Bacteria 4093
408 Ga0501079_0035871 3300049741 Bacteria 3818
409 Ga0501079_0064634 3300049741 Bacteria 2822
410 Ga0501079_0100328 3300049741 Bacteria 2244
411 Ga0501079_0146883 3300049741 Bacteria 1838
412 Ga0501079_0291110 3300049741 Bacteria 1277
413 Ga0501079_0555352 3300049741 Bacteria 903
414 Ga0501080_0024128 3300049742 Bacteria 5638
415 Ga0501080_0036813 3300049742 Bacteria 4568
416 Ga0501080_0043154 3300049742 Unclassified 4198
417 Ga0501080_0065629 3300049742 Bacteria 3376
418 Ga0501080_0135944 3300049742 Bacteria 2275
419 Ga0501080_0295828 3300049742 Bacteria 1469
420 Ga0501081_0000199 3300049743 Bacteria 29312
421 Ga0501081_0000269 3300049743 Bacteria 27324
422 Ga0501081_0001471 3300049743 Bacteria 14438
423 Ga0501081_0002110 3300049743 Bacteria 12433
424 Ga0501081_0002148 3300049743 Bacteria 12352
425 Ga0501081_0002847 3300049743 Bacteria 10988
426 Ga0501081_0010378 3300049743 Bacteria 6076
427 Ga0501081_0024097 3300049743 Bacteria 4085
428 Ga0501081_0087206 3300049743 Bacteria 2192
429 Ga0501081_0121997 3300049743 Bacteria 1857
430 Ga0501081_0363937 3300049743 Bacteria 1067
431 Ga0501083_0088797 3300049744 Bacteria 2043
432 Ga0501083_0137152 3300049744 Bacteria 1603
433 Ga0501083_0162980 3300049744 Bacteria 1458
434 Ga0501083_0212338 3300049744 Bacteria 1261
435 Ga0501083_0365483 3300049744 Bacteria 938
436 Ga0501035_0022634 3300049822 Bacteria 5772
437 Ga0501035_0057145 3300049822 Bacteria 3479
438 Ga0501035_0237277 3300049822 Bacteria 1552
439 Ga0501044_0055444 3300049823 Unclassified 4071
440 Ga0501045_0002393 3300049824 Bacteria 12741
441 Ga0501045_0004313 3300049824 Bacteria 9813
442 Ga0501045_0012471 3300049824 Bacteria 5985
443 Ga0501045_0035074 3300049824 Unclassified 3642
444 Ga0501045_0058185 3300049824 Bacteria 2830
445 Ga0501045_0072923 3300049824 Bacteria 2528
446 Ga0501045_0135380 3300049824 Bacteria 1832
447 Ga0501045_0262087 3300049824 Bacteria 1286
448 nmdc:mga05p37_102093_c1 3300050507 Bacteria 3532
449 nmdc:mga09592_241034_c1 3300050508 Bacteria 1567
450 nmdc:mga09592_6350_c1 3300050508 Bacteria 9633
451 nmdc:mga0qj67_25870_c1 3300050509 Bacteria 4539
452 nmdc:mga0qj67_47200_c1 3300050509 Unclassified 3402
453 nmdc:mga0qj67_515845_c1 3300050509 Bacteria 960
454 nmdc:mga06r32_2093_c1 3300050510 Bacteria 17869
455 nmdc:mga06r32_341259_c1 3300050510 Bacteria 1482
456 nmdc:mga06r32_428201_c1 3300050510 Bacteria 1304
457 nmdc:mga06r32_511615_c1 3300050510 Unclassified 1177
458 nmdc:mga06r32_533987_c1 3300050510 Bacteria 1148
459 nmdc:mga06r32_59099_c1 3300050510 Bacteria 3686
460 nmdc:mga08y16_44135_c1 3300050511 Bacteria 4671
461 nmdc:mga0n895_1070_c1 3300050512 Bacteria 19971
462 nmdc:mga0n895_116648_c1 3300050512 Bacteria 2689
463 nmdc:mga0n895_289005_c1 3300050512 Bacteria 1662
464 nmdc:mga0n895_806_c1 3300050512 Bacteria 22417
465 nmdc:mga0rr50_162_c1 3300050513 Bacteria 36242
466 nmdc:mga0rr50_16708_c1 3300050513 Bacteria 4882
467 nmdc:mga0rr50_9693_c2 3300050513 Bacteria 1706
468 nmdc:mga08x19_230778_c1 3300050514 Bacteria 1274
469 nmdc:mga08x19_7095_c1 3300050514 Bacteria 6651
470 nmdc:mga08x19_70_c1 3300050514 Bacteria 98848
471 nmdc:mga0a205_1528_c1 3300050515 Bacteria 19767
472 nmdc:mga0a205_89671_c1 3300050515 Bacteria 2972
473 Ga0495595_0003322 3300053084 Bacteria 6381
474 Ga0501084_0013847 3300054114 Bacteria 6676
475 Ga0501084_0033798 3300054114 Bacteria 4278
476 Ga0501084_0035599 3300054114 Bacteria 4162
477 Ga0501084_0115090 3300054114 Bacteria 2261
478 Ga0501084_0190058 3300054114 Bacteria 1732
479 Ga0501084_0202963 3300054114 Bacteria 1673
480 Ga0501084_0225457 3300054114 Bacteria 1581
481 Ga0501084_0225512 3300054114 Bacteria 1581
482 Ga0501084_0246156 3300054114 Unclassified 1509
483 Ga0501084_0335224 3300054114 Bacteria 1277
484 Ga0590071_005440 3300059421 Bacteria 3058
485 Ga0501082_0000467 3300060353 Bacteria 35572
486 Ga0501082_0000895 3300060353 Bacteria 26294
487 Ga0501082_0003121 3300060353 Bacteria 14446
488 Ga0501082_0010073 3300060353 Bacteria 8144
489 Ga0501082_0014093 3300060353 Bacteria 6878
490 Ga0501082_0085424 3300060353 Bacteria 2722
491 Ga0501082_0103492 3300060353 Bacteria 2463
492 Ga0501082_0162730 3300060353 Bacteria 1939
493 Ga0501082_0168835 3300060353 Bacteria 1902
494 Ga0501082_0185924 3300060353 Bacteria 1808
495 Ga0501082_0261382 3300060353 Bacteria 1506
496 Ga0501082_0400885 3300060353 Bacteria 1197
497 Ga0530510_0000260 3300061734 Bacteria 33260
498 Ga0530510_0002961 3300061734 Bacteria 11650
499 Ga0530510_0004838 3300061734 Bacteria 9317
500 Ga0530510_0004946 3300061734 Bacteria 9202
501 Ga0530510_0013778 3300061734 Bacteria 5694
502 Ga0530510_0030182 3300061734 Bacteria 3893
503 Ga0530510_0037002 3300061734 Bacteria 3517
504 Ga0530510_0054750 3300061734 Bacteria 2883
505 Ga0530510_0056141 3300061734 Bacteria 2845
506 Ga0530510_0064165 3300061734 Bacteria 2660
507 Ga0530510_0149900 3300061734 Bacteria 1722
508 Ga0530510_0402153 3300061734 Bacteria 1032
509 nmdc:mga08x19_139765_c1
510 JGI24748J21848_1000031
511 JGI24034J26672_10000005
512 JGI24742J22300_10011601
513 Ga0065714_10081885
514 Ga0065704_10009885
515 Ga0065712_10011311
516 Ga0065707_10005130
517 Ga0065707_10118822
518 Ga0065707_10318806
519 Ga0070683_100001598
520 Ga0070683_100186691
521 Ga0070690_100334664
522 Ga0070680_100050168
523 Ga0070660_100042864
524 Ga0070689_100076516
525 Ga0070661_100131677
526 Ga0070669_100034394
527 Ga0070675_100025107
528 Ga0070671_100040739
529 Ga0070671_100095768
530 Ga0070673_100024586
531 Ga0070659_100190526
532 Ga0070703_10000194
533 Ga0070709_10003103
534 Ga0070709_10069989
535 Ga0070714_100001346
536 Ga0070714_100008997
537 Ga0070713_100000338
538 Ga0070713_100010303
539 Ga0070711_100480419
540 Ga0070705_100080374
541 Ga0070705_100166720
542 Ga0070694_100090266
543 Ga0070708_100582348
544 Ga0070663_100309539
545 Ga0070681_10081559
546 Ga0070681_10131512
547 Ga0070706_100000611
548 Ga0070706_100038810
549 Ga0070706_100046495
550 Ga0070707_100127121
551 Ga0070698_100028619
552 Ga0070699_100141033
553 Ga0070699_100315740
554 Ga0070679_100009393
555 Ga0070679_100009515
556 Ga0070684_100000337
557 Ga0070684_100077330
558 Ga0070684_100230434
559 Ga0070697_100020863
560 Ga0068853_100041333
561 Ga0068853_100367223
562 Ga0070672_100620480
563 Ga0070686_100074661
564 Ga0070686_100229474
565 Ga0070695_100074406
566 Ga0070695_100177140
567 Ga0070695_100192282
568 Ga0070696_100025283
569 Ga0068855_100592184
570 Ga0070664_100027184
571 Ga0068857_100000911
572 Ga0068857_100198556
573 Ga0068857_100328508
574 Ga0068856_100001688
575 Ga0068856_100212057
576 Ga0068859_100000239
577 Ga0068863_100210128
578 Ga0068858_100003055
579 Ga0068858_100349570
580 Ga0081455_10000506
581 Ga0070717_10014098
582 Ga0070717_10300770
583 Ga0070716_100025625
584 Ga0070716_100115037
585 Ga0075430_100023035
586 Ga0075431_100000319
587 Ga0075431_100066354
588 Ga0075431_100159586
589 Ga0075431_100642510
590 Ga0075433_10000304
591 Ga0075433_10006080
592 Ga0075433_10275010
593 Ga0075434_100000675
594 Ga0075434_100007118
595 Ga0075434_100053307
596 Ga0075434_100252444
597 Ga0075429_100007123
598 Ga0075429_100202617
599 Ga0075429_100203607
600 Ga0075429_100240040
601 Ga0075429_100347154
602 Ga0075436_100000007
603 Ga0075436_100010737
604 Ga0075436_100205417
605 Ga0097620_100000239
606 Ga0075435_100000276
607 Ga0075435_100018254
608 Ga0075435_100031325
609 Ga0075435_100204646
610 Ga0111539_10006761
611 Ga0111539_10093054
612 Ga0111539_10494120
613 Ga0105245_10479449
614 Ga0105247_10000033
615 Ga0114129_10070727
616 Ga0105248_10527414
617 Ga0105237_10036891
618 Ga0105237_10082953
619 Ga0105239_10171681
620 Ga0105246_10113859
621 Ga0157371_10501690
622 Ga0157370_10231288
623 Ga0157369_10009138
624 Ga0157378_10017936
625 Ga0157378_10771730
626 Ga0163163_10336872
627 Ga0182008_10062831
628 Ga0207672_1000120
629 Ga0207697_10007491
630 Ga0207653_10000264
631 Ga0207710_10000001
632 Ga0207699_10009537
633 Ga0207705_10129392
634 Ga0207684_10000230
635 Ga0207684_10027110
636 Ga0207707_10021850
637 Ga0207671_10216580
638 Ga0207663_10372842
639 Ga0207662_10083659
640 Ga0207657_10008815
641 Ga0207657_10029699
642 Ga0207649_10172577
643 Ga0207652_10169384
644 Ga0207681_10030980
645 Ga0207700_10000824
646 Ga0207700_10007090
647 Ga0207664_10034316
648 Ga0207644_10185376
649 Ga0207690_10409519
650 Ga0207706_10049349
651 Ga0207665_10023944
652 Ga0207689_10269084
653 Ga0207661_10000644
654 Ga0207679_10018041
655 Ga0207679_10272182
656 Ga0207668_10156316
657 Ga0207703_10000700
658 Ga0207703_10214332
659 Ga0207639_10342742
660 Ga0207678_10114286
661 Ga0207702_10000572
662 Ga0207702_10260399
663 Ga0207676_10598095
664 Ga0207674_10000316
665 Ga0207674_10014485
666 Ga0207674_10384015
667 Ga0207683_10016281
668 Ga0207698_10740595
669 Ga0209968_1007264
670 Ga0209999_1018345
671 Ga0209982_1002103
672 Ga0209974_10036826
673 Ga0207428_10002542
674 Ga0268265_10524853
675 Ga0265338_10047956
676 Ga0265340_10042594
677 Ga0265339_10007118
678 Ga0265339_10009573
679 Ga0307408_100093206
680 Ga0307408_100098298
681 Ga0316575_10005147
682 Ga0316579_10013563
683 Ga0316576_10044132
684 Ga0316576_10123892
685 Ga0316576_10375331
686 Ga0316578_10021675
687 Ga0316578_10051911
688 Ga0307405_10311269
689 Ga0316577_10012552
690 Ga0307410_10008139
691 Ga0307406_10032780
692 Ga0307412_10604385
693 Ga0307416_100002187
694 Ga0307414_10010668
695 Ga0307411_10027404
696 Ga0307415_100080579
697 Ga0316580_10078817
698 Ga0316596_1058487
699 Ga0373934_0003463
700 Ga0373940_0095548
701 Ga0373923_0034705
702 Ga0373939_0028590
703 Ga0373953_0017090
704 Ga0373954_0038060
705 Ga0373954_0112568
706 Ga0373956_0007508
707 Ga0373956_0030179
708 Ga0373957_0003736
709 Ga0373955_0008227
710 Ga0373961_0044976
711 Ga0373931_0017164
712 Ga0373933_0013884
713 Ga0316582_0031963
714 Ga0316582_0034804
715 Ga0316582_0259013
716 Ga0316584_0031316
717 Ga0316584_0100168
718 Ga0373925_0047936
719 Ga0400484_07749
720 Ga0400484_11644
721 Ga0400490_04289
722 Ga0400490_43919
723 Ga0400490_47450
724 Ga0400485_00533
725 Ga0400485_08952
726 Ga0400488_20252
727 Ga0400488_35767
728 Ga0400488_62639
729 Ga0400486_05468
730 Ga0400486_19007
731 Ga0400486_25816
732 Ga0400483_053205
733 Ga0400483_120526
734 Ga0400483_133284
735 Ga0400483_151310
736 Ga0400483_195952
737 Ga0400483_239420
738 Ga0400483_259948
739 Ga0400489_12348
740 Ga0400489_58662
741 Ga0400489_82775
742 Ga0400489_87695
743 Ga0400487_00540
744 Ga0400487_65956
745 Ga0436360_0433083
746 Ga0451795_0235973
747 Ga0451577_0042758
748 Ga0451577_0179311
749 Ga0451577_0238119
750 Ga0451577_0469178
751 Ga0451577_0658493
752 Ga0453684_0005616
753 Ga0453684_0010598
754 Ga0453684_0030512
755 Ga0453684_0046903
756 Ga0453684_0133208
757 Ga0453684_0297315
758 Ga0451576_0028015
759 Ga0451576_0049044
760 Ga0451576_0066210
761 Ga0451576_0100951
762 Ga0451576_0188264
763 Ga0451576_0257305
764 Ga0451576_0261067
765 Ga0451576_0849740
766 Ga0495592_0031918
767 Ga0495651_0073641
768 Ga0495653_0136222
769 Ga0495580_0000165
770 Ga0495580_0102642
771 Ga0495580_0151079
772 Ga0495594_0022173
773 Ga0495628_0215401
774 Ga0495587_0138537
775 Ga0495621_0094881
776 Ga0495667_0051993
777 Ga0495635_0191845
778 Ga0495657_0041358
779 Ga0495658_0118883
780 Ga0495604_0102418
781 Ga0495680_0148070
782 Ga0495675_0007251
783 Ga0495684_0001628
784 Ga0496101_0249448
785 Ga0496109_0048111
786 Ga0496110_0124917
787 Ga0496112_0152724
788 Ga0501031_0005809
789 Ga0501031_0078233
790 Ga0501032_0025426
791 Ga0501032_0386895
792 Ga0501033_0041231
793 Ga0501033_0121385
794 Ga0501033_0253007
795 Ga0501033_0312115
796 Ga0501034_0105819
797 Ga0501034_0464014
798 Ga0501036_0006813
799 Ga0501036_0017908
800 Ga0501036_0021049
801 Ga0501036_0107666
802 Ga0501037_0032074
803 Ga0501037_0121118
804 Ga0501038_0000888
805 Ga0501038_0005012
806 Ga0501038_0005696
807 Ga0501038_0024344
808 Ga0501038_0057683
809 Ga0501039_0044256
810 Ga0501039_0105027
811 Ga0501039_0253838
812 Ga0501039_0407407
813 Ga0501040_0000027
814 Ga0501040_0001997
815 Ga0501040_0004162
816 Ga0501040_0017152
817 Ga0501040_0021340
818 Ga0501040_0023771
819 Ga0501040_0072925
820 Ga0501040_0084661
821 Ga0501040_0230067
822 Ga0501040_0288073
823 Ga0501041_0000169
824 Ga0501041_0000368
825 Ga0501041_0033987
826 Ga0501041_0081921
827 Ga0501041_0111666
828 Ga0501041_0329322
829 Ga0501042_0002978
830 Ga0501042_0042223
831 Ga0501042_0078024
832 Ga0501042_0257319
833 Ga0501043_0049571
834 Ga0501046_0014076
835 Ga0501046_0027090
836 Ga0501046_0027848
837 Ga0501046_0099604
838 Ga0501046_0180658
839 Ga0501046_0198025
840 Ga0501046_0203420
841 Ga0501046_0218505
842 Ga0501046_0325120
843 Ga0501046_0331068
844 Ga0501047_0088704
845 Ga0501048_0018940
846 Ga0501048_0021683
847 Ga0501048_0023118
848 Ga0501048_0091560
849 Ga0501068_0002670
850 Ga0501068_0014340
851 Ga0501068_0044607
852 Ga0501068_0049282
853 Ga0501069_0107352
854 Ga0501070_0013468
855 Ga0501070_0212168
856 Ga0501071_0047974
857 Ga0501071_0053811
858 Ga0501071_0198145
859 Ga0501071_0235430
860 Ga0501072_0001034
861 Ga0501072_0001987
862 Ga0501072_0007826
863 Ga0501072_0021456
864 Ga0501072_0022742
865 Ga0501072_0049042
866 Ga0501072_0063361
867 Ga0501072_0087295
868 Ga0501072_0210191
869 Ga0501072_0256490
870 Ga0501072_0498261
871 Ga0501073_0017499
872 Ga0501073_0040511
873 Ga0501073_0121785
874 Ga0501074_0011181
875 Ga0501074_0025201
876 Ga0501074_0061725
877 Ga0501074_0128909
878 Ga0501075_0002276
879 Ga0501075_0005440
880 Ga0501075_0006564
881 Ga0501075_0012091
882 Ga0501075_0013270
883 Ga0501075_0043195
884 Ga0501075_0053317
885 Ga0501075_0059798
886 Ga0501075_0070245
887 Ga0501075_0082224
888 Ga0501075_0082467
889 Ga0501075_0092867
890 Ga0501075_0182342
891 Ga0501075_0266984
892 Ga0501076_0000003
893 Ga0501076_0002561
894 Ga0501076_0003859
895 Ga0501076_0009553
896 Ga0501076_0023868
897 Ga0501076_0026925
898 Ga0501076_0028420
899 Ga0501076_0060724
900 Ga0501076_0063579
901 Ga0501076_0178101
902 Ga0501076_0208003
903 Ga0501076_0231572
904 Ga0501077_0001855
905 Ga0501077_0017446
906 Ga0501077_0064461
907 Ga0501077_0092694
908 Ga0501077_0160419
909 Ga0501077_0175652
910 Ga0501077_0176049
911 Ga0501077_0181463
912 Ga0501079_0001310
913 Ga0501079_0002589
914 Ga0501079_0004039
915 Ga0501079_0031232
916 Ga0501079_0035871
917 Ga0501079_0064634
918 Ga0501079_0100328
919 Ga0501079_0146883
920 Ga0501079_0291110
921 Ga0501079_0555352
922 Ga0501080_0024128
923 Ga0501080_0036813
924 Ga0501080_0043154
925 Ga0501080_0065629
926 Ga0501080_0135944
927 Ga0501080_0295828
928 Ga0501081_0000199
929 Ga0501081_0000269
930 Ga0501081_0001471
931 Ga0501081_0002110
932 Ga0501081_0002148
933 Ga0501081_0002847
934 Ga0501081_0010378
935 Ga0501081_0024097
936 Ga0501081_0087206
937 Ga0501081_0121997
938 Ga0501081_0363937
939 Ga0501083_0088797
940 Ga0501083_0137152
941 Ga0501083_0162980
942 Ga0501083_0212338
943 Ga0501083_0365483
944 Ga0501035_0022634
945 Ga0501035_0057145
946 Ga0501035_0237277
947 Ga0501044_0055444
948 Ga0501045_0002393
949 Ga0501045_0004313
950 Ga0501045_0012471
951 Ga0501045_0035074
952 Ga0501045_0058185
953 Ga0501045_0072923
954 Ga0501045_0135380
955 Ga0501045_0262087
956 nmdc:mga05p37_102093_c1
957 nmdc:mga09592_241034_c1
958 nmdc:mga09592_6350_c1
959 nmdc:mga0qj67_25870_c1
960 nmdc:mga0qj67_47200_c1
961 nmdc:mga0qj67_515845_c1
962 nmdc:mga06r32_2093_c1
963 nmdc:mga06r32_341259_c1
964 nmdc:mga06r32_428201_c1
965 nmdc:mga06r32_511615_c1
966 nmdc:mga06r32_533987_c1
967 nmdc:mga06r32_59099_c1
968 nmdc:mga08y16_44135_c1
969 nmdc:mga0n895_1070_c1
970 nmdc:mga0n895_116648_c1
971 nmdc:mga0n895_289005_c1
972 nmdc:mga0n895_806_c1
973 nmdc:mga0rr50_162_c1
974 nmdc:mga0rr50_16708_c1
975 nmdc:mga0rr50_9693_c2
976 nmdc:mga08x19_230778_c1
977 nmdc:mga08x19_7095_c1
978 nmdc:mga08x19_70_c1
979 nmdc:mga0a205_1528_c1
980 nmdc:mga0a205_89671_c1
981 Ga0495595_0003322
982 Ga0501084_0013847
983 Ga0501084_0033798
984 Ga0501084_0035599
985 Ga0501084_0115090
986 Ga0501084_0190058
987 Ga0501084_0202963
988 Ga0501084_0225457
989 Ga0501084_0225512
990 Ga0501084_0246156
991 Ga0501084_0335224
992 Ga0590071_005440
993 Ga0501082_0000467
994 Ga0501082_0000895
995 Ga0501082_0003121
996 Ga0501082_0010073
997 Ga0501082_0014093
998 Ga0501082_0085424
999 Ga0501082_0103492
1000 Ga0501082_0162730
1001 Ga0501082_0168835
1002 Ga0501082_0185924
1003 Ga0501082_0261382
1004 Ga0501082_0400885
1005 Ga0530510_0000260
1006 Ga0530510_0002961
1007 Ga0530510_0004838
1008 Ga0530510_0004946
1009 Ga0530510_0013778
1010 Ga0530510_0030182
1011 Ga0530510_0037002
1012 Ga0530510_0054750
1013 Ga0530510_0056141
1014 Ga0530510_0064165
1015 Ga0530510_0149900
1016 Ga0530510_0402153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01869

BcrAD_BadFG

BadF/BadG/BcrA/BcrD ATPase family

4

253

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hux-assembly1.cif.gz_B crystal structure of the acidaminococcus fermentans (r)-2-hydroxyglutaryl-coa dehydratase component a 0.9599 1 259
1hux-assembly1.cif.gz_B crystal structure of the acidaminococcus fermentans (r)-2-hydroxyglutaryl-coa dehydratase component a 0.9527 1 259
4ehu-assembly1.cif.gz_A activator of the 2-hydroxyisocaproyl-coa dehydratase from clostridium difficile with bound adpnp 0.9376 3 265
4ehu-assembly1.cif.gz_A activator of the 2-hydroxyisocaproyl-coa dehydratase from clostridium difficile with bound adpnp 0.9174 3 265
8c9k-assembly2.cif.gz_D-2 structure of mpox virus poxin 0.8984 98 125
ID Description Score Start End Superfamily
1huxB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9516 98 237 3.30.420.40
af_Q60315_91_229_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9442 99 239 3.30.420.40
1huxB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9387 98 237 3.30.420.40
af_Q60315_91_229_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9313 99 239 3.30.420.40
af_P39383_79_255_3.30.870.30 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;MITD, C-terminal phospholipase D-like domain 0.9284 84 262 3.30.870.30
ID Description Score Start End GO Terms
AF-A0A3Q8HV99-F1-model_v4 deleted 0.989 1 104
AF-A0A3D1U4C4-F1-model_v4 2-hydroxyglutaryl-CoA dehydratase 0.9843 3 261 GO:0046872
GO:0051536
AF-A0A842VVS3-F1-model_v4 2-hydroxyglutaryl-CoA dehydratase 0.984 3 89 GO:0046872
AF-A0A2H5W8C4-F1-model_v4 (R)-phenyllactate dehydratase activator (EC 3.6.1.-) 0.982 1 259 GO:0016747
GO:0016787
GO:0046872
GO:0051536
AF-A0A7J4S5W9-F1-model_v4 2-hydroxyglutaryl-CoA dehydratase 0.9815 59 263 GO:0046872
GO:0051536

Map