F456842

General Info

Members Datasets Scaffolds Average Seq Length
508 266 1016 256

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0026875|Ga0451577_0026875_642_1499
Length 285
Sequence MITLKGRTELLKMERATWIVQQTLAECVAACRPGVTTEEIDRIAAEGIRKRGGRAAFPGYRGYPKTICSSVNEEVVHGIPTPKRKLRDGDIVGLDLGAIVDGYFGDAARTAVVGEAPAEVRGLVRNTWRALVAGVSAVKVGGRVGDIGAAVEAVAKENGYGVVREYVGHGIGTALHEEPQVPNYGPGGKGERIREGMTLAIEPMFNLGTARVSLAPDGWTVRTADGKPSAHFEHTVVATAAGPVVLGFGRYTADGARTGAPDEMDYPAPAASPSGETVVPGESRV

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
102 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
162 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
191 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.06
Metatranscriptomes 3.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 1.77
Rhizosphere 96.26
Stem 0
Stem Tuber 0
Unclassified 2.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0026875 3300042876 Bacteria 5210
2 JGI25407J50210_10002202 3300003373 Bacteria 4563
3 JGI25405J52794_10000957 3300003911 Bacteria 4538
4 Ga0058859_10039280 3300004798 Bacteria 17980
5 Ga0058859_11800547 3300004798 Bacteria 4728
6 Ga0058863_11953124 3300004799 Bacteria 1889
7 Ga0058860_12161439 3300004801 Bacteria 5444
8 Ga0058860_12235955 3300004801 Bacteria 17046
9 Ga0065704_10111069 3300005289 Bacteria 1966
10 Ga0070676_10063099 3300005328 Bacteria 2206
11 Ga0070683_100080539 3300005329 Bacteria 3048
12 Ga0070690_100001073 3300005330 Bacteria 14017
13 Ga0070690_100083973 3300005330 Bacteria 2087
14 Ga0070690_100304152 3300005330 Bacteria 1144
15 Ga0070670_100029424 3300005331 Bacteria 4729
16 Ga0068869_100050782 3300005334 Bacteria 3007
17 Ga0068869_100106502 3300005334 Bacteria 2128
18 Ga0070666_10001507 3300005335 Bacteria 14139
19 Ga0070666_10092190 3300005335 Bacteria 2082
20 Ga0070666_10129766 3300005335 Bacteria 1751
21 Ga0070660_100188271 3300005339 Bacteria 1671
22 Ga0070689_100045106 3300005340 Bacteria 3393
23 Ga0070689_100133946 3300005340 Bacteria 1989
24 Ga0070687_100105880 3300005343 Bacteria 1583
25 Ga0070692_10014546 3300005345 Bacteria 3700
26 Ga0070668_100087028 3300005347 Bacteria 2458
27 Ga0070669_100030262 3300005353 Bacteria 3905
28 Ga0070669_100046731 3300005353 Bacteria 3157
29 Ga0070675_100113128 3300005354 Bacteria 2298
30 Ga0070675_100222598 3300005354 Bacteria 1644
31 Ga0070671_100212824 3300005355 Bacteria 1639
32 Ga0070674_100007417 3300005356 Bacteria 6470
33 Ga0070673_100083639 3300005364 Bacteria 2593
34 Ga0070688_100002699 3300005365 Bacteria 8999
35 Ga0070659_100410638 3300005366 Bacteria 1144
36 Ga0070667_100064574 3300005367 Bacteria 3106
37 Ga0070705_100033441 3300005440 Bacteria 2866
38 Ga0070700_100012203 3300005441 Bacteria 4786
39 Ga0070694_100016219 3300005444 Bacteria 4688
40 Ga0070694_100035142 3300005444 Bacteria 3311
41 Ga0070708_100002882 3300005445 Bacteria 13353
42 Ga0070708_100017302 3300005445 Bacteria 6010
43 Ga0070708_100039269 3300005445 Bacteria 4141
44 Ga0070708_100053276 3300005445 Bacteria 3589
45 Ga0070708_100211418 3300005445 Bacteria 1818
46 Ga0070708_100221898 3300005445 Bacteria 1773
47 Ga0070663_100068862 3300005455 Bacteria 2570
48 Ga0070678_100009268 3300005456 Bacteria 5953
49 Ga0070662_100131184 3300005457 Bacteria 1932
50 Ga0070662_100252991 3300005457 Bacteria 1417
51 Ga0068867_100685355 3300005459 Bacteria 903
52 Ga0070685_10002542 3300005466 Bacteria 9345
53 Ga0070685_10053096 3300005466 Bacteria 2347
54 Ga0070706_100005176 3300005467 Bacteria 12446
55 Ga0070706_100005771 3300005467 Bacteria 11760
56 Ga0070706_100007109 3300005467 Bacteria 10527
57 Ga0070706_100013417 3300005467 Bacteria 7575
58 Ga0070706_100039004 3300005467 Bacteria 4385
59 Ga0070706_100051166 3300005467 Bacteria 3812
60 Ga0070706_100299221 3300005467 Bacteria 1501
61 Ga0070706_100497998 3300005467 Bacteria 1134
62 Ga0070707_100000111 3300005468 Bacteria 75249
63 Ga0070707_100006596 3300005468 Bacteria 10769
64 Ga0070707_100152999 3300005468 Bacteria 2246
65 Ga0070707_100437390 3300005468 Bacteria 1268
66 Ga0070707_100662758 3300005468 Bacteria 1006
67 Ga0070698_100000222 3300005471 Bacteria 56055
68 Ga0070698_100016546 3300005471 Bacteria 7781
69 Ga0070698_100023411 3300005471 Bacteria 6457
70 Ga0070698_100045940 3300005471 Bacteria 4467
71 Ga0070698_100117871 3300005471 Bacteria 2617
72 Ga0070699_100007902 3300005518 Bacteria 9245
73 Ga0070699_100041483 3300005518 Bacteria 3984
74 Ga0070699_100073401 3300005518 Bacteria 2977
75 Ga0070699_100131816 3300005518 Bacteria 2203
76 Ga0070699_100201118 3300005518 Bacteria 1771
77 Ga0070699_100300978 3300005518 Bacteria 1439
78 Ga0070699_100323034 3300005518 Bacteria 1387
79 Ga0070679_100096333 3300005530 Bacteria 2946
80 Ga0070697_100002003 3300005536 Bacteria 15614
81 Ga0070697_100019475 3300005536 Bacteria 5361
82 Ga0070697_100076556 3300005536 Bacteria 2751
83 Ga0070697_100120944 3300005536 Bacteria 2190
84 Ga0070697_100263241 3300005536 Bacteria 1477
85 Ga0070697_100374162 3300005536 Bacteria 1233
86 Ga0070672_100191346 3300005543 Bacteria 1708
87 Ga0070686_100000174 3300005544 Bacteria 45207
88 Ga0070686_100028960 3300005544 Bacteria 3363
89 Ga0070686_100046572 3300005544 Bacteria 2737
90 Ga0070695_100353742 3300005545 Bacteria 1101
91 Ga0070696_100050869 3300005546 Bacteria 2881
92 Ga0070696_100225277 3300005546 Bacteria 1408
93 Ga0070696_100404520 3300005546 Unclassified 1069
94 Ga0070665_100012717 3300005548 Bacteria 8478
95 Ga0070665_100124542 3300005548 Bacteria 2579
96 Ga0070704_100067055 3300005549 Bacteria 2590
97 Ga0070704_100159650 3300005549 Bacteria 1782
98 Ga0070704_100243538 3300005549 Bacteria 1473
99 Ga0068855_100331079 3300005563 Bacteria 1681
100 Ga0070664_100005841 3300005564 Bacteria 9927
101 Ga0068854_100117048 3300005578 Bacteria 2018
102 Ga0068859_100000020 3300005617 Bacteria 247060
103 Ga0068859_100005416 3300005617 Bacteria 12972
104 Ga0068859_100015861 3300005617 Bacteria 7571
105 Ga0068859_100084664 3300005617 Bacteria 3215
106 Ga0068859_100343535 3300005617 Bacteria 1587
107 Ga0068859_100595522 3300005617 Bacteria 1199
108 Ga0068864_100030418 3300005618 Bacteria 4576
109 Ga0068861_100005092 3300005719 Bacteria 8863
110 Ga0068861_100025454 3300005719 Bacteria 4293
111 Ga0068870_10012331 3300005840 Bacteria 3992
112 Ga0068863_100054885 3300005841 Bacteria 3774
113 Ga0068858_100143088 3300005842 Bacteria 2246
114 Ga0068860_100005967 3300005843 Bacteria 12256
115 Ga0068860_100190399 3300005843 Bacteria 1985
116 Ga0068860_100248766 3300005843 Bacteria 1730
117 Ga0068862_100003143 3300005844 Bacteria 14358
118 Ga0068862_100075037 3300005844 Bacteria 2924
119 Ga0068862_100102895 3300005844 Bacteria 2500
120 Ga0081455_10000608 3300005937 Bacteria 46340
121 Ga0081455_10002585 3300005937 Bacteria 21454
122 Ga0081455_10029745 3300005937 Bacteria 4975
123 Ga0081538_10000250 3300005981 Bacteria 60946
124 Ga0081538_10000746 3300005981 Bacteria 35470
125 Ga0081538_10001299 3300005981 Bacteria 25836
126 Ga0081538_10002371 3300005981 Bacteria 18522
127 Ga0081538_10063656 3300005981 Bacteria 2092
128 Ga0081538_10096447 3300005981 Unclassified 1506
129 Ga0081540_1002521 3300005983 Bacteria 14871
130 Ga0081539_10013603 3300005985 Bacteria 6121
131 Ga0081539_10036280 3300005985 Bacteria 2953
132 Ga0081539_10086240 3300005985 Unclassified 1634
133 Ga0075365_10071291 3300006038 Bacteria 2339
134 Ga0070715_10040944 3300006163 Bacteria 1939
135 Ga0070712_100157834 3300006175 Bacteria 1749
136 Ga0075427_10003745 3300006194 Bacteria 2116
137 Ga0097621_100119649 3300006237 Bacteria 2232
138 Ga0097621_100246943 3300006237 Bacteria 1562
139 Ga0068871_100087050 3300006358 Bacteria 2596
140 Ga0075428_100082107 3300006844 Bacteria 3517
141 Ga0075430_100015098 3300006846 Bacteria 6574
142 Ga0075430_100303918 3300006846 Bacteria 1319
143 Ga0075430_100458716 3300006846 Bacteria 1052
144 Ga0075431_100000830 3300006847 Bacteria 26982
145 Ga0075431_100063480 3300006847 Bacteria 3812
146 Ga0075431_100093326 3300006847 Bacteria 3106
147 Ga0075431_100170754 3300006847 Bacteria 2234
148 Ga0075431_100311965 3300006847 Bacteria 1587
149 Ga0075433_10001069 3300006852 Bacteria 19675
150 Ga0075433_10004735 3300006852 Bacteria 10614
151 Ga0075433_10016739 3300006852 Bacteria 6053
152 Ga0075434_100002471 3300006871 Bacteria 16270
153 Ga0075434_100039407 3300006871 Bacteria 4682
154 Ga0075429_100057465 3300006880 Bacteria 3387
155 Ga0075429_100138933 3300006880 Bacteria 2127
156 Ga0075429_100445882 3300006880 Bacteria 1134
157 Ga0075436_100047527 3300006914 Bacteria 2960
158 Ga0075436_100052422 3300006914 Bacteria 2816
159 Ga0097620_100000020 3300006931 Bacteria 247060
160 Ga0097620_100005416 3300006931 Bacteria 12972
161 Ga0097620_100015860 3300006931 Bacteria 7571
162 Ga0097620_100084665 3300006931 Bacteria 3215
163 Ga0097620_100343543 3300006931 Bacteria 1587
164 Ga0097620_100595502 3300006931 Bacteria 1199
165 Ga0075435_100002461 3300007076 Bacteria 12304
166 Ga0075435_100016162 3300007076 Bacteria 5623
167 Ga0075435_100016233 3300007076 Bacteria 5613
168 Ga0075435_100223524 3300007076 Bacteria 1599
169 Ga0099794_10124780 3300007265 Bacteria 1297
170 Ga0111539_10014963 3300009094 Bacteria 9671
171 Ga0111539_10192975 3300009094 Bacteria 2376
172 Ga0111539_10216491 3300009094 Bacteria 2231
173 Ga0111539_10491847 3300009094 Bacteria 1429
174 Ga0111539_10521356 3300009094 Bacteria 1384
175 Ga0105245_10077241 3300009098 Bacteria 3035
176 Ga0105245_10901834 3300009098 Bacteria 926
177 Ga0114129_10000247 3300009147 Bacteria 60820
178 Ga0114129_10001417 3300009147 Bacteria 32326
179 Ga0114129_10032401 3300009147 Bacteria 7386
180 Ga0114129_10333086 3300009147 Bacteria 2015
181 Ga0114129_10510619 3300009147 Bacteria 1568
182 Ga0114129_10713496 3300009147 Unclassified 1288
183 Ga0105242_10333647 3300009176 Bacteria 1395
184 Ga0105248_10000986 3300009177 Bacteria 31580
185 Ga0105248_10386061 3300009177 Bacteria 1577
186 Ga0105248_10958025 3300009177 Bacteria 966
187 Ga0105249_10007788 3300009553 Bacteria 9333
188 Ga0105249_10050551 3300009553 Bacteria 3789
189 Ga0105249_10994668 3300009553 Bacteria 907
190 Ga0105239_10417704 3300010375 Bacteria 1519
191 Ga0105246_10267396 3300011119 Unclassified 1365
192 Ga0157371_10269122 3300013102 Bacteria 1229
193 Ga0157370_10316786 3300013104 Bacteria 1439
194 Ga0157374_10002664 3300013296 Bacteria 15039
195 Ga0157378_10140495 3300013297 Bacteria 2242
196 Ga0157378_10144371 3300013297 Bacteria 2213
197 Ga0163162_10019826 3300013306 Bacteria 6603
198 Ga0163162_10029919 3300013306 Bacteria 5392
199 Ga0163162_10091792 3300013306 Bacteria 3120
200 Ga0163162_10097976 3300013306 Bacteria 3021
201 Ga0157375_10023209 3300013308 Bacteria 5721
202 Ga0157375_10522676 3300013308 Bacteria 1350
203 Ga0163163_10005964 3300014325 Bacteria 10599
204 Ga0163163_10075623 3300014325 Bacteria 3361
205 Ga0157380_10001355 3300014326 Bacteria 15948
206 Ga0157380_10032751 3300014326 Bacteria 4000
207 Ga0157380_10057818 3300014326 Bacteria 3090
208 Ga0157379_10019313 3300014968 Bacteria 6018
209 Ga0157379_10093589 3300014968 Bacteria 2696
210 Ga0157379_10170781 3300014968 Bacteria 1963
211 Ga0157376_10191629 3300014969 Bacteria 1875
212 Ga0157376_10280946 3300014969 Bacteria 1568
213 Ga0163161_10019901 3300017792 Bacteria 4707
214 Ga0163161_10111632 3300017792 Bacteria 2044
215 Ga0197907_11249361 3300020069 Bacteria 1696
216 Ga0206356_11461437 3300020070 Bacteria 1709
217 Ga0206349_1175258 3300020075 Bacteria 1104
218 Ga0206349_1971054 3300020075 Bacteria 1374
219 Ga0206355_1175708 3300020076 Bacteria 2394
220 Ga0206351_10417438 3300020077 Bacteria 1138
221 Ga0206350_10445354 3300020080 Bacteria 1394
222 Ga0206350_11061128 3300020080 Bacteria 1177
223 Ga0206354_10069224 3300020081 Bacteria 1108
224 Ga0206353_12014134 3300020082 Bacteria 1346
225 Ga0154015_1007589 3300020610 Bacteria 1355
226 Ga0154015_1173907 3300020610 Bacteria 1246
227 Ga0213875_10002205 3300021388 Bacteria 11867
228 Ga0213871_10030980 3300021441 Bacteria 1394
229 Ga0224712_10019010 3300022467 Bacteria 2308
230 Ga0224712_10027152 3300022467 Bacteria 2033
231 Ga0207697_10004596 3300025315 Bacteria 6562
232 Ga0207688_10033652 3300025901 Bacteria 2835
233 Ga0207688_10238588 3300025901 Bacteria 1099
234 Ga0207680_10005391 3300025903 Bacteria 6110
235 Ga0207680_10009447 3300025903 Bacteria 4838
236 Ga0207647_10252765 3300025904 Unclassified 1010
237 Ga0207685_10011384 3300025905 Bacteria 2671
238 Ga0207699_10206590 3300025906 Bacteria 1334
239 Ga0207645_10035686 3300025907 Bacteria 3192
240 Ga0207643_10001235 3300025908 Bacteria 15094
241 Ga0207684_10001935 3300025910 Bacteria 21461
242 Ga0207684_10012769 3300025910 Bacteria 7284
243 Ga0207684_10031392 3300025910 Bacteria 4519
244 Ga0207684_10055984 3300025910 Bacteria 3345
245 Ga0207684_10098184 3300025910 Bacteria 2501
246 Ga0207684_10136772 3300025910 Bacteria 2104
247 Ga0207684_10254686 3300025910 Bacteria 1515
248 Ga0207707_10228528 3300025912 Bacteria 1619
249 Ga0207660_10348043 3300025917 Bacteria 1187
250 Ga0207662_10093593 3300025918 Bacteria 1852
251 Ga0207662_10137045 3300025918 Bacteria 1548
252 Ga0207662_10228177 3300025918 Bacteria 1215
253 Ga0207646_10000163 3300025922 Bacteria 90731
254 Ga0207646_10029900 3300025922 Bacteria 4945
255 Ga0207646_10102142 3300025922 Bacteria 2571
256 Ga0207646_10147921 3300025922 Bacteria 2117
257 Ga0207646_10173349 3300025922 Bacteria 1948
258 Ga0207646_10548759 3300025922 Bacteria 1039
259 Ga0207646_10731288 3300025922 Bacteria 884
260 Ga0207681_10152635 3300025923 Bacteria 1732
261 Ga0207650_10033610 3300025925 Bacteria 3715
262 Ga0207659_10091504 3300025926 Bacteria 2272
263 Ga0207687_10116804 3300025927 Bacteria 1989
264 Ga0207690_10145374 3300025932 Bacteria 1752
265 Ga0207706_10017023 3300025933 Bacteria 6558
266 Ga0207706_10154963 3300025933 Bacteria 2015
267 Ga0207686_10053538 3300025934 Bacteria 2523
268 Ga0207686_10260804 3300025934 Bacteria 1271
269 Ga0207670_10002638 3300025936 Bacteria 9436
270 Ga0207670_10004890 3300025936 Bacteria 7284
271 Ga0207670_10081782 3300025936 Bacteria 2262
272 Ga0207704_10121661 3300025938 Bacteria 1788
273 Ga0207691_10000326 3300025940 Bacteria 47354
274 Ga0207691_10002644 3300025940 Bacteria 17504
275 Ga0207711_10042042 3300025941 Bacteria 3893
276 Ga0207711_10068699 3300025941 Bacteria 3069
277 Ga0207711_10405407 3300025941 Bacteria 1267
278 Ga0207689_10047884 3300025942 Bacteria 3527
279 Ga0207689_10058420 3300025942 Bacteria 3173
280 Ga0207689_10094194 3300025942 Bacteria 2460
281 Ga0207689_10096116 3300025942 Bacteria 2433
282 Ga0207689_10254453 3300025942 Bacteria 1453
283 Ga0207679_10242203 3300025945 Bacteria 1529
284 Ga0207667_10312502 3300025949 Bacteria 1605
285 Ga0207651_10110359 3300025960 Bacteria 2063
286 Ga0207712_10019714 3300025961 Bacteria 4407
287 Ga0207712_10035316 3300025961 Bacteria 3395
288 Ga0207712_10320348 3300025961 Bacteria 1279
289 Ga0207668_10095747 3300025972 Bacteria 2192
290 Ga0207668_10398011 3300025972 Unclassified 1164
291 Ga0207658_10028226 3300025986 Bacteria 3951
292 Ga0207677_10101136 3300026023 Bacteria 2121
293 Ga0207678_10022707 3300026067 Bacteria 5494
294 Ga0207678_10148661 3300026067 Bacteria 2000
295 Ga0207708_10000207 3300026075 Bacteria 46522
296 Ga0207641_10091631 3300026088 Bacteria 2660
297 Ga0207648_10004605 3300026089 Bacteria 14141
298 Ga0207648_10029737 3300026089 Bacteria 4844
299 Ga0207676_10118955 3300026095 Bacteria 2224
300 Ga0207675_100002673 3300026118 Bacteria 17594
301 Ga0207675_100107757 3300026118 Bacteria 2627
302 Ga0207675_100177472 3300026118 Bacteria 2038
303 Ga0207675_100365378 3300026118 Unclassified 1417
304 Ga0207683_10015011 3300026121 Bacteria 6591
305 Ga0207683_10105200 3300026121 Bacteria 2523
306 Ga0209967_1001225 3300027364 Bacteria 3289
307 Ga0209995_1002421 3300027471 Bacteria 2945
308 Ga0209999_1001163 3300027543 Bacteria 4492
309 Ga0209970_1001245 3300027614 Bacteria 4502
310 Ga0210002_1000800 3300027617 Bacteria 4293
311 Ga0209983_1000398 3300027665 Bacteria 9318
312 Ga0209971_1000384 3300027682 Bacteria 12081
313 Ga0209974_10000498 3300027876 Bacteria 13115
314 Ga0207428_10018969 3300027907 Bacteria 5866
315 Ga0268266_10034583 3300028379 Bacteria 4297
316 Ga0268265_10010944 3300028380 Bacteria 6125
317 Ga0268265_10105297 3300028380 Bacteria 2288
318 Ga0268265_10341413 3300028380 Unclassified 1364
319 Ga0268264_10029061 3300028381 Bacteria 4526
320 Ga0268264_10046412 3300028381 Bacteria 3608
321 Ga0268264_10099936 3300028381 Bacteria 2519
322 Ga0268264_10421540 3300028381 Bacteria 1287
323 Ga0265329_10038952 3300031242 Bacteria 1529
324 Ga0265331_10097307 3300031250 Bacteria 1357
325 Ga0265327_10001686 3300031251 Bacteria 26426
326 Ga0265316_10003744 3300031344 Bacteria 15279
327 Ga0265316_10149380 3300031344 Bacteria 1751
328 Ga0307408_100011882 3300031548 Bacteria 5761
329 Ga0265342_10031591 3300031712 Bacteria 3273
330 Ga0316576_10169173 3300031727 Bacteria 1649
331 Ga0307405_10058678 3300031731 Bacteria 2423
332 Ga0307409_100789081 3300031995 Bacteria 956
333 Ga0307416_100797730 3300032002 Bacteria 1040
334 Ga0373923_0074924 3300035111 Bacteria 1460
335 Ga0373936_0118033 3300035113 Bacteria 1131
336 Ga0373941_0033207 3300035115 Bacteria 1550
337 Ga0373945_0047787 3300035116 Bacteria 1566
338 Ga0373945_0102919 3300035116 Bacteria 1119
339 Ga0373953_0151601 3300035117 Bacteria 994
340 Ga0373943_0047456 3300035170 Bacteria 2100
341 Ga0373943_0108946 3300035170 Bacteria 1458
342 Ga0373943_0171438 3300035170 Bacteria 1188
343 Ga0373946_0004730 3300035171 Bacteria 4892
344 Ga0373955_0038216 3300035172 Bacteria 2557
345 Ga0373955_0196023 3300035172 Bacteria 1202
346 Ga0373927_0000686 3300035695 Bacteria 25824
347 Ga0373947_0015225 3300035725 Bacteria 4416
348 Ga0373947_0022107 3300035725 Bacteria 3686
349 Ga0373937_0011850 3300036401 Bacteria 7658
350 Ga0373937_0254363 3300036401 Bacteria 1656
351 Ga0373937_0272014 3300036401 Bacteria 1599
352 Ga0373925_0005035 3300037068 Bacteria 9915
353 Ga0373925_0289174 3300037068 Bacteria 1321
354 Ga0373925_0454563 3300037068 Bacteria 1049
355 Ga0395898_0144326 3300037466 Bacteria 2279
356 Ga0395898_0259122 3300037466 Bacteria 1659
357 Ga0436364_0049523 3300037853 Bacteria 2311
358 Ga0436364_1054367 3300037853 Bacteria 18076
359 Ga0395901_0055292 3300038443 Bacteria 4128
360 Ga0395901_0075954 3300038443 Bacteria 3505
361 Ga0436360_0135897 3300039438 Bacteria 2135
362 Ga0436360_0222243 3300039438 Bacteria 17184
363 Ga0436361_0132586 3300039447 Bacteria 1485
364 Ga0436363_0064601 3300039450 Bacteria 789
365 Ga0436362_0209718 3300039453 Bacteria 2519
366 Ga0436362_0718647 3300039453 Bacteria 1080
367 Ga0439431_0003880 3300041997 Bacteria 3299
368 Ga0439446_0015171 3300042156 Bacteria 2135
369 Ga0439435_0012466 3300042436 Bacteria 2061
370 Ga0451577_0008521 3300042876 Bacteria 9973
371 Ga0451577_0011103 3300042876 Bacteria 8548
372 Ga0451577_0083369 3300042876 Bacteria 2852
373 Ga0453684_0001606 3300044712 Bacteria 62129
374 Ga0453684_0007159 3300044712 Bacteria 20757
375 Ga0453684_0015628 3300044712 Bacteria 11973
376 Ga0453684_0125803 3300044712 Bacteria 3085
377 Ga0451576_0097183 3300045051 Bacteria 3063
378 Ga0451576_0493861 3300045051 Bacteria 1286
379 Ga0495603_0042618 3300046455 Bacteria 2713
380 Ga0495580_0005582 3300046472 Bacteria 10367
381 Ga0495580_0116432 3300046472 Bacteria 1856
382 Ga0495580_0204377 3300046472 Bacteria 1360
383 Ga0495639_0002018 3300046475 Bacteria 8984
384 Ga0495662_0105830 3300046476 Bacteria 1377
385 Ga0495584_0189661 3300046491 Bacteria 1045
386 Ga0495594_0048874 3300046499 Bacteria 2324
387 Ga0495628_0157010 3300046516 Bacteria 1730
388 Ga0495586_0003305 3300046535 Bacteria 8648
389 Ga0495622_0023394 3300046557 Bacteria 2880
390 Ga0495667_0062096 3300046559 Bacteria 2449
391 Ga0495635_0139689 3300046663 Bacteria 1650
392 Ga0495647_0085224 3300046681 Bacteria 1287
393 Ga0495658_0126101 3300046683 Bacteria 1553
394 Ga0495600_0033474 3300046809 Bacteria 3337
395 Ga0495581_0324452 3300047315 Bacteria 899
396 Ga0495604_0019157 3300047317 Bacteria 5481
397 Ga0495636_0235516 3300047318 Unclassified 843
398 Ga0495680_0046852 3300047322 Bacteria 3406
399 Ga0495684_0040282 3300047471 Bacteria 3582
400 Ga0495684_0245951 3300047471 Bacteria 1303
401 Ga0495602_0139503 3300048088 Bacteria 1920
402 Ga0496102_0038005 3300048905 Bacteria 4342
403 Ga0496104_0054346 3300048907 Bacteria 3785
404 Ga0496104_0159245 3300048907 Bacteria 2166
405 Ga0496106_0014836 3300048909 Bacteria 5762
406 Ga0496107_0052447 3300048910 Bacteria 2942
407 Ga0496109_0088366 3300048912 Bacteria 2864
408 Ga0496110_0171259 3300048913 Bacteria 1970
409 Ga0496112_0325641 3300048915 Bacteria 1481
410 Ga0496112_0820488 3300048915 Bacteria 854
411 Ga0501325_011897 3300049541 Bacteria 811
412 Ga0501031_0082532 3300049568 Bacteria 2095
413 Ga0501033_0099559 3300049570 Bacteria 2123
414 Ga0501034_0810619 3300049571 Bacteria 828
415 Ga0501036_0027052 3300049572 Bacteria 4847
416 Ga0501036_0101440 3300049572 Bacteria 2434
417 Ga0501036_0607717 3300049572 Unclassified 907
418 Ga0501037_0036281 3300049573 Bacteria 3634
419 Ga0501037_0294953 3300049573 Bacteria 1127
420 Ga0501038_0083861 3300049574 Bacteria 2682
421 Ga0501038_0331921 3300049574 Unclassified 1188
422 Ga0501040_0002090 3300049576 Bacteria 12865
423 Ga0501040_0017211 3300049576 Bacteria 4798
424 Ga0501041_0014579 3300049577 Bacteria 4666
425 Ga0501041_0060800 3300049577 Bacteria 2312
426 Ga0501041_0138609 3300049577 Bacteria 1517
427 Ga0501042_0015328 3300049578 Bacteria 5248
428 Ga0501043_0096450 3300049579 Bacteria 2324
429 Ga0501046_0015916 3300049580 Bacteria 6307
430 Ga0501047_0023653 3300049581 Bacteria 5899
431 Ga0501048_0083340 3300049582 Bacteria 2255
432 Ga0501048_0184297 3300049582 Bacteria 1480
433 Ga0501068_0069310 3300049584 Bacteria 2150
434 Ga0501070_0068762 3300049586 Bacteria 2932
435 Ga0501071_0005094 3300049587 Bacteria 8413
436 Ga0501071_0171706 3300049587 Bacteria 1623
437 Ga0501072_0012190 3300049588 Bacteria 6569
438 Ga0501072_0110515 3300049588 Bacteria 2188
439 Ga0501072_0232881 3300049588 Bacteria 1467
440 Ga0501074_0010151 3300049590 Bacteria 6837
441 Ga0501074_0131789 3300049590 Bacteria 1788
442 Ga0501075_0008549 3300049591 Bacteria 7136
443 Ga0501075_0074803 3300049591 Bacteria 2562
444 Ga0501075_0172253 3300049591 Bacteria 1652
445 Ga0501075_0172408 3300049591 Bacteria 1651
446 Ga0501076_0001670 3300049592 Bacteria 15004
447 Ga0501076_0053562 3300049592 Bacteria 3198
448 Ga0501076_0063235 3300049592 Bacteria 2949
449 Ga0501076_0188215 3300049592 Bacteria 1684
450 Ga0501076_0440191 3300049592 Bacteria 1073
451 Ga0501076_0671345 3300049592 Unclassified 855
452 Ga0501077_0062233 3300049593 Bacteria 2368
453 Ga0501079_0037178 3300049741 Bacteria 3751
454 Ga0501079_0214887 3300049741 Bacteria 1502
455 Ga0501079_0642277 3300049741 Bacteria 836
456 Ga0501080_0301201 3300049742 Bacteria 1454
457 Ga0501081_0007089 3300049743 Bacteria 7285
458 Ga0501081_0079034 3300049743 Bacteria 2300
459 Ga0501081_0210773 3300049743 Bacteria 1411
460 Ga0501083_0028393 3300049744 Bacteria 3856
461 Ga0501083_0145624 3300049744 Bacteria 1551
462 Ga0501035_0720316 3300049822 Unclassified 803
463 Ga0501044_0002703 3300049823 Bacteria 20155
464 Ga0501045_0007683 3300049824 Bacteria 7499
465 Ga0501045_0015565 3300049824 Bacteria 5396
466 nmdc:mga0yw44_59287_c1 3300050492 Bacteria 2341
467 nmdc:mga05p37_1701_c1 3300050507 Bacteria 25630
468 nmdc:mga05p37_2405_c1 3300050507 Bacteria 21778
469 nmdc:mga05p37_35436_c1 3300050507 Bacteria 6119
470 nmdc:mga05p37_90847_c1 3300050507 Bacteria 3763
471 nmdc:mga09592_65437_c1 3300050508 Bacteria 3080
472 nmdc:mga0qj67_11591_c1 3300050509 Bacteria 6611
473 nmdc:mga0qj67_159371_c1 3300050509 Bacteria 1832
474 nmdc:mga0qj67_159848_c1 3300050509 Bacteria 1829
475 nmdc:mga0qj67_49532_c1 3300050509 Bacteria 3320
476 nmdc:mga06r32_120500_c1 3300050510 Bacteria 2587
477 nmdc:mga06r32_143481_c1 3300050510 Bacteria 2365
478 nmdc:mga06r32_183115_c1 3300050510 Bacteria 2081
479 nmdc:mga06r32_337413_c1 3300050510 Bacteria 1492
480 nmdc:mga06r32_9698_c1 3300050510 Bacteria 8699
481 nmdc:mga08y16_232213_c1 3300050511 Bacteria 1908
482 nmdc:mga08y16_285077_c1 3300050511 Bacteria 1703
483 nmdc:mga08y16_49775_c1 3300050511 Unclassified 4385
484 nmdc:mga0n895_54944_c1 3300050512 Bacteria 3918
485 nmdc:mga0n895_656071_c1 3300050512 Bacteria 1048
486 nmdc:mga0rr50_106330_c1 3300050513 Bacteria 2214
487 nmdc:mga0rr50_1883_c1 3300050513 Bacteria 11637
488 nmdc:mga0rr50_19331_c1 3300050513 Bacteria 4595
489 nmdc:mga0rr50_205879_c1 3300050513 Bacteria 1619
490 nmdc:mga0rr50_791564_c1 3300050513 Bacteria 809
491 nmdc:mga0rr50_89376_c1 3300050513 Bacteria 2395
492 nmdc:mga08x19_45596_c1 3300050514 Bacteria 2801
493 nmdc:mga08x19_62417_c1 3300050514 Bacteria 2416
494 nmdc:mga0a205_3344_c1 3300050515 Bacteria 14292
495 nmdc:mga0a205_6040_c1 3300050515 Bacteria 10923
496 Ga0495601_0008491 3300053077 Bacteria 6067
497 Ga0495601_0215421 3300053077 Bacteria 1254
498 Ga0495595_0014251 3300053084 Bacteria 3369
499 Ga0495619_0005474 3300053085 Bacteria 8050
500 Ga0501084_0009091 3300054114 Bacteria 8221
501 Ga0501084_0058482 3300054114 Bacteria 3226
502 Ga0501084_0224652 3300054114 Bacteria 1585
503 Ga0501084_0252474 3300054114 Bacteria 1489
504 Ga0501082_0000274 3300060353 Bacteria 45495
505 Ga0501082_0143173 3300060353 Bacteria 2075
506 Ga0530510_0006799 3300061734 Bacteria 7967
507 Ga0530510_0020217 3300061734 Bacteria 4735
508 Ga0530510_0141906 3300061734 Bacteria 1770
509 Ga0451577_0026875
510 JGI25407J50210_10002202
511 JGI25405J52794_10000957
512 Ga0058859_10039280
513 Ga0058859_11800547
514 Ga0058863_11953124
515 Ga0058860_12161439
516 Ga0058860_12235955
517 Ga0065704_10111069
518 Ga0070676_10063099
519 Ga0070683_100080539
520 Ga0070690_100001073
521 Ga0070690_100083973
522 Ga0070690_100304152
523 Ga0070670_100029424
524 Ga0068869_100050782
525 Ga0068869_100106502
526 Ga0070666_10001507
527 Ga0070666_10092190
528 Ga0070666_10129766
529 Ga0070660_100188271
530 Ga0070689_100045106
531 Ga0070689_100133946
532 Ga0070687_100105880
533 Ga0070692_10014546
534 Ga0070668_100087028
535 Ga0070669_100030262
536 Ga0070669_100046731
537 Ga0070675_100113128
538 Ga0070675_100222598
539 Ga0070671_100212824
540 Ga0070674_100007417
541 Ga0070673_100083639
542 Ga0070688_100002699
543 Ga0070659_100410638
544 Ga0070667_100064574
545 Ga0070705_100033441
546 Ga0070700_100012203
547 Ga0070694_100016219
548 Ga0070694_100035142
549 Ga0070708_100002882
550 Ga0070708_100017302
551 Ga0070708_100039269
552 Ga0070708_100053276
553 Ga0070708_100211418
554 Ga0070708_100221898
555 Ga0070663_100068862
556 Ga0070678_100009268
557 Ga0070662_100131184
558 Ga0070662_100252991
559 Ga0068867_100685355
560 Ga0070685_10002542
561 Ga0070685_10053096
562 Ga0070706_100005176
563 Ga0070706_100005771
564 Ga0070706_100007109
565 Ga0070706_100013417
566 Ga0070706_100039004
567 Ga0070706_100051166
568 Ga0070706_100299221
569 Ga0070706_100497998
570 Ga0070707_100000111
571 Ga0070707_100006596
572 Ga0070707_100152999
573 Ga0070707_100437390
574 Ga0070707_100662758
575 Ga0070698_100000222
576 Ga0070698_100016546
577 Ga0070698_100023411
578 Ga0070698_100045940
579 Ga0070698_100117871
580 Ga0070699_100007902
581 Ga0070699_100041483
582 Ga0070699_100073401
583 Ga0070699_100131816
584 Ga0070699_100201118
585 Ga0070699_100300978
586 Ga0070699_100323034
587 Ga0070679_100096333
588 Ga0070697_100002003
589 Ga0070697_100019475
590 Ga0070697_100076556
591 Ga0070697_100120944
592 Ga0070697_100263241
593 Ga0070697_100374162
594 Ga0070672_100191346
595 Ga0070686_100000174
596 Ga0070686_100028960
597 Ga0070686_100046572
598 Ga0070695_100353742
599 Ga0070696_100050869
600 Ga0070696_100225277
601 Ga0070696_100404520
602 Ga0070665_100012717
603 Ga0070665_100124542
604 Ga0070704_100067055
605 Ga0070704_100159650
606 Ga0070704_100243538
607 Ga0068855_100331079
608 Ga0070664_100005841
609 Ga0068854_100117048
610 Ga0068859_100000020
611 Ga0068859_100005416
612 Ga0068859_100015861
613 Ga0068859_100084664
614 Ga0068859_100343535
615 Ga0068859_100595522
616 Ga0068864_100030418
617 Ga0068861_100005092
618 Ga0068861_100025454
619 Ga0068870_10012331
620 Ga0068863_100054885
621 Ga0068858_100143088
622 Ga0068860_100005967
623 Ga0068860_100190399
624 Ga0068860_100248766
625 Ga0068862_100003143
626 Ga0068862_100075037
627 Ga0068862_100102895
628 Ga0081455_10000608
629 Ga0081455_10002585
630 Ga0081455_10029745
631 Ga0081538_10000250
632 Ga0081538_10000746
633 Ga0081538_10001299
634 Ga0081538_10002371
635 Ga0081538_10063656
636 Ga0081538_10096447
637 Ga0081540_1002521
638 Ga0081539_10013603
639 Ga0081539_10036280
640 Ga0081539_10086240
641 Ga0075365_10071291
642 Ga0070715_10040944
643 Ga0070712_100157834
644 Ga0075427_10003745
645 Ga0097621_100119649
646 Ga0097621_100246943
647 Ga0068871_100087050
648 Ga0075428_100082107
649 Ga0075430_100015098
650 Ga0075430_100303918
651 Ga0075430_100458716
652 Ga0075431_100000830
653 Ga0075431_100063480
654 Ga0075431_100093326
655 Ga0075431_100170754
656 Ga0075431_100311965
657 Ga0075433_10001069
658 Ga0075433_10004735
659 Ga0075433_10016739
660 Ga0075434_100002471
661 Ga0075434_100039407
662 Ga0075429_100057465
663 Ga0075429_100138933
664 Ga0075429_100445882
665 Ga0075436_100047527
666 Ga0075436_100052422
667 Ga0097620_100000020
668 Ga0097620_100005416
669 Ga0097620_100015860
670 Ga0097620_100084665
671 Ga0097620_100343543
672 Ga0097620_100595502
673 Ga0075435_100002461
674 Ga0075435_100016162
675 Ga0075435_100016233
676 Ga0075435_100223524
677 Ga0099794_10124780
678 Ga0111539_10014963
679 Ga0111539_10192975
680 Ga0111539_10216491
681 Ga0111539_10491847
682 Ga0111539_10521356
683 Ga0105245_10077241
684 Ga0105245_10901834
685 Ga0114129_10000247
686 Ga0114129_10001417
687 Ga0114129_10032401
688 Ga0114129_10333086
689 Ga0114129_10510619
690 Ga0114129_10713496
691 Ga0105242_10333647
692 Ga0105248_10000986
693 Ga0105248_10386061
694 Ga0105248_10958025
695 Ga0105249_10007788
696 Ga0105249_10050551
697 Ga0105249_10994668
698 Ga0105239_10417704
699 Ga0105246_10267396
700 Ga0157371_10269122
701 Ga0157370_10316786
702 Ga0157374_10002664
703 Ga0157378_10140495
704 Ga0157378_10144371
705 Ga0163162_10019826
706 Ga0163162_10029919
707 Ga0163162_10091792
708 Ga0163162_10097976
709 Ga0157375_10023209
710 Ga0157375_10522676
711 Ga0163163_10005964
712 Ga0163163_10075623
713 Ga0157380_10001355
714 Ga0157380_10032751
715 Ga0157380_10057818
716 Ga0157379_10019313
717 Ga0157379_10093589
718 Ga0157379_10170781
719 Ga0157376_10191629
720 Ga0157376_10280946
721 Ga0163161_10019901
722 Ga0163161_10111632
723 Ga0197907_11249361
724 Ga0206356_11461437
725 Ga0206349_1175258
726 Ga0206349_1971054
727 Ga0206355_1175708
728 Ga0206351_10417438
729 Ga0206350_10445354
730 Ga0206350_11061128
731 Ga0206354_10069224
732 Ga0206353_12014134
733 Ga0154015_1007589
734 Ga0154015_1173907
735 Ga0213875_10002205
736 Ga0213871_10030980
737 Ga0224712_10019010
738 Ga0224712_10027152
739 Ga0207697_10004596
740 Ga0207688_10033652
741 Ga0207688_10238588
742 Ga0207680_10005391
743 Ga0207680_10009447
744 Ga0207647_10252765
745 Ga0207685_10011384
746 Ga0207699_10206590
747 Ga0207645_10035686
748 Ga0207643_10001235
749 Ga0207684_10001935
750 Ga0207684_10012769
751 Ga0207684_10031392
752 Ga0207684_10055984
753 Ga0207684_10098184
754 Ga0207684_10136772
755 Ga0207684_10254686
756 Ga0207707_10228528
757 Ga0207660_10348043
758 Ga0207662_10093593
759 Ga0207662_10137045
760 Ga0207662_10228177
761 Ga0207646_10000163
762 Ga0207646_10029900
763 Ga0207646_10102142
764 Ga0207646_10147921
765 Ga0207646_10173349
766 Ga0207646_10548759
767 Ga0207646_10731288
768 Ga0207681_10152635
769 Ga0207650_10033610
770 Ga0207659_10091504
771 Ga0207687_10116804
772 Ga0207690_10145374
773 Ga0207706_10017023
774 Ga0207706_10154963
775 Ga0207686_10053538
776 Ga0207686_10260804
777 Ga0207670_10002638
778 Ga0207670_10004890
779 Ga0207670_10081782
780 Ga0207704_10121661
781 Ga0207691_10000326
782 Ga0207691_10002644
783 Ga0207711_10042042
784 Ga0207711_10068699
785 Ga0207711_10405407
786 Ga0207689_10047884
787 Ga0207689_10058420
788 Ga0207689_10094194
789 Ga0207689_10096116
790 Ga0207689_10254453
791 Ga0207679_10242203
792 Ga0207667_10312502
793 Ga0207651_10110359
794 Ga0207712_10019714
795 Ga0207712_10035316
796 Ga0207712_10320348
797 Ga0207668_10095747
798 Ga0207668_10398011
799 Ga0207658_10028226
800 Ga0207677_10101136
801 Ga0207678_10022707
802 Ga0207678_10148661
803 Ga0207708_10000207
804 Ga0207641_10091631
805 Ga0207648_10004605
806 Ga0207648_10029737
807 Ga0207676_10118955
808 Ga0207675_100002673
809 Ga0207675_100107757
810 Ga0207675_100177472
811 Ga0207675_100365378
812 Ga0207683_10015011
813 Ga0207683_10105200
814 Ga0209967_1001225
815 Ga0209995_1002421
816 Ga0209999_1001163
817 Ga0209970_1001245
818 Ga0210002_1000800
819 Ga0209983_1000398
820 Ga0209971_1000384
821 Ga0209974_10000498
822 Ga0207428_10018969
823 Ga0268266_10034583
824 Ga0268265_10010944
825 Ga0268265_10105297
826 Ga0268265_10341413
827 Ga0268264_10029061
828 Ga0268264_10046412
829 Ga0268264_10099936
830 Ga0268264_10421540
831 Ga0265329_10038952
832 Ga0265331_10097307
833 Ga0265327_10001686
834 Ga0265316_10003744
835 Ga0265316_10149380
836 Ga0307408_100011882
837 Ga0265342_10031591
838 Ga0316576_10169173
839 Ga0307405_10058678
840 Ga0307409_100789081
841 Ga0307416_100797730
842 Ga0373923_0074924
843 Ga0373936_0118033
844 Ga0373941_0033207
845 Ga0373945_0047787
846 Ga0373945_0102919
847 Ga0373953_0151601
848 Ga0373943_0047456
849 Ga0373943_0108946
850 Ga0373943_0171438
851 Ga0373946_0004730
852 Ga0373955_0038216
853 Ga0373955_0196023
854 Ga0373927_0000686
855 Ga0373947_0015225
856 Ga0373947_0022107
857 Ga0373937_0011850
858 Ga0373937_0254363
859 Ga0373937_0272014
860 Ga0373925_0005035
861 Ga0373925_0289174
862 Ga0373925_0454563
863 Ga0395898_0144326
864 Ga0395898_0259122
865 Ga0436364_0049523
866 Ga0436364_1054367
867 Ga0395901_0055292
868 Ga0395901_0075954
869 Ga0436360_0135897
870 Ga0436360_0222243
871 Ga0436361_0132586
872 Ga0436363_0064601
873 Ga0436362_0209718
874 Ga0436362_0718647
875 Ga0439431_0003880
876 Ga0439446_0015171
877 Ga0439435_0012466
878 Ga0451577_0008521
879 Ga0451577_0011103
880 Ga0451577_0083369
881 Ga0453684_0001606
882 Ga0453684_0007159
883 Ga0453684_0015628
884 Ga0453684_0125803
885 Ga0451576_0097183
886 Ga0451576_0493861
887 Ga0495603_0042618
888 Ga0495580_0005582
889 Ga0495580_0116432
890 Ga0495580_0204377
891 Ga0495639_0002018
892 Ga0495662_0105830
893 Ga0495584_0189661
894 Ga0495594_0048874
895 Ga0495628_0157010
896 Ga0495586_0003305
897 Ga0495622_0023394
898 Ga0495667_0062096
899 Ga0495635_0139689
900 Ga0495647_0085224
901 Ga0495658_0126101
902 Ga0495600_0033474
903 Ga0495581_0324452
904 Ga0495604_0019157
905 Ga0495636_0235516
906 Ga0495680_0046852
907 Ga0495684_0040282
908 Ga0495684_0245951
909 Ga0495602_0139503
910 Ga0496102_0038005
911 Ga0496104_0054346
912 Ga0496104_0159245
913 Ga0496106_0014836
914 Ga0496107_0052447
915 Ga0496109_0088366
916 Ga0496110_0171259
917 Ga0496112_0325641
918 Ga0496112_0820488
919 Ga0501325_011897
920 Ga0501031_0082532
921 Ga0501033_0099559
922 Ga0501034_0810619
923 Ga0501036_0027052
924 Ga0501036_0101440
925 Ga0501036_0607717
926 Ga0501037_0036281
927 Ga0501037_0294953
928 Ga0501038_0083861
929 Ga0501038_0331921
930 Ga0501040_0002090
931 Ga0501040_0017211
932 Ga0501041_0014579
933 Ga0501041_0060800
934 Ga0501041_0138609
935 Ga0501042_0015328
936 Ga0501043_0096450
937 Ga0501046_0015916
938 Ga0501047_0023653
939 Ga0501048_0083340
940 Ga0501048_0184297
941 Ga0501068_0069310
942 Ga0501070_0068762
943 Ga0501071_0005094
944 Ga0501071_0171706
945 Ga0501072_0012190
946 Ga0501072_0110515
947 Ga0501072_0232881
948 Ga0501074_0010151
949 Ga0501074_0131789
950 Ga0501075_0008549
951 Ga0501075_0074803
952 Ga0501075_0172253
953 Ga0501075_0172408
954 Ga0501076_0001670
955 Ga0501076_0053562
956 Ga0501076_0063235
957 Ga0501076_0188215
958 Ga0501076_0440191
959 Ga0501076_0671345
960 Ga0501077_0062233
961 Ga0501079_0037178
962 Ga0501079_0214887
963 Ga0501079_0642277
964 Ga0501080_0301201
965 Ga0501081_0007089
966 Ga0501081_0079034
967 Ga0501081_0210773
968 Ga0501083_0028393
969 Ga0501083_0145624
970 Ga0501035_0720316
971 Ga0501044_0002703
972 Ga0501045_0007683
973 Ga0501045_0015565
974 nmdc:mga0yw44_59287_c1
975 nmdc:mga05p37_1701_c1
976 nmdc:mga05p37_2405_c1
977 nmdc:mga05p37_35436_c1
978 nmdc:mga05p37_90847_c1
979 nmdc:mga09592_65437_c1
980 nmdc:mga0qj67_11591_c1
981 nmdc:mga0qj67_159371_c1
982 nmdc:mga0qj67_159848_c1
983 nmdc:mga0qj67_49532_c1
984 nmdc:mga06r32_120500_c1
985 nmdc:mga06r32_143481_c1
986 nmdc:mga06r32_183115_c1
987 nmdc:mga06r32_337413_c1
988 nmdc:mga06r32_9698_c1
989 nmdc:mga08y16_232213_c1
990 nmdc:mga08y16_285077_c1
991 nmdc:mga08y16_49775_c1
992 nmdc:mga0n895_54944_c1
993 nmdc:mga0n895_656071_c1
994 nmdc:mga0rr50_106330_c1
995 nmdc:mga0rr50_1883_c1
996 nmdc:mga0rr50_19331_c1
997 nmdc:mga0rr50_205879_c1
998 nmdc:mga0rr50_791564_c1
999 nmdc:mga0rr50_89376_c1
1000 nmdc:mga08x19_45596_c1
1001 nmdc:mga08x19_62417_c1
1002 nmdc:mga0a205_3344_c1
1003 nmdc:mga0a205_6040_c1
1004 Ga0495601_0008491
1005 Ga0495601_0215421
1006 Ga0495595_0014251
1007 Ga0495619_0005474
1008 Ga0501084_0009091
1009 Ga0501084_0058482
1010 Ga0501084_0224652
1011 Ga0501084_0252474
1012 Ga0501082_0000274
1013 Ga0501082_0143173
1014 Ga0530510_0006799
1015 Ga0530510_0020217
1016 Ga0530510_0141906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

11

240

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9928 1 234
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9913 1 234
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9911 1 234
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9895 1 235
4fuk-assembly1.cif.gz_A aminopeptidase from trypanosoma brucei 0.9847 1 234
ID Description Score Start End Superfamily
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9939 1 234 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9911 1 234 3.90.230.10
af_P9WK21_10_265_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9867 1 234 3.90.230.10
af_Q9VKV9_33_317_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9866 1 234 3.90.230.10
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9863 1 236 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7C7DIY6-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9989 1 236 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A356ZCU1-F1-model_v4 Type I methionyl aminopeptidase 0.9988 71 176 GO:0005829
GO:0006508
GO:0070006
AF-A0A7X7PQL7-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9986 2 236 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A381NBN9-F1-model_v4 Peptidase M24 domain-containing protein 0.9985 1 234 GO:0005829
GO:0006508
GO:0070006
AF-I3VU54-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9979 1 236 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Map