F456813

General Info

Members Datasets Scaffolds Average Seq Length
508 221 1016 163

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_10521805|Ga0163161_105218052
Length 196
Sequence MIVLASQLFKSQRPRTKAQSPYLPLPALRYTIPFMRRAIYPGSFDPLTNGHLDIIERGCKLFDEIIVSILVNPEKRPFFTLEERQEMLNDVLKDISQGGCEVRVDSFRGLLVTYAVAQQANAIVRGIRAISDYEYELQMALMNRRLEPSIETVFMMPGETYSYVSSRLVKEVFQLGGPIDGLVPPLIEKRMREKMK

Samples

Sample ID Description Type Environment
1 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
170 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
171 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
192 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
193 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
194 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
195 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
196 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
197 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
198 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
221 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.62
Stem 0
Stem Tuber 0
Unclassified 5.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163161_10521805 3300017792 Bacteria 970
2 JGI25406J46586_10042358 3300003203 Bacteria 1595
3 Ga0065704_10238561 3300005289 Unclassified 1022
4 Ga0065712_10014744 3300005290 Bacteria 2151
5 Ga0065715_10094934 3300005293 Unclassified 4208
6 Ga0065715_10203093 3300005293 Unclassified 1351
7 Ga0065715_10386068 3300005293 Bacteria 900
8 Ga0065707_10155162 3300005295 Bacteria 1616
9 Ga0065707_10183493 3300005295 Bacteria 1403
10 Ga0065707_10287435 3300005295 Bacteria 1033
11 Ga0070676_10097727 3300005328 Bacteria 1809
12 Ga0070676_10421078 3300005328 Bacteria 933
13 Ga0070690_100010843 3300005330 Bacteria 5316
14 Ga0070690_100294857 3300005330 Bacteria 1161
15 Ga0070670_100030463 3300005331 Bacteria 4647
16 Ga0068869_100035955 3300005334 Bacteria 3514
17 Ga0068869_100204908 3300005334 Bacteria 1557
18 Ga0068869_100223331 3300005334 Bacteria 1494
19 Ga0070680_100000085 3300005336 Bacteria 51915
20 Ga0070680_100218192 3300005336 Bacteria 1609
21 Ga0070680_100391679 3300005336 Bacteria 1184
22 Ga0068868_100020708 3300005338 Bacteria 4947
23 Ga0070687_100133534 3300005343 Bacteria 1436
24 Ga0070687_100697821 3300005343 Bacteria 708
25 Ga0070661_100029991 3300005344 Bacteria 3928
26 Ga0070692_10523493 3300005345 Bacteria 772
27 Ga0070669_100001795 3300005353 Bacteria 15423
28 Ga0070669_100072761 3300005353 Bacteria 2545
29 Ga0070669_100257163 3300005353 Bacteria 1392
30 Ga0070675_100071904 3300005354 Bacteria 2870
31 Ga0070671_100013494 3300005355 Bacteria 6587
32 Ga0070671_100192556 3300005355 Bacteria 1728
33 Ga0070671_100213578 3300005355 Bacteria 1636
34 Ga0070674_100314982 3300005356 Bacteria 1252
35 Ga0070674_100646804 3300005356 Unclassified 898
36 Ga0070673_100103756 3300005364 Bacteria 2346
37 Ga0070673_100135092 3300005364 Bacteria 2075
38 Ga0070673_100591062 3300005364 Bacteria 1012
39 Ga0070673_100834554 3300005364 Unclassified 852
40 Ga0070688_100132507 3300005365 Bacteria 1683
41 Ga0070688_100438035 3300005365 Bacteria 975
42 Ga0070659_100041257 3300005366 Bacteria 3606
43 Ga0070667_100134443 3300005367 Bacteria 2161
44 Ga0070667_100681002 3300005367 Bacteria 950
45 Ga0070703_10000590 3300005406 Bacteria 13107
46 Ga0070701_10003060 3300005438 Bacteria 6556
47 Ga0070701_10068188 3300005438 Bacteria 1895
48 Ga0070701_10174520 3300005438 Bacteria 1254
49 Ga0070705_100074659 3300005440 Bacteria 2062
50 Ga0070705_100080028 3300005440 Bacteria 2003
51 Ga0070705_100145333 3300005440 Bacteria 1566
52 Ga0070700_100002976 3300005441 Bacteria 8692
53 Ga0070700_100060784 3300005441 Bacteria 2382
54 Ga0070694_100000316 3300005444 Bacteria 25983
55 Ga0070694_100057532 3300005444 Unclassified 2643
56 Ga0070694_100142944 3300005444 Bacteria 1740
57 Ga0070708_100050012 3300005445 Bacteria 3699
58 Ga0070708_100129029 3300005445 Bacteria 2339
59 Ga0070663_100232482 3300005455 Bacteria 1452
60 Ga0070678_100107198 3300005456 Bacteria 2179
61 Ga0070662_100130322 3300005457 Bacteria 1938
62 Ga0070662_101443501 3300005457 Bacteria 593
63 Ga0070681_10000189 3300005458 Bacteria 47802
64 Ga0070681_10012448 3300005458 Bacteria 8440
65 Ga0068867_100029042 3300005459 Unclassified 3984
66 Ga0068867_100059137 3300005459 Bacteria 2841
67 Ga0068867_100142441 3300005459 Bacteria 1875
68 Ga0068867_100937458 3300005459 Bacteria 781
69 Ga0070685_10012900 3300005466 Bacteria 4399
70 Ga0070706_100282500 3300005467 Bacteria 1549
71 Ga0070706_100353477 3300005467 Bacteria 1369
72 Ga0070707_100000394 3300005468 Bacteria 43081
73 Ga0070707_100063714 3300005468 Bacteria 3538
74 Ga0070707_100369884 3300005468 Bacteria 1393
75 Ga0070707_101631780 3300005468 Bacteria 612
76 Ga0070698_100414812 3300005471 Bacteria 1280
77 Ga0070698_100799429 3300005471 Bacteria 887
78 Ga0070699_100106915 3300005518 Bacteria 2455
79 Ga0070699_100278978 3300005518 Bacteria 1497
80 Ga0070679_100000291 3300005530 Bacteria 42609
81 Ga0070684_100902394 3300005535 Bacteria 828
82 Ga0070697_100362698 3300005536 Bacteria 1253
83 Ga0068853_100005183 3300005539 Bacteria 10195
84 Ga0068853_100144379 3300005539 Bacteria 2138
85 Ga0070672_100074486 3300005543 Bacteria 2708
86 Ga0070672_100766814 3300005543 Bacteria 847
87 Ga0070672_101223083 3300005543 Bacteria 669
88 Ga0070686_100007543 3300005544 Bacteria 6075
89 Ga0070686_100077516 3300005544 Bacteria 2192
90 Ga0070695_100109425 3300005545 Bacteria 1873
91 Ga0070695_100250975 3300005545 Archaea 1288
92 Ga0070696_100090896 3300005546 Bacteria 2173
93 Ga0070696_100236236 3300005546 Bacteria 1377
94 Ga0070665_100038589 3300005548 Bacteria 4802
95 Ga0070704_100002430 3300005549 Bacteria 10449
96 Ga0070704_100055631 3300005549 Bacteria 2806
97 Ga0070704_100723647 3300005549 Unclassified 884
98 Ga0068855_101634544 3300005563 Bacteria 658
99 Ga0070664_100000776 3300005564 Bacteria 24631
100 Ga0068857_100023598 3300005577 Bacteria 5416
101 Ga0068854_100519975 3300005578 Bacteria 1005
102 Ga0070702_100060164 3300005615 Bacteria 2207
103 Ga0070702_100064644 3300005615 Bacteria 2141
104 Ga0070702_100611372 3300005615 Bacteria 819
105 Ga0068852_100252661 3300005616 Bacteria 1689
106 Ga0068859_100005862 3300005617 Bacteria 12470
107 Ga0068859_100012716 3300005617 Bacteria 8460
108 Ga0068859_100129300 3300005617 Bacteria 2596
109 Ga0068859_100288267 3300005617 Bacteria 1734
110 Ga0068859_100333995 3300005617 Bacteria 1610
111 Ga0068859_100398551 3300005617 Unclassified 1472
112 Ga0068859_101402045 3300005617 Bacteria 771
113 Ga0068864_100012078 3300005618 Bacteria 7134
114 Ga0068864_101847472 3300005618 Bacteria 610
115 Ga0068866_10104623 3300005718 Bacteria 1568
116 Ga0068861_100020872 3300005719 Bacteria 4700
117 Ga0068861_100072040 3300005719 Bacteria 2680
118 Ga0068861_100374594 3300005719 Bacteria 1256
119 Ga0068870_10130475 3300005840 Bacteria 1459
120 Ga0068870_10596860 3300005840 Bacteria 750
121 Ga0068870_10806273 3300005840 Bacteria 656
122 Ga0068863_100060333 3300005841 Bacteria 3587
123 Ga0068858_100037830 3300005842 Bacteria 4475
124 Ga0068858_100096062 3300005842 Bacteria 2761
125 Ga0068858_100450834 3300005842 Bacteria 1240
126 Ga0068860_100019050 3300005843 Bacteria 6663
127 Ga0068860_100045458 3300005843 Bacteria 4188
128 Ga0068860_100047639 3300005843 Bacteria 4085
129 Ga0068860_100572538 3300005843 Bacteria 1133
130 Ga0068862_100009515 3300005844 Bacteria 8039
131 Ga0068862_100035452 3300005844 Bacteria 4225
132 Ga0068862_100348486 3300005844 Unclassified 1373
133 Ga0068862_100665244 3300005844 Unclassified 1006
134 Ga0081539_10000411 3300005985 Bacteria 91279
135 Ga0097621_100158126 3300006237 Bacteria 1946
136 Ga0068871_100001650 3300006358 Bacteria 15016
137 Ga0068871_100025653 3300006358 Unclassified 4589
138 Ga0068871_100270769 3300006358 Bacteria 1483
139 Ga0068871_100716444 3300006358 Unclassified 918
140 Ga0068871_100827737 3300006358 Bacteria 855
141 Ga0068871_101312332 3300006358 Bacteria 681
142 Ga0075428_100017167 3300006844 Bacteria 7997
143 Ga0075428_100267323 3300006844 Bacteria 1840
144 Ga0075428_100737133 3300006844 Bacteria 1049
145 Ga0075428_101276973 3300006844 Bacteria 773
146 Ga0075430_100018282 3300006846 Bacteria 5966
147 Ga0075430_100028042 3300006846 Bacteria 4783
148 Ga0075430_100245464 3300006846 Bacteria 1484
149 Ga0075431_100023595 3300006847 Bacteria 6296
150 Ga0075431_100073219 3300006847 Bacteria 3534
151 Ga0075431_100217119 3300006847 Bacteria 1951
152 Ga0075433_10005347 3300006852 Bacteria 10079
153 Ga0075433_10036125 3300006852 Bacteria 4254
154 Ga0075433_10226907 3300006852 Bacteria 1659
155 Ga0075434_100197135 3300006871 Bacteria 2033
156 Ga0075434_100657698 3300006871 Bacteria 1066
157 Ga0075434_101359533 3300006871 Bacteria 721
158 Ga0075429_100000482 3300006880 Bacteria 29831
159 Ga0075429_100098665 3300006880 Bacteria 2548
160 Ga0075429_100124958 3300006880 Bacteria 2250
161 Ga0075429_100488777 3300006880 Bacteria 1078
162 Ga0068865_100008104 3300006881 Bacteria 6484
163 Ga0068865_100027746 3300006881 Bacteria 3743
164 Ga0075436_100287808 3300006914 Bacteria 1176
165 Ga0075436_100445611 3300006914 Bacteria 942
166 Ga0097620_100005862 3300006931 Bacteria 12470
167 Ga0097620_100012716 3300006931 Bacteria 8460
168 Ga0097620_100129298 3300006931 Bacteria 2596
169 Ga0097620_100288266 3300006931 Bacteria 1734
170 Ga0097620_100334006 3300006931 Bacteria 1610
171 Ga0097620_100398556 3300006931 Unclassified 1472
172 Ga0097620_101402064 3300006931 Bacteria 771
173 Ga0075435_100038963 3300007076 Bacteria 3792
174 Ga0075435_100821371 3300007076 Bacteria 809
175 Ga0105250_10311435 3300009092 Bacteria 682
176 Ga0111539_10001809 3300009094 Bacteria 28474
177 Ga0111539_10187500 3300009094 Bacteria 2415
178 Ga0111539_10355875 3300009094 Bacteria 1704
179 Ga0111539_10960462 3300009094 Bacteria 994
180 Ga0105245_10009914 3300009098 Bacteria 8297
181 Ga0114129_10024049 3300009147 Bacteria 8632
182 Ga0114129_10073033 3300009147 Bacteria 4780
183 Ga0114129_10434850 3300009147 Bacteria 1723
184 Ga0114129_10500996 3300009147 Bacteria 1586
185 Ga0114129_10945472 3300009147 Bacteria 1089
186 Ga0114129_12043889 3300009147 Bacteria 692
187 Ga0105243_10000024 3300009148 Bacteria 197391
188 Ga0105243_10012864 3300009148 Bacteria 6322
189 Ga0105243_10656625 3300009148 Unclassified 1017
190 Ga0105243_10696839 3300009148 Bacteria 989
191 Ga0105243_11623296 3300009148 Bacteria 674
192 Ga0105241_10164996 3300009174 Bacteria 1824
193 Ga0105241_10288946 3300009174 Bacteria 1403
194 Ga0105242_10000081 3300009176 Bacteria 65802
195 Ga0105242_10000502 3300009176 Bacteria 30880
196 Ga0105242_10020804 3300009176 Bacteria 5147
197 Ga0105248_10006121 3300009177 Bacteria 13199
198 Ga0105248_10050164 3300009177 Bacteria 4680
199 Ga0105248_10182549 3300009177 Bacteria 2364
200 Ga0105248_11092936 3300009177 Bacteria 901
201 Ga0105248_12088205 3300009177 Bacteria 644
202 Ga0105249_10067816 3300009553 Unclassified 3288
203 Ga0105249_10136050 3300009553 Bacteria 2351
204 Ga0105249_10492113 3300009553 Bacteria 1270
205 Ga0105249_10751749 3300009553 Bacteria 1037
206 Ga0105239_10190411 3300010375 Bacteria 2296
207 Ga0105246_10206727 3300011119 Bacteria 1530
208 Ga0105246_10643245 3300011119 Bacteria 922
209 Ga0157373_10011899 3300013100 Bacteria 6392
210 Ga0157371_10666963 3300013102 Bacteria 777
211 Ga0157374_10052644 3300013296 Bacteria 3793
212 Ga0157374_10096420 3300013296 Bacteria 2829
213 Ga0157378_10008510 3300013297 Bacteria 8930
214 Ga0157378_10008975 3300013297 Bacteria 8705
215 Ga0157378_10146728 3300013297 Bacteria 2195
216 Ga0157378_11164349 3300013297 Bacteria 810
217 Ga0157378_11892968 3300013297 Bacteria 645
218 Ga0163162_10001915 3300013306 Bacteria 19599
219 Ga0163162_10599143 3300013306 Unclassified 1228
220 Ga0163162_10695674 3300013306 Bacteria 1138
221 Ga0157372_10208596 3300013307 Bacteria 2264
222 Ga0157375_10030312 3300013308 Bacteria 5099
223 Ga0157375_10069666 3300013308 Bacteria 3524
224 Ga0157375_10122679 3300013308 Bacteria 2710
225 Ga0157375_10894650 3300013308 Bacteria 1032
226 Ga0157375_11382869 3300013308 Unclassified 829
227 Ga0163163_10003153 3300014325 Bacteria 13976
228 Ga0163163_10030026 3300014325 Bacteria 5232
229 Ga0163163_10047671 3300014325 Bacteria 4212
230 Ga0163163_10441477 3300014325 Bacteria 1361
231 Ga0157380_10123991 3300014326 Bacteria 2193
232 Ga0157380_10364021 3300014326 Bacteria 1358
233 Ga0157380_10386736 3300014326 Bacteria 1322
234 Ga0157380_10399651 3300014326 Bacteria 1303
235 Ga0157380_10729864 3300014326 Bacteria 999
236 Ga0157377_10374805 3300014745 Bacteria 962
237 Ga0157376_10054326 3300014969 Bacteria 3339
238 Ga0163161_10002410 3300017792 Bacteria 13411
239 Ga0213876_10000111 3300021384 Bacteria 89727
240 Ga0213876_10001396 3300021384 Bacteria 15072
241 Ga0207697_10026781 3300025315 Bacteria 2358
242 Ga0207653_10000303 3300025885 Bacteria 28140
243 Ga0207653_10011650 3300025885 Bacteria 2744
244 Ga0207688_10176513 3300025901 Bacteria 1272
245 Ga0207645_10020943 3300025907 Bacteria 4271
246 Ga0207645_10435463 3300025907 Bacteria 884
247 Ga0207645_10785212 3300025907 Bacteria 647
248 Ga0207643_10159832 3300025908 Bacteria 1355
249 Ga0207684_10142590 3300025910 Bacteria 2060
250 Ga0207684_10156583 3300025910 Bacteria 1961
251 Ga0207707_10000218 3300025912 Bacteria 61709
252 Ga0207707_10006171 3300025912 Bacteria 10469
253 Ga0207660_10240889 3300025917 Bacteria 1425
254 Ga0207660_10265233 3300025917 Bacteria 1359
255 Ga0207662_10002434 3300025918 Bacteria 9338
256 Ga0207662_10018196 3300025918 Bacteria 3982
257 Ga0207649_10502724 3300025920 Bacteria 922
258 Ga0207652_10000066 3300025921 Bacteria 110924
259 Ga0207652_10069698 3300025921 Bacteria 3053
260 Ga0207646_10002467 3300025922 Bacteria 21845
261 Ga0207646_10016833 3300025922 Bacteria 6856
262 Ga0207646_10603078 3300025922 Bacteria 985
263 Ga0207681_10001074 3300025923 Bacteria 17730
264 Ga0207681_10045183 3300025923 Unclassified 2956
265 Ga0207681_10093317 3300025923 Bacteria 2154
266 Ga0207681_10274359 3300025923 Bacteria 1325
267 Ga0207650_10028012 3300025925 Bacteria 4037
268 Ga0207650_11018009 3300025925 Unclassified 705
269 Ga0207659_10236662 3300025926 Bacteria 1475
270 Ga0207687_10385122 3300025927 Bacteria 1150
271 Ga0207687_10750264 3300025927 Unclassified 831
272 Ga0207690_10052265 3300025932 Bacteria 2736
273 Ga0207706_10157261 3300025933 Bacteria 1998
274 Ga0207706_10227382 3300025933 Bacteria 1633
275 Ga0207706_10574741 3300025933 Bacteria 969
276 Ga0207686_10000011 3300025934 Bacteria 216046
277 Ga0207686_10000012 3300025934 Bacteria 209763
278 Ga0207686_10197584 3300025934 Bacteria 1438
279 Ga0207709_10000042 3300025935 Bacteria 254145
280 Ga0207709_10224841 3300025935 Bacteria 1356
281 Ga0207709_10627674 3300025935 Bacteria 853
282 Ga0207709_10646552 3300025935 Bacteria 842
283 Ga0207670_10012435 3300025936 Bacteria 4982
284 Ga0207670_10713650 3300025936 Bacteria 831
285 Ga0207665_10281595 3300025939 Bacteria 1237
286 Ga0207691_10000799 3300025940 Bacteria 31267
287 Ga0207691_10217721 3300025940 Bacteria 1657
288 Ga0207691_10219052 3300025940 Bacteria 1651
289 Ga0207711_10108746 3300025941 Bacteria 2463
290 Ga0207711_10430784 3300025941 Bacteria 1227
291 Ga0207711_10922190 3300025941 Bacteria 812
292 Ga0207689_10002744 3300025942 Bacteria 16283
293 Ga0207689_10146351 3300025942 Bacteria 1946
294 Ga0207689_10319799 3300025942 Bacteria 1288
295 Ga0207689_10322687 3300025942 Bacteria 1282
296 Ga0207689_10604128 3300025942 Bacteria 923
297 Ga0207679_10009596 3300025945 Bacteria 6203
298 Ga0207651_10171866 3300025960 Bacteria 1710
299 Ga0207651_10333469 3300025960 Bacteria 1272
300 Ga0207651_10405694 3300025960 Unclassified 1160
301 Ga0207651_11239833 3300025960 Bacteria 670
302 Ga0207712_10134667 3300025961 Unclassified 1888
303 Ga0207658_10658733 3300025986 Bacteria 944
304 Ga0207677_10834199 3300026023 Bacteria 827
305 Ga0207703_10028900 3300026035 Bacteria 4375
306 Ga0207639_10015509 3300026041 Bacteria 5378
307 Ga0207708_10006252 3300026075 Bacteria 8825
308 Ga0207708_10017147 3300026075 Bacteria 5451
309 Ga0207708_10039985 3300026075 Bacteria 3574
310 Ga0207641_10074013 3300026088 Bacteria 2937
311 Ga0207641_10451546 3300026088 Bacteria 1242
312 Ga0207648_10001538 3300026089 Bacteria 25397
313 Ga0207648_10062632 3300026089 Unclassified 3242
314 Ga0207648_10173931 3300026089 Bacteria 1904
315 Ga0207676_10004662 3300026095 Bacteria 9710
316 Ga0207676_10916095 3300026095 Bacteria 860
317 Ga0207676_11411598 3300026095 Bacteria 692
318 Ga0207674_10000006 3300026116 Bacteria 233530
319 Ga0207674_10893562 3300026116 Bacteria 856
320 Ga0207675_100000501 3300026118 Bacteria 38076
321 Ga0207675_100038938 3300026118 Bacteria 4436
322 Ga0207683_10247877 3300026121 Bacteria 1625
323 Ga0207698_11721392 3300026142 Bacteria 642
324 Ga0209968_1015670 3300027526 Bacteria 1201
325 Ga0209971_1028238 3300027682 Bacteria 1342
326 Ga0209974_10073774 3300027876 Bacteria 1167
327 Ga0207428_10405143 3300027907 Unclassified 998
328 Ga0268265_10030652 3300028380 Bacteria 3876
329 Ga0268265_10043773 3300028380 Bacteria 3330
330 Ga0268264_10067602 3300028381 Bacteria 3017
331 Ga0268264_10126773 3300028381 Bacteria 2257
332 Ga0268264_10302858 3300028381 Bacteria 1505
333 Ga0268264_10414935 3300028381 Bacteria 1297
334 Ga0307515_10018849 3300028794 Bacteria 12459
335 Ga0316178_1164299 3300030735 Archaea 814
336 Ga0307513_10309147 3300031456 Bacteria 1344
337 Ga0307408_100015341 3300031548 Bacteria 5100
338 Ga0307408_100172771 3300031548 Bacteria 1727
339 Ga0307408_100177357 3300031548 Bacteria 1706
340 Ga0307408_100252491 3300031548 Bacteria 1455
341 Ga0307408_100334634 3300031548 Bacteria 1280
342 Ga0307408_101404867 3300031548 Unclassified 657
343 Ga0307405_10022967 3300031731 Bacteria 3536
344 Ga0307405_10208044 3300031731 Bacteria 1426
345 Ga0307405_10760867 3300031731 Bacteria 808
346 Ga0307405_11054916 3300031731 Bacteria 696
347 Ga0307413_10000186 3300031824 Bacteria 17765
348 Ga0307413_10532508 3300031824 Bacteria 949
349 Ga0307413_10867143 3300031824 Bacteria 764
350 Ga0307410_10008291 3300031852 Bacteria 5756
351 Ga0307410_10109787 3300031852 Bacteria 1994
352 Ga0307410_11736973 3300031852 Bacteria 553
353 Ga0307406_10032357 3300031901 Bacteria 3193
354 Ga0307406_10098579 3300031901 Bacteria 1985
355 Ga0307406_10414655 3300031901 Bacteria 1071
356 Ga0307406_10689457 3300031901 Bacteria 852
357 Ga0307406_10851642 3300031901 Bacteria 773
358 Ga0307406_11163000 3300031901 Unclassified 668
359 Ga0307407_10003224 3300031903 Bacteria 6628
360 Ga0307407_10162853 3300031903 Bacteria 1461
361 Ga0307407_10667142 3300031903 Bacteria 780
362 Ga0307412_10043374 3300031911 Bacteria 2928
363 Ga0307409_100001494 3300031995 Bacteria 11540
364 Ga0307409_100043338 3300031995 Bacteria 3378
365 Ga0307416_100118960 3300032002 Bacteria 2349
366 Ga0307416_100252495 3300032002 Bacteria 1717
367 Ga0307414_10042018 3300032004 Bacteria 3103
368 Ga0307414_10572161 3300032004 Bacteria 1010
369 Ga0307411_10004147 3300032005 Bacteria 6886
370 Ga0307415_100018432 3300032126 Bacteria 4216
371 Ga0307415_100222416 3300032126 Bacteria 1514
372 Ga0307415_101064597 3300032126 Bacteria 755
373 Ga0373925_0651781 3300037068 Bacteria 868
374 Ga0395900_0810304 3300037418 Bacteria 864
375 Ga0395905_0767504 3300037471 Bacteria 867
376 Ga0436365_0407503 3300039437 Bacteria 219857
377 Ga0436365_0785613 3300039437 Bacteria 45802
378 Ga0453683_0087387 3300044673 Bacteria 1954
379 Ga0453683_0340611 3300044673 Bacteria 962
380 Ga0451576_0097452 3300045051 Bacteria 3058
381 Ga0495659_0035856 3300046664 Bacteria 1750
382 Ga0501297_013276 3300049520 Bacteria 965
383 Ga0501298_006444 3300049521 Bacteria 1919
384 Ga0501299_009508 3300049522 Bacteria 1604
385 Ga0501033_0502861 3300049570 Bacteria 838
386 Ga0501036_0081901 3300049572 Bacteria 2728
387 Ga0501038_0201340 3300049574 Bacteria 1598
388 Ga0501038_0280676 3300049574 Bacteria 1311
389 Ga0501039_0191867 3300049575 Bacteria 1606
390 Ga0501039_0197019 3300049575 Bacteria 1584
391 Ga0501039_1297320 3300049575 Bacteria 562
392 Ga0501040_0016720 3300049576 Bacteria 4863
393 Ga0501040_0026766 3300049576 Bacteria 3879
394 Ga0501040_0101319 3300049576 Bacteria 2009
395 Ga0501040_0154827 3300049576 Bacteria 1618
396 Ga0501040_0285739 3300049576 Bacteria 1178
397 Ga0501040_0292190 3300049576 Bacteria 1165
398 Ga0501041_0276039 3300049577 Bacteria 1057
399 Ga0501042_0047448 3300049578 Bacteria 3063
400 Ga0501042_0117363 3300049578 Bacteria 1916
401 Ga0501046_0066309 3300049580 Bacteria 2814
402 Ga0501046_0197139 3300049580 Bacteria 1499
403 Ga0501048_0023525 3300049582 Bacteria 4501
404 Ga0501048_0041049 3300049582 Bacteria 3315
405 Ga0501067_0008688 3300049583 Bacteria 5628
406 Ga0501067_0230555 3300049583 Bacteria 1031
407 Ga0501068_0050067 3300049584 Bacteria 2525
408 Ga0501068_0146298 3300049584 Bacteria 1483
409 Ga0501068_0238821 3300049584 Bacteria 1156
410 Ga0501069_0073105 3300049585 Bacteria 1922
411 Ga0501069_0431488 3300049585 Bacteria 782
412 Ga0501070_0417688 3300049586 Bacteria 1084
413 Ga0501071_0023117 3300049587 Bacteria 4339
414 Ga0501071_0991514 3300049587 Bacteria 649
415 Ga0501071_1302923 3300049587 Bacteria 561
416 Ga0501072_0036158 3300049588 Bacteria 3871
417 Ga0501072_0078555 3300049588 Bacteria 2613
418 Ga0501072_0165065 3300049588 Bacteria 1767
419 Ga0501072_1297604 3300049588 Bacteria 564
420 Ga0501074_0022858 3300049590 Bacteria 4547
421 Ga0501075_0014937 3300049591 Bacteria 5570
422 Ga0501075_0096301 3300049591 Bacteria 2246
423 Ga0501075_0285028 3300049591 Bacteria 1258
424 Ga0501076_0018039 3300049592 Bacteria 5371
425 Ga0501076_0141742 3300049592 Bacteria 1953
426 Ga0501076_0145567 3300049592 Bacteria 1926
427 Ga0501076_0163308 3300049592 Bacteria 1815
428 Ga0501076_0548498 3300049592 Bacteria 953
429 Ga0501076_0551022 3300049592 Bacteria 951
430 Ga0501077_0001790 3300049593 Bacteria 12990
431 Ga0501077_0042643 3300049593 Bacteria 2885
432 Ga0501077_0070183 3300049593 Bacteria 2220
433 Ga0501077_0082237 3300049593 Bacteria 2041
434 Ga0501077_0113315 3300049593 Bacteria 1719
435 Ga0501207_059347 3300049654 Bacteria 698
436 Ga0501216_025977 3300049660 Bacteria 1055
437 Ga0501223_038839 3300049663 Bacteria 924
438 Ga0501235_009224 3300049669 Bacteria 2157
439 Ga0501235_082502 3300049669 Bacteria 769
440 Ga0501239_013732 3300049672 Bacteria 930
441 Ga0501247_030323 3300049677 Bacteria 736
442 Ga0501249_055985 3300049679 Bacteria 910
443 Ga0501259_008707 3300049688 Bacteria 1638
444 Ga0501225_0163923 3300049705 Bacteria 685
445 Ga0501079_0003986 3300049741 Bacteria 10912
446 Ga0501079_0009633 3300049741 Bacteria 7327
447 Ga0501079_0144374 3300049741 Bacteria 1854
448 Ga0501079_0494168 3300049741 Bacteria 962
449 Ga0501080_0091368 3300049742 Bacteria 2828
450 Ga0501080_0146833 3300049742 Bacteria 2180
451 Ga0501081_0000626 3300049743 Bacteria 20137
452 Ga0501081_0007524 3300049743 Bacteria 7064
453 Ga0501081_0012645 3300049743 Bacteria 5548
454 Ga0501083_0400336 3300049744 Bacteria 893
455 Ga0501272_016222 3300049769 Bacteria 871
456 Ga0501035_0392203 3300049822 Bacteria 1156
457 Ga0501045_0001736 3300049824 Bacteria 14685
458 Ga0501045_0029509 3300049824 Bacteria 3965
459 Ga0501045_0083029 3300049824 Bacteria 2363
460 nmdc:mga05p37_1575425_c1 3300050507 Bacteria 649
461 nmdc:mga05p37_231869_c1 3300050507 Bacteria 2224
462 nmdc:mga05p37_31875_c1 3300050507 Bacteria 6442
463 nmdc:mga05p37_501434_c1 3300050507 Bacteria 1393
464 nmdc:mga05p37_501553_c1 3300050507 Bacteria 1393
465 nmdc:mga09592_137098_c1 3300050508 Bacteria 2108
466 nmdc:mga09592_289222_c1 3300050508 Unclassified 1421
467 nmdc:mga09592_449509_c1 3300050508 Bacteria 1112
468 nmdc:mga09592_46116_c1 3300050508 Bacteria 3672
469 nmdc:mga09592_48486_c1 3300050508 Bacteria 1323
470 nmdc:mga0qj67_194074_c1 3300050509 Bacteria 1650
471 nmdc:mga0qj67_58363_c1 3300050509 Bacteria 3060
472 nmdc:mga0qj67_79359_c1 3300050509 Bacteria 2629
473 nmdc:mga06r32_1041507_c1 3300050510 Bacteria 769
474 nmdc:mga06r32_109857_c1 3300050510 Bacteria 2712
475 nmdc:mga06r32_13323_c1 3300050510 Bacteria 7447
476 nmdc:mga06r32_14394_c1 3300050510 Bacteria 7180
477 nmdc:mga06r32_472711_c1 3300050510 Bacteria 1232
478 nmdc:mga06r32_553054_c1 3300050510 Bacteria 1125
479 nmdc:mga08y16_237274_c1 3300050511 Bacteria 1885
480 nmdc:mga0n895_136239_c1 3300050512 Bacteria 2482
481 nmdc:mga0rr50_17448_c1 3300050513 Bacteria 4794
482 nmdc:mga08x19_147114_c1 3300050514 Bacteria 1594
483 nmdc:mga08x19_290483_c1 3300050514 Bacteria 1134
484 nmdc:mga08x19_453896_c1 3300050514 Bacteria 902
485 nmdc:mga08x19_576716_c1 3300050514 Bacteria 797
486 nmdc:mga0a205_225663_c1 3300050515 Bacteria 1758
487 nmdc:mga0a205_238867_c1 3300050515 Bacteria 1698
488 nmdc:mga0a205_287443_c1 3300050515 Bacteria 1519
489 Ga0501084_0001725 3300054114 Bacteria 17338
490 Ga0501084_0005239 3300054114 Bacteria 10613
491 Ga0501084_0108549 3300054114 Bacteria 2331
492 Ga0501084_0155357 3300054114 Bacteria 1929
493 Ga0501084_0214962 3300054114 Bacteria 1622
494 Ga0501084_0227168 3300054114 Bacteria 1575
495 Ga0590071_067936 3300059421 Bacteria 876
496 Ga0501082_0008654 3300060353 Bacteria 8775
497 Ga0501082_0011231 3300060353 Bacteria 7695
498 Ga0501082_0028742 3300060353 Bacteria 4789
499 Ga0501082_0094399 3300060353 Bacteria 2585
500 Ga0501082_0687461 3300060353 Bacteria 895
501 Ga0530510_0000450 3300061734 Bacteria 26655
502 Ga0530510_0001924 3300061734 Bacteria 14201
503 Ga0530510_0021657 3300061734 Bacteria 4574
504 Ga0530510_0022368 3300061734 Bacteria 4503
505 Ga0530510_0068029 3300061734 Bacteria 2584
506 Ga0530510_0748658 3300061734 Bacteria 745
507 2861522865 2861520306 Bacteria 8348283
508 2904479860 2904479285 Bacteria 5073931
509 Ga0163161_10521805
510 JGI25406J46586_10042358
511 Ga0065704_10238561
512 Ga0065712_10014744
513 Ga0065715_10094934
514 Ga0065715_10203093
515 Ga0065715_10386068
516 Ga0065707_10155162
517 Ga0065707_10183493
518 Ga0065707_10287435
519 Ga0070676_10097727
520 Ga0070676_10421078
521 Ga0070690_100010843
522 Ga0070690_100294857
523 Ga0070670_100030463
524 Ga0068869_100035955
525 Ga0068869_100204908
526 Ga0068869_100223331
527 Ga0070680_100000085
528 Ga0070680_100218192
529 Ga0070680_100391679
530 Ga0068868_100020708
531 Ga0070687_100133534
532 Ga0070687_100697821
533 Ga0070661_100029991
534 Ga0070692_10523493
535 Ga0070669_100001795
536 Ga0070669_100072761
537 Ga0070669_100257163
538 Ga0070675_100071904
539 Ga0070671_100013494
540 Ga0070671_100192556
541 Ga0070671_100213578
542 Ga0070674_100314982
543 Ga0070674_100646804
544 Ga0070673_100103756
545 Ga0070673_100135092
546 Ga0070673_100591062
547 Ga0070673_100834554
548 Ga0070688_100132507
549 Ga0070688_100438035
550 Ga0070659_100041257
551 Ga0070667_100134443
552 Ga0070667_100681002
553 Ga0070703_10000590
554 Ga0070701_10003060
555 Ga0070701_10068188
556 Ga0070701_10174520
557 Ga0070705_100074659
558 Ga0070705_100080028
559 Ga0070705_100145333
560 Ga0070700_100002976
561 Ga0070700_100060784
562 Ga0070694_100000316
563 Ga0070694_100057532
564 Ga0070694_100142944
565 Ga0070708_100050012
566 Ga0070708_100129029
567 Ga0070663_100232482
568 Ga0070678_100107198
569 Ga0070662_100130322
570 Ga0070662_101443501
571 Ga0070681_10000189
572 Ga0070681_10012448
573 Ga0068867_100029042
574 Ga0068867_100059137
575 Ga0068867_100142441
576 Ga0068867_100937458
577 Ga0070685_10012900
578 Ga0070706_100282500
579 Ga0070706_100353477
580 Ga0070707_100000394
581 Ga0070707_100063714
582 Ga0070707_100369884
583 Ga0070707_101631780
584 Ga0070698_100414812
585 Ga0070698_100799429
586 Ga0070699_100106915
587 Ga0070699_100278978
588 Ga0070679_100000291
589 Ga0070684_100902394
590 Ga0070697_100362698
591 Ga0068853_100005183
592 Ga0068853_100144379
593 Ga0070672_100074486
594 Ga0070672_100766814
595 Ga0070672_101223083
596 Ga0070686_100007543
597 Ga0070686_100077516
598 Ga0070695_100109425
599 Ga0070695_100250975
600 Ga0070696_100090896
601 Ga0070696_100236236
602 Ga0070665_100038589
603 Ga0070704_100002430
604 Ga0070704_100055631
605 Ga0070704_100723647
606 Ga0068855_101634544
607 Ga0070664_100000776
608 Ga0068857_100023598
609 Ga0068854_100519975
610 Ga0070702_100060164
611 Ga0070702_100064644
612 Ga0070702_100611372
613 Ga0068852_100252661
614 Ga0068859_100005862
615 Ga0068859_100012716
616 Ga0068859_100129300
617 Ga0068859_100288267
618 Ga0068859_100333995
619 Ga0068859_100398551
620 Ga0068859_101402045
621 Ga0068864_100012078
622 Ga0068864_101847472
623 Ga0068866_10104623
624 Ga0068861_100020872
625 Ga0068861_100072040
626 Ga0068861_100374594
627 Ga0068870_10130475
628 Ga0068870_10596860
629 Ga0068870_10806273
630 Ga0068863_100060333
631 Ga0068858_100037830
632 Ga0068858_100096062
633 Ga0068858_100450834
634 Ga0068860_100019050
635 Ga0068860_100045458
636 Ga0068860_100047639
637 Ga0068860_100572538
638 Ga0068862_100009515
639 Ga0068862_100035452
640 Ga0068862_100348486
641 Ga0068862_100665244
642 Ga0081539_10000411
643 Ga0097621_100158126
644 Ga0068871_100001650
645 Ga0068871_100025653
646 Ga0068871_100270769
647 Ga0068871_100716444
648 Ga0068871_100827737
649 Ga0068871_101312332
650 Ga0075428_100017167
651 Ga0075428_100267323
652 Ga0075428_100737133
653 Ga0075428_101276973
654 Ga0075430_100018282
655 Ga0075430_100028042
656 Ga0075430_100245464
657 Ga0075431_100023595
658 Ga0075431_100073219
659 Ga0075431_100217119
660 Ga0075433_10005347
661 Ga0075433_10036125
662 Ga0075433_10226907
663 Ga0075434_100197135
664 Ga0075434_100657698
665 Ga0075434_101359533
666 Ga0075429_100000482
667 Ga0075429_100098665
668 Ga0075429_100124958
669 Ga0075429_100488777
670 Ga0068865_100008104
671 Ga0068865_100027746
672 Ga0075436_100287808
673 Ga0075436_100445611
674 Ga0097620_100005862
675 Ga0097620_100012716
676 Ga0097620_100129298
677 Ga0097620_100288266
678 Ga0097620_100334006
679 Ga0097620_100398556
680 Ga0097620_101402064
681 Ga0075435_100038963
682 Ga0075435_100821371
683 Ga0105250_10311435
684 Ga0111539_10001809
685 Ga0111539_10187500
686 Ga0111539_10355875
687 Ga0111539_10960462
688 Ga0105245_10009914
689 Ga0114129_10024049
690 Ga0114129_10073033
691 Ga0114129_10434850
692 Ga0114129_10500996
693 Ga0114129_10945472
694 Ga0114129_12043889
695 Ga0105243_10000024
696 Ga0105243_10012864
697 Ga0105243_10656625
698 Ga0105243_10696839
699 Ga0105243_11623296
700 Ga0105241_10164996
701 Ga0105241_10288946
702 Ga0105242_10000081
703 Ga0105242_10000502
704 Ga0105242_10020804
705 Ga0105248_10006121
706 Ga0105248_10050164
707 Ga0105248_10182549
708 Ga0105248_11092936
709 Ga0105248_12088205
710 Ga0105249_10067816
711 Ga0105249_10136050
712 Ga0105249_10492113
713 Ga0105249_10751749
714 Ga0105239_10190411
715 Ga0105246_10206727
716 Ga0105246_10643245
717 Ga0157373_10011899
718 Ga0157371_10666963
719 Ga0157374_10052644
720 Ga0157374_10096420
721 Ga0157378_10008510
722 Ga0157378_10008975
723 Ga0157378_10146728
724 Ga0157378_11164349
725 Ga0157378_11892968
726 Ga0163162_10001915
727 Ga0163162_10599143
728 Ga0163162_10695674
729 Ga0157372_10208596
730 Ga0157375_10030312
731 Ga0157375_10069666
732 Ga0157375_10122679
733 Ga0157375_10894650
734 Ga0157375_11382869
735 Ga0163163_10003153
736 Ga0163163_10030026
737 Ga0163163_10047671
738 Ga0163163_10441477
739 Ga0157380_10123991
740 Ga0157380_10364021
741 Ga0157380_10386736
742 Ga0157380_10399651
743 Ga0157380_10729864
744 Ga0157377_10374805
745 Ga0157376_10054326
746 Ga0163161_10002410
747 Ga0213876_10000111
748 Ga0213876_10001396
749 Ga0207697_10026781
750 Ga0207653_10000303
751 Ga0207653_10011650
752 Ga0207688_10176513
753 Ga0207645_10020943
754 Ga0207645_10435463
755 Ga0207645_10785212
756 Ga0207643_10159832
757 Ga0207684_10142590
758 Ga0207684_10156583
759 Ga0207707_10000218
760 Ga0207707_10006171
761 Ga0207660_10240889
762 Ga0207660_10265233
763 Ga0207662_10002434
764 Ga0207662_10018196
765 Ga0207649_10502724
766 Ga0207652_10000066
767 Ga0207652_10069698
768 Ga0207646_10002467
769 Ga0207646_10016833
770 Ga0207646_10603078
771 Ga0207681_10001074
772 Ga0207681_10045183
773 Ga0207681_10093317
774 Ga0207681_10274359
775 Ga0207650_10028012
776 Ga0207650_11018009
777 Ga0207659_10236662
778 Ga0207687_10385122
779 Ga0207687_10750264
780 Ga0207690_10052265
781 Ga0207706_10157261
782 Ga0207706_10227382
783 Ga0207706_10574741
784 Ga0207686_10000011
785 Ga0207686_10000012
786 Ga0207686_10197584
787 Ga0207709_10000042
788 Ga0207709_10224841
789 Ga0207709_10627674
790 Ga0207709_10646552
791 Ga0207670_10012435
792 Ga0207670_10713650
793 Ga0207665_10281595
794 Ga0207691_10000799
795 Ga0207691_10217721
796 Ga0207691_10219052
797 Ga0207711_10108746
798 Ga0207711_10430784
799 Ga0207711_10922190
800 Ga0207689_10002744
801 Ga0207689_10146351
802 Ga0207689_10319799
803 Ga0207689_10322687
804 Ga0207689_10604128
805 Ga0207679_10009596
806 Ga0207651_10171866
807 Ga0207651_10333469
808 Ga0207651_10405694
809 Ga0207651_11239833
810 Ga0207712_10134667
811 Ga0207658_10658733
812 Ga0207677_10834199
813 Ga0207703_10028900
814 Ga0207639_10015509
815 Ga0207708_10006252
816 Ga0207708_10017147
817 Ga0207708_10039985
818 Ga0207641_10074013
819 Ga0207641_10451546
820 Ga0207648_10001538
821 Ga0207648_10062632
822 Ga0207648_10173931
823 Ga0207676_10004662
824 Ga0207676_10916095
825 Ga0207676_11411598
826 Ga0207674_10000006
827 Ga0207674_10893562
828 Ga0207675_100000501
829 Ga0207675_100038938
830 Ga0207683_10247877
831 Ga0207698_11721392
832 Ga0209968_1015670
833 Ga0209971_1028238
834 Ga0209974_10073774
835 Ga0207428_10405143
836 Ga0268265_10030652
837 Ga0268265_10043773
838 Ga0268264_10067602
839 Ga0268264_10126773
840 Ga0268264_10302858
841 Ga0268264_10414935
842 Ga0307515_10018849
843 Ga0316178_1164299
844 Ga0307513_10309147
845 Ga0307408_100015341
846 Ga0307408_100172771
847 Ga0307408_100177357
848 Ga0307408_100252491
849 Ga0307408_100334634
850 Ga0307408_101404867
851 Ga0307405_10022967
852 Ga0307405_10208044
853 Ga0307405_10760867
854 Ga0307405_11054916
855 Ga0307413_10000186
856 Ga0307413_10532508
857 Ga0307413_10867143
858 Ga0307410_10008291
859 Ga0307410_10109787
860 Ga0307410_11736973
861 Ga0307406_10032357
862 Ga0307406_10098579
863 Ga0307406_10414655
864 Ga0307406_10689457
865 Ga0307406_10851642
866 Ga0307406_11163000
867 Ga0307407_10003224
868 Ga0307407_10162853
869 Ga0307407_10667142
870 Ga0307412_10043374
871 Ga0307409_100001494
872 Ga0307409_100043338
873 Ga0307416_100118960
874 Ga0307416_100252495
875 Ga0307414_10042018
876 Ga0307414_10572161
877 Ga0307411_10004147
878 Ga0307415_100018432
879 Ga0307415_100222416
880 Ga0307415_101064597
881 Ga0373925_0651781
882 Ga0395900_0810304
883 Ga0395905_0767504
884 Ga0436365_0407503
885 Ga0436365_0785613
886 Ga0453683_0087387
887 Ga0453683_0340611
888 Ga0451576_0097452
889 Ga0495659_0035856
890 Ga0501297_013276
891 Ga0501298_006444
892 Ga0501299_009508
893 Ga0501033_0502861
894 Ga0501036_0081901
895 Ga0501038_0201340
896 Ga0501038_0280676
897 Ga0501039_0191867
898 Ga0501039_0197019
899 Ga0501039_1297320
900 Ga0501040_0016720
901 Ga0501040_0026766
902 Ga0501040_0101319
903 Ga0501040_0154827
904 Ga0501040_0285739
905 Ga0501040_0292190
906 Ga0501041_0276039
907 Ga0501042_0047448
908 Ga0501042_0117363
909 Ga0501046_0066309
910 Ga0501046_0197139
911 Ga0501048_0023525
912 Ga0501048_0041049
913 Ga0501067_0008688
914 Ga0501067_0230555
915 Ga0501068_0050067
916 Ga0501068_0146298
917 Ga0501068_0238821
918 Ga0501069_0073105
919 Ga0501069_0431488
920 Ga0501070_0417688
921 Ga0501071_0023117
922 Ga0501071_0991514
923 Ga0501071_1302923
924 Ga0501072_0036158
925 Ga0501072_0078555
926 Ga0501072_0165065
927 Ga0501072_1297604
928 Ga0501074_0022858
929 Ga0501075_0014937
930 Ga0501075_0096301
931 Ga0501075_0285028
932 Ga0501076_0018039
933 Ga0501076_0141742
934 Ga0501076_0145567
935 Ga0501076_0163308
936 Ga0501076_0548498
937 Ga0501076_0551022
938 Ga0501077_0001790
939 Ga0501077_0042643
940 Ga0501077_0070183
941 Ga0501077_0082237
942 Ga0501077_0113315
943 Ga0501207_059347
944 Ga0501216_025977
945 Ga0501223_038839
946 Ga0501235_009224
947 Ga0501235_082502
948 Ga0501239_013732
949 Ga0501247_030323
950 Ga0501249_055985
951 Ga0501259_008707
952 Ga0501225_0163923
953 Ga0501079_0003986
954 Ga0501079_0009633
955 Ga0501079_0144374
956 Ga0501079_0494168
957 Ga0501080_0091368
958 Ga0501080_0146833
959 Ga0501081_0000626
960 Ga0501081_0007524
961 Ga0501081_0012645
962 Ga0501083_0400336
963 Ga0501272_016222
964 Ga0501035_0392203
965 Ga0501045_0001736
966 Ga0501045_0029509
967 Ga0501045_0083029
968 nmdc:mga05p37_1575425_c1
969 nmdc:mga05p37_231869_c1
970 nmdc:mga05p37_31875_c1
971 nmdc:mga05p37_501434_c1
972 nmdc:mga05p37_501553_c1
973 nmdc:mga09592_137098_c1
974 nmdc:mga09592_289222_c1
975 nmdc:mga09592_449509_c1
976 nmdc:mga09592_46116_c1
977 nmdc:mga09592_48486_c1
978 nmdc:mga0qj67_194074_c1
979 nmdc:mga0qj67_58363_c1
980 nmdc:mga0qj67_79359_c1
981 nmdc:mga06r32_1041507_c1
982 nmdc:mga06r32_109857_c1
983 nmdc:mga06r32_13323_c1
984 nmdc:mga06r32_14394_c1
985 nmdc:mga06r32_472711_c1
986 nmdc:mga06r32_553054_c1
987 nmdc:mga08y16_237274_c1
988 nmdc:mga0n895_136239_c1
989 nmdc:mga0rr50_17448_c1
990 nmdc:mga08x19_147114_c1
991 nmdc:mga08x19_290483_c1
992 nmdc:mga08x19_453896_c1
993 nmdc:mga08x19_576716_c1
994 nmdc:mga0a205_225663_c1
995 nmdc:mga0a205_238867_c1
996 nmdc:mga0a205_287443_c1
997 Ga0501084_0001725
998 Ga0501084_0005239
999 Ga0501084_0108549
1000 Ga0501084_0155357
1001 Ga0501084_0214962
1002 Ga0501084_0227168
1003 Ga0590071_067936
1004 Ga0501082_0008654
1005 Ga0501082_0011231
1006 Ga0501082_0028742
1007 Ga0501082_0094399
1008 Ga0501082_0687461
1009 Ga0530510_0000450
1010 Ga0530510_0001924
1011 Ga0530510_0021657
1012 Ga0530510_0022368
1013 Ga0530510_0068029
1014 Ga0530510_0748658
1015 2861522865
1016 2904479860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

39

172

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b7b-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 5-methoxy-2-methyl-1h-indole 0.9637 2 162
7yy8-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 12 0.9636 1 160
5o0a-assembly1.cif.gz_B crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 5-methyl-1-phenyl-pyrazole-4-carboxylic acid (fragment 1) 0.9605 1 160
6b7d-assembly1.cif.gz_A crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5-dimethylpyridazine 0.9586 2 162
7yyb-assembly1.cif.gz_B-2 crystal structure of mycobacterium abscessus phosphopantetheine adenylyltransferase in complex with fragment 15 0.9574 1 160
ID Description Score Start End Superfamily
3nbkD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.949 1 161 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9449 1 164 3.40.50.620
4f3rC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9403 1 156 3.40.50.620
3nd7D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9398 2 159 3.40.50.620
6g7vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9386 1 164 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2V8QWP6-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9884 2 164 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A2V8QWP6-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9766 2 164 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A853HS31-F1-model_v4 deleted 0.9757 2 160
AF-A0A2E9X7P9-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) (Dephospho-CoA pyrophosphorylase) (Pantetheine-phosphate adenylyltransferase) (PPAT) 0.9752 2 164 GO:0004595
GO:0005524
GO:0005737
GO:0015937
AF-A0A0W8E794-F1-model_v4 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) 0.9743 1 162 GO:0004595
GO:0005737
GO:0015937

Map