F456497

General Info

Members Datasets Scaffolds Average Seq Length
506 307 479 324

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10027242|Ga0081455_100272424
Length 380
Sequence MLPEPREATRPVDGTGSVEGMRPEPVEGPGPQQAQPEDAIRHRIARGGLTARSARAERAIKQRPRRLRTTAAMRAMVGETSLEPRQLILPMFVAEGLREPRPISSMPGVVQHTLDTLRKAAVEAADAGLAGIMIFGVPLHKDARGSGALDPDGILTSAIRAVREEVGDECLVMSDVCLDEFTDHGHCGVLTPSGAVDNDATVEIYAQMAVLHAAAGVHAVGPSGMMDGQVGAIREALDASGASDVAILAYSVKYASAFYGPFREAVASSLKGNRRTYQQDPANIREALREVALDVAQGADIVMVKPALGYLDVVRAIRDAVDLPVAAYNVSGEYAMVEAAAANGWINKEPAIDEALTSIRRAGADLILTYWALDWATRRR

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2582580736 Prauserella sp. Am3 Isolate Unclassified
3 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
4 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
5 2643221692 Nocardia sp. Root136 Isolate Unclassified
6 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
7 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
8 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
9 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
10 2857727296 Kocuria sp. R-72562 Isolate Unclassified
11 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
12 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
13 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
14 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
15 2891562705 Microbispora tritici MT50 Isolate Unclassified
16 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
17 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
18 2919395869 Microbacterium resistens 2980 Isolate Unclassified
19 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
20 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
21 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
22 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
23 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
158 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
173 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
174 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
196 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
197 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
198 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
199 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
200 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
201 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
204 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
205 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
206 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
207 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
229 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
246 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
247 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
279 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
305 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
306 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
307 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.27
Metatranscriptomes 0.4
Isolates 5.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 3.95
Nodule 0
Rhizoplane 5.14
Rhizosphere 80.43
Stem 0
Stem Tuber 0.2
Unclassified 10.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055527_1000004 3300003760 Bacteria 570634
2 Ga0055542_1000307 3300003762 Bacteria 53734
3 Ga0055529_1000008 3300003763 Bacteria 394786
4 Ga0065704_10013689 3300005289 Bacteria 2274
5 Ga0070683_100001274 3300005329 Bacteria 19172
6 Ga0070690_100010742 3300005330 Bacteria 5338
7 Ga0068869_100001068 3300005334 Bacteria 15991
8 Ga0068869_100065905 3300005334 Bacteria 2667
9 Ga0070682_100000058 3300005337 Bacteria 108660
10 Ga0070682_100007342 3300005337 Bacteria 6214
11 Ga0070682_100106362 3300005337 Bacteria 1862
12 Ga0070691_10019500 3300005341 Bacteria 3130
13 Ga0070668_100036466 3300005347 Bacteria 3753
14 Ga0070668_100137868 3300005347 Bacteria 1964
15 Ga0070675_100524807 3300005354 Bacteria 1069
16 Ga0070671_100049432 3300005355 Bacteria 3499
17 Ga0070674_100196885 3300005356 Bacteria 1553
18 Ga0070674_100384800 3300005356 Bacteria 1142
19 Ga0070673_100002546 3300005364 Bacteria 11126
20 Ga0070673_100051230 3300005364 Bacteria 3231
21 Ga0070659_100084619 3300005366 Bacteria 2536
22 Ga0070709_10024506 3300005434 Bacteria 3552
23 Ga0070714_100185501 3300005435 Bacteria 1895
24 Ga0070713_100248616 3300005436 Bacteria 1621
25 Ga0070713_100400917 3300005436 Bacteria 1281
26 Ga0070710_10033737 3300005437 Bacteria 2781
27 Ga0070710_10036755 3300005437 Bacteria 2679
28 Ga0070701_10033237 3300005438 Bacteria 2576
29 Ga0070701_10036611 3300005438 Bacteria 2473
30 Ga0070705_100201873 3300005440 Bacteria 1364
31 Ga0070708_100009263 3300005445 Bacteria 7937
32 Ga0070663_100000466 3300005455 Bacteria 21362
33 Ga0070662_100164497 3300005457 Bacteria 1737
34 Ga0070706_100002380 3300005467 Bacteria 18992
35 Ga0070706_100010066 3300005467 Bacteria 8784
36 Ga0070706_100083189 3300005467 Bacteria 2965
37 Ga0070706_100087100 3300005467 Bacteria 2895
38 Ga0070706_100104662 3300005467 Bacteria 2632
39 Ga0070706_100452652 3300005467 Bacteria 1194
40 Ga0070707_100003232 3300005468 Bacteria 15432
41 Ga0070707_100003789 3300005468 Bacteria 14265
42 Ga0070707_100016745 3300005468 Bacteria 6880
43 Ga0070707_100030838 3300005468 Bacteria 5107
44 Ga0070707_100357966 3300005468 Bacteria 1417
45 Ga0070698_100000714 3300005471 Bacteria 35621
46 Ga0070698_100001437 3300005471 Bacteria 26406
47 Ga0070698_100006891 3300005471 Bacteria 12313
48 Ga0070698_100032056 3300005471 Bacteria 5446
49 Ga0070698_100161885 3300005471 Bacteria 2181
50 Ga0070699_100047802 3300005518 Bacteria 3702
51 Ga0070699_100053439 3300005518 Bacteria 3496
52 Ga0070684_100058667 3300005535 Bacteria 3364
53 Ga0070697_100000498 3300005536 Bacteria 29802
54 Ga0070697_100029782 3300005536 Bacteria 4380
55 Ga0068853_100304606 3300005539 Bacteria 1474
56 Ga0070686_100011190 3300005544 Bacteria 5083
57 Ga0070695_100128520 3300005545 Bacteria 1743
58 Ga0070696_100099173 3300005546 Bacteria 2084
59 Ga0068854_100084121 3300005578 Bacteria 2354
60 Ga0070702_100023668 3300005615 Bacteria 3267
61 Ga0070702_100143758 3300005615 Bacteria 1523
62 Ga0068859_100275148 3300005617 Unclassified 1776
63 Ga0068866_10028539 3300005718 Bacteria 2660
64 Ga0068866_10086160 3300005718 Bacteria 1699
65 Ga0068861_100024992 3300005719 Bacteria 4325
66 Ga0068861_100319490 3300005719 Bacteria 1352
67 Ga0068851_10029742 3300005834 Bacteria 2706
68 Ga0068870_10046503 3300005840 Bacteria 2276
69 Ga0068858_100109711 3300005842 Bacteria 2576
70 Ga0068860_100474080 3300005843 Bacteria 1247
71 Ga0081455_10001759 3300005937 Bacteria 26177
72 Ga0081455_10011389 3300005937 Bacteria 8940
73 Ga0081455_10018266 3300005937 Bacteria 6690
74 Ga0081455_10027242 3300005937 Bacteria 5238
75 Ga0081455_10071989 3300005937 Bacteria 2864
76 Ga0081538_10001441 3300005981 Bacteria 24455
77 Ga0081538_10043813 3300005981 Bacteria 2802
78 Ga0081539_10000015 3300005985 Bacteria 395781
79 Ga0081539_10000362 3300005985 Bacteria 99991
80 Ga0081539_10000380 3300005985 Bacteria 96999
81 Ga0081539_10007107 3300005985 Bacteria 10348
82 Ga0070717_10002872 3300006028 Bacteria 12222
83 Ga0070717_10169731 3300006028 Bacteria 1897
84 Ga0070717_10177824 3300006028 Bacteria 1853
85 Ga0075364_10007108 3300006051 Bacteria 6619
86 Ga0075364_10031335 3300006051 Bacteria 3417
87 Ga0075364_10081037 3300006051 Bacteria 2146
88 Ga0075432_10000184 3300006058 Bacteria 15938
89 Ga0075432_10003361 3300006058 Bacteria 5407
90 Ga0070715_10000657 3300006163 Bacteria 9236
91 Ga0070715_10020702 3300006163 Bacteria 2540
92 Ga0070712_100025975 3300006175 Bacteria 3897
93 Ga0075367_10075177 3300006178 Bacteria 2037
94 Ga0075370_10029167 3300006353 Bacteria 3071
95 Ga0075428_100006350 3300006844 Bacteria 13153
96 Ga0075428_100009656 3300006844 Bacteria 10714
97 Ga0075428_100019966 3300006844 Bacteria 7419
98 Ga0075428_100024519 3300006844 Bacteria 6675
99 Ga0075428_100186544 3300006844 Bacteria 2244
100 Ga0075430_100014397 3300006846 Bacteria 6740
101 Ga0075431_100006189 3300006847 Bacteria 11879
102 Ga0075431_100022671 3300006847 Bacteria 6419
103 Ga0075433_10002351 3300006852 Bacteria 14387
104 Ga0075433_10002630 3300006852 Bacteria 13710
105 Ga0075434_100003332 3300006871 Bacteria 14373
106 Ga0075434_100164442 3300006871 Bacteria 2239
107 Ga0075434_100239528 3300006871 Bacteria 1834
108 Ga0075429_100000914 3300006880 Bacteria 23365
109 Ga0075429_100024002 3300006880 Bacteria 5290
110 Ga0068865_100018705 3300006881 Bacteria 4474
111 Ga0075436_100008179 3300006914 Bacteria 7159
112 Ga0075436_100060034 3300006914 Bacteria 2627
113 Ga0097620_100275120 3300006931 Unclassified 1776
114 Ga0075435_100001797 3300007076 Bacteria 13948
115 Ga0075435_100014600 3300007076 Bacteria 5878
116 Ga0099794_10025660 3300007265 Bacteria 2717
117 Ga0111539_10009361 3300009094 Bacteria 12367
118 Ga0111539_10015527 3300009094 Bacteria 9468
119 Ga0111539_10018696 3300009094 Bacteria 8580
120 Ga0105245_10116909 3300009098 Bacteria 2487
121 Ga0105245_10405728 3300009098 Bacteria 1363
122 Ga0105245_10448253 3300009098 Bacteria 1298
123 Ga0114129_10002093 3300009147 Bacteria 27442
124 Ga0114129_10029868 3300009147 Bacteria 7720
125 Ga0114129_10092576 3300009147 Bacteria 4188
126 Ga0105243_10003944 3300009148 Bacteria 11845
127 Ga0105243_10039200 3300009148 Bacteria 3692
128 Ga0105243_10169767 3300009148 Bacteria 1888
129 Ga0105241_10465943 3300009174 Bacteria 1120
130 Ga0105242_10031687 3300009176 Bacteria 4225
131 Ga0105242_10135756 3300009176 Bacteria 2129
132 Ga0105248_10034951 3300009177 Bacteria 5624
133 Ga0105238_10063204 3300009551 Bacteria 3702
134 Ga0105249_10000686 3300009553 Bacteria 30797
135 Ga0105249_10239212 3300009553 Bacteria 1794
136 Ga0105239_10047982 3300010375 Bacteria 4681
137 Ga0105246_10039969 3300011119 Bacteria 3163
138 Ga0157369_10212846 3300013105 Bacteria 2025
139 Ga0157378_10083575 3300013297 Bacteria 2890
140 Ga0157378_10185602 3300013297 Bacteria 1959
141 Ga0163162_10000714 3300013306 Bacteria 30817
142 Ga0163162_10017149 3300013306 Bacteria 7085
143 Ga0163162_10095574 3300013306 Bacteria 3059
144 Ga0163162_10373155 3300013306 Bacteria 1560
145 Ga0157372_10042623 3300013307 Bacteria 5021
146 Ga0157372_10094103 3300013307 Bacteria 3411
147 Ga0157375_10027019 3300013308 Bacteria 5359
148 Ga0157375_10031357 3300013308 Bacteria 5024
149 Ga0157375_10168716 3300013308 Bacteria 2335
150 Ga0157375_10461668 3300013308 Bacteria 1435
151 Ga0157380_10030725 3300014326 Bacteria 4116
152 Ga0157380_10071792 3300014326 Bacteria 2801
153 Ga0157380_10077643 3300014326 Bacteria 2707
154 Ga0157380_10298406 3300014326 Bacteria 1483
155 Ga0157380_10574639 3300014326 Bacteria 1110
156 Ga0157376_10142594 3300014969 Bacteria 2151
157 Ga0157376_10297748 3300014969 Bacteria 1526
158 Ga0163161_10180319 3300017792 Bacteria 1619
159 Ga0197907_10936403 3300020069 Bacteria 3304
160 Ga0213873_10036333 3300021358 Bacteria 1250
161 Ga0213876_10000097 3300021384 Bacteria 99326
162 Ga0224712_10054803 3300022467 Bacteria 1566
163 Ga0209672_100011 3300025228 Bacteria 856297
164 Ga0209147_100238 3300025229 Bacteria 54120
165 Ga0209258_102859 3300025242 Bacteria 4106
166 Ga0209148_1000023 3300025254 Bacteria 680511
167 Ga0209455_1000023 3300025272 Bacteria 680449
168 Ga0207685_10022435 3300025905 Bacteria 2134
169 Ga0207699_10031730 3300025906 Bacteria 2969
170 Ga0207684_10011531 3300025910 Bacteria 7723
171 Ga0207684_10062472 3300025910 Bacteria 3163
172 Ga0207684_10078962 3300025910 Bacteria 2799
173 Ga0207684_10296465 3300025910 Bacteria 1394
174 Ga0207693_10003243 3300025915 Bacteria 13959
175 Ga0207693_10023030 3300025915 Bacteria 4946
176 Ga0207663_10048691 3300025916 Bacteria 2625
177 Ga0207662_10182314 3300025918 Bacteria 1351
178 Ga0207646_10001355 3300025922 Bacteria 30398
179 Ga0207646_10007603 3300025922 Bacteria 10978
180 Ga0207646_10017864 3300025922 Bacteria 6624
181 Ga0207646_10018738 3300025922 Bacteria 6451
182 Ga0207681_10001481 3300025923 Bacteria 15139
183 Ga0207659_10362468 3300025926 Bacteria 1205
184 Ga0207687_10076949 3300025927 Bacteria 2398
185 Ga0207687_10332037 3300025927 Bacteria 1234
186 Ga0207700_10075875 3300025928 Bacteria 2606
187 Ga0207700_10197213 3300025928 Bacteria 1695
188 Ga0207664_10016628 3300025929 Bacteria 5372
189 Ga0207664_10068591 3300025929 Bacteria 2849
190 Ga0207664_10474367 3300025929 Bacteria 1119
191 Ga0207644_10192342 3300025931 Unclassified 1605
192 Ga0207690_10032143 3300025932 Bacteria 3364
193 Ga0207690_10241088 3300025932 Bacteria 1392
194 Ga0207706_10001492 3300025933 Bacteria 23254
195 Ga0207706_10054731 3300025933 Bacteria 3520
196 Ga0207686_10077399 3300025934 Bacteria 2160
197 Ga0207709_10041876 3300025935 Bacteria 2751
198 Ga0207709_10058724 3300025935 Bacteria 2392
199 Ga0207669_10320820 3300025937 Bacteria 1186
200 Ga0207665_10021898 3300025939 Bacteria 4202
201 Ga0207711_10189771 3300025941 Bacteria 1872
202 Ga0207689_10003120 3300025942 Bacteria 15198
203 Ga0207689_10038748 3300025942 Bacteria 3946
204 Ga0207661_10005787 3300025944 Bacteria 8718
205 Ga0207661_10274659 3300025944 Bacteria 1505
206 Ga0207679_10080183 3300025945 Bacteria 2492
207 Ga0207651_10002572 3300025960 Bacteria 8667
208 Ga0207651_10039690 3300025960 Bacteria 3107
209 Ga0207651_10109600 3300025960 Bacteria 2069
210 Ga0207712_10042805 3300025961 Bacteria 3121
211 Ga0207712_10094432 3300025961 Bacteria 2209
212 Ga0207668_10195572 3300025972 Bacteria 1606
213 Ga0207703_10098929 3300026035 Bacteria 2468
214 Ga0207678_10001240 3300026067 Bacteria 23521
215 Ga0207708_10050427 3300026075 Bacteria 3168
216 Ga0207648_10061459 3300026089 Bacteria 3276
217 Ga0207648_10264035 3300026089 Bacteria 1537
218 Ga0207676_10062318 3300026095 Bacteria 2958
219 Ga0207674_10149299 3300026116 Bacteria 2295
220 Ga0207674_10337703 3300026116 Bacteria 1457
221 Ga0207675_100018820 3300026118 Bacteria 6444
222 Ga0207675_100100967 3300026118 Bacteria 2718
223 Ga0207675_100195860 3300026118 Bacteria 1939
224 Ga0207675_100215648 3300026118 Bacteria 1848
225 Ga0207683_10357156 3300026121 Bacteria 1342
226 Ga0207428_10002940 3300027907 Bacteria 16876
227 Ga0207428_10003495 3300027907 Bacteria 15231
228 Ga0207428_10019672 3300027907 Bacteria 5754
229 Ga0268264_10256560 3300028381 Bacteria 1627
230 Ga0307515_10061235 3300028794 Bacteria 5345
231 Ga0307515_10361680 3300028794 Bacteria 1092
232 Ga0307512_10003620 3300030522 Bacteria 17667
233 Ga0307513_10002630 3300031456 Bacteria 24801
234 Ga0307408_100007224 3300031548 Bacteria 7347
235 Ga0307408_100014447 3300031548 Bacteria 5246
236 Ga0307408_100097670 3300031548 Bacteria 2232
237 Ga0307508_10308395 3300031616 Bacteria 1175
238 Ga0316579_10013858 3300031691 Bacteria 3476
239 Ga0316576_10002382 3300031727 Bacteria 10690
240 Ga0316576_10006560 3300031727 Bacteria 7258
241 Ga0307405_10000853 3300031731 Bacteria 12028
242 Ga0307405_10012780 3300031731 Bacteria 4459
243 Ga0307413_10003683 3300031824 Bacteria 6511
244 Ga0307518_10000304 3300031838 Bacteria 37119
245 Ga0307410_10000043 3300031852 Bacteria 43864
246 Ga0307410_10005698 3300031852 Bacteria 6632
247 Ga0307410_10006019 3300031852 Bacteria 6501
248 Ga0307410_10022611 3300031852 Bacteria 3890
249 Ga0307410_10221690 3300031852 Bacteria 1455
250 Ga0326468_10000684 3300031889 Bacteria 3455
251 Ga0307406_10000008 3300031901 Bacteria 120233
252 Ga0307406_10001097 3300031901 Bacteria 15087
253 Ga0307406_10060327 3300031901 Bacteria 2445
254 Ga0307406_10084608 3300031901 Bacteria 2118
255 Ga0307407_10000710 3300031903 Bacteria 10840
256 Ga0307407_10019224 3300031903 Bacteria 3474
257 Ga0307407_10023064 3300031903 Bacteria 3241
258 Ga0307407_10152056 3300031903 Bacteria 1505
259 Ga0307412_10035016 3300031911 Bacteria 3204
260 Ga0307412_10285825 3300031911 Bacteria 1297
261 Ga0307409_100000014 3300031995 Bacteria 62867
262 Ga0307409_100018426 3300031995 Bacteria 4694
263 Ga0307409_100018590 3300031995 Bacteria 4678
264 Ga0307409_100104053 3300031995 Bacteria 2363
265 Ga0307409_100545899 3300031995 Bacteria 1137
266 Ga0307416_100000088 3300032002 Bacteria 62911
267 Ga0307416_100005302 3300032002 Bacteria 7903
268 Ga0307416_100009589 3300032002 Bacteria 6346
269 Ga0307416_100040502 3300032002 Bacteria 3620
270 Ga0307416_100193113 3300032002 Bacteria 1923
271 Ga0307414_10005251 3300032004 Bacteria 7120
272 Ga0307414_10010021 3300032004 Bacteria 5474
273 Ga0307414_10029734 3300032004 Bacteria 3560
274 Ga0307414_10525028 3300032004 Bacteria 1051
275 Ga0307411_10000384 3300032005 Bacteria 15110
276 Ga0307411_10001875 3300032005 Bacteria 8954
277 Ga0307411_10027653 3300032005 Bacteria 3435
278 Ga0307411_10124053 3300032005 Bacteria 1875
279 Ga0307411_10271422 3300032005 Bacteria 1345
280 Ga0307415_100005409 3300032126 Bacteria 6779
281 Ga0316583_10022857 3300032133 Bacteria 2236
282 Ga0316585_10003308 3300032137 Bacteria 4428
283 Ga0307507_10081783 3300033179 Bacteria 2836
284 Ga0373926_0000105 3300035083 Bacteria 16863
285 Ga0373926_0020627 3300035083 Bacteria 2276
286 Ga0373944_0024133 3300035089 Bacteria 1779
287 Ga0373951_0000647 3300035091 Bacteria 9579
288 Ga0373923_0033268 3300035111 Bacteria 2087
289 Ga0373936_0061346 3300035113 Bacteria 1535
290 Ga0373945_0062352 3300035116 Bacteria 1393
291 Ga0373946_0040448 3300035171 Bacteria 1907
292 Ga0373931_0074438 3300035691 Bacteria 1860
293 Ga0373931_0142459 3300035691 Bacteria 1390
294 Ga0373935_0001250 3300035692 Bacteria 14055
295 Ga0373935_0471643 3300035692 Bacteria 908
296 Ga0373927_0004229 3300035695 Bacteria 10080
297 Ga0373947_0001176 3300035725 Bacteria 16097
298 Ga0373947_0100431 3300035725 Bacteria 1818
299 Ga0316582_0167678 3300036647 Bacteria 1489
300 Ga0373925_0010217 3300037068 Bacteria 6813
301 Ga0373925_0121540 3300037068 Bacteria 2027
302 Ga0373925_0160531 3300037068 Bacteria 1770
303 Ga0373925_0247639 3300037068 Bacteria 1429
304 Ga0395900_0368741 3300037418 Bacteria 1406
305 Ga0395898_0000270 3300037466 Bacteria 127152
306 Ga0395898_0453820 3300037466 Bacteria 1221
307 Ga0395905_0068847 3300037471 Bacteria 3315
308 Ga0395905_0129753 3300037471 Bacteria 2371
309 Ga0395901_0364908 3300038443 Bacteria 1488
310 Ga0436365_1423688 3300039437 Bacteria 102720
311 Ga0436361_0482415 3300039447 Bacteria 1515
312 Ga0436362_0798161 3300039453 Bacteria 1015
313 Ga0439461_0030165 3300041410 Bacteria 1126
314 Ga0439465_0023461 3300041413 Bacteria 1942
315 Ga0451791_0616002 3300041451 Bacteria 3343
316 Ga0451793_0867764 3300041452 Bacteria 3059
317 Ga0451797_0330067 3300041453 Bacteria 1925
318 Ga0451837_1025066 3300041494 Bacteria 2474
319 Ga0451843_0941436 3300041509 Bacteria 1080
320 Ga0451853_0239579 3300041512 Bacteria 8675
321 Ga0451853_1222744 3300041512 Bacteria 1731
322 Ga0439448_0007405 3300042005 Bacteria 3182
323 Ga0439455_0005850 3300042012 Bacteria 2520
324 Ga0439463_000980 3300042016 Bacteria 7776
325 Ga0439463_003339 3300042016 Bacteria 4063
326 Ga0450888_001537 3300042126 Bacteria 2223
327 Ga0439435_0004082 3300042436 Bacteria 3111
328 Ga0439459_0009516 3300042438 Bacteria 1682
329 Ga0439464_0002196 3300042439 Bacteria 4769
330 Ga0439460_0009369 3300042461 Bacteria 2486
331 Ga0451577_0166319 3300042876 Bacteria 1987
332 Ga0466961_0005970 3300044693 Bacteria 7717
333 Ga0466963_0077132 3300044694 Bacteria 2251
334 Ga0466971_0021785 3300044719 Bacteria 2852
335 Ga0466971_0040643 3300044719 Bacteria 2089
336 Ga0466970_0186519 3300044765 Bacteria 1152
337 Ga0466960_0027543 3300044901 Bacteria 2593
338 Ga0466958_0046436 3300045836 Bacteria 2621
339 Ga0495603_0006482 3300046455 Bacteria 7010
340 Ga0495603_0260352 3300046455 Bacteria 998
341 Ga0495629_0011086 3300046459 Bacteria 6549
342 Ga0495651_0164666 3300046462 Bacteria 1585
343 Ga0495653_0017538 3300046463 Bacteria 5822
344 Ga0495580_0132131 3300046472 Bacteria 1731
345 Ga0495582_0004074 3300046473 Bacteria 8209
346 Ga0495639_0012789 3300046475 Bacteria 3621
347 Ga0495639_0106346 3300046475 Bacteria 1328
348 Ga0495662_0003736 3300046476 Bacteria 7672
349 Ga0495662_0026767 3300046476 Bacteria 2785
350 Ga0495664_0105185 3300046477 Bacteria 1701
351 Ga0495585_0039408 3300046492 Bacteria 2656
352 Ga0495607_0017446 3300046501 Bacteria 4608
353 Ga0495620_0014723 3300046515 Bacteria 3967
354 Ga0495630_0020988 3300046517 Bacteria 4821
355 Ga0495630_0135012 3300046517 Bacteria 1875
356 Ga0495631_0105871 3300046518 Bacteria 1210
357 Ga0495644_0003246 3300046523 Bacteria 6425
358 Ga0495644_0066524 3300046523 Bacteria 1354
359 Ga0495663_0004240 3300046525 Bacteria 4045
360 Ga0495663_0013025 3300046525 Bacteria 2322
361 Ga0495663_0029917 3300046525 Bacteria 1611
362 Ga0495666_0029314 3300046526 Bacteria 2707
363 Ga0495642_0028718 3300046528 Bacteria 2217
364 Ga0495665_0058263 3300046531 Bacteria 2039
365 Ga0495640_0116918 3300046533 Bacteria 1736
366 Ga0495586_0045416 3300046535 Bacteria 2367
367 Ga0495598_0000123 3300046537 Bacteria 12960
368 Ga0495598_0014283 3300046537 Bacteria 1983
369 Ga0495598_0053546 3300046537 Bacteria 1223
370 Ga0495609_0114144 3300046538 Bacteria 1164
371 Ga0495621_0033329 3300046539 Bacteria 1775
372 Ga0495621_0076404 3300046539 Bacteria 1242
373 Ga0495668_0067024 3300046616 Bacteria 1975
374 Ga0495634_0006133 3300046642 Bacteria 9151
375 Ga0495634_0009406 3300046642 Bacteria 7209
376 Ga0495635_0019262 3300046663 Bacteria 4759
377 Ga0495635_0136079 3300046663 Bacteria 1674
378 Ga0495659_0010655 3300046664 Bacteria 2956
379 Ga0495661_0065440 3300046665 Bacteria 2142
380 Ga0495588_0057948 3300046674 Bacteria 2002
381 Ga0495623_0020578 3300046679 Bacteria 4264
382 Ga0495613_0063298 3300046689 Bacteria 2706
383 Ga0495624_0014329 3300046690 Bacteria 5383
384 Ga0495670_0005250 3300046691 Bacteria 6374
385 Ga0495589_0023528 3300046794 Bacteria 3139
386 Ga0495581_0031033 3300047315 Bacteria 3096
387 Ga0495581_0037501 3300047315 Bacteria 2805
388 Ga0495581_0144457 3300047315 Bacteria 1388
389 Ga0495636_0037345 3300047318 Bacteria 2006
390 Ga0495674_0004486 3300047319 Bacteria 13436
391 Ga0495674_0007553 3300047319 Bacteria 10384
392 Ga0495676_0061387 3300047321 Bacteria 2940
393 Ga0495676_0202010 3300047321 Bacteria 1380
394 Ga0495680_0002204 3300047322 Bacteria 20167
395 Ga0495677_0023067 3300047445 Bacteria 2259
396 Ga0495684_0082822 3300047471 Bacteria 2433
397 Ga0495684_0370009 3300047471 Bacteria 1013
398 Ga0495593_0004911 3300047673 Bacteria 7928
399 Ga0495593_0084580 3300047673 Bacteria 1638
400 Ga0495593_0160729 3300047673 Bacteria 1134
401 Ga0496100_0165852 3300048903 Bacteria 1587
402 Ga0496102_0087755 3300048905 Bacteria 2874
403 Ga0496103_0125117 3300048906 Bacteria 1639
404 Ga0496104_0001695 3300048907 Bacteria 19033
405 Ga0496105_0007144 3300048908 Bacteria 8615
406 Ga0496105_0013764 3300048908 Bacteria 6423
407 Ga0496108_0019347 3300048911 Bacteria 5591
408 Ga0496108_0030104 3300048911 Bacteria 4499
409 Ga0496108_0089642 3300048911 Bacteria 2614
410 Ga0496108_0322664 3300048911 Bacteria 1346
411 Ga0496109_0000773 3300048912 Bacteria 26613
412 Ga0496109_0056395 3300048912 Bacteria 3585
413 Ga0496109_0095547 3300048912 Bacteria 2752
414 Ga0496109_0182518 3300048912 Bacteria 1971
415 Ga0496110_0033053 3300048913 Bacteria 4472
416 Ga0496111_0011025 3300048914 Bacteria 6083
417 Ga0496111_0023172 3300048914 Bacteria 4357
418 Ga0496113_0006984 3300048916 Bacteria 7220
419 Ga0496113_0024066 3300048916 Bacteria 4324
420 Ga0496114_0091118 3300048917 Bacteria 2589
421 Ga0496114_0322565 3300048917 Bacteria 1365
422 Ga0496114_0446746 3300048917 Bacteria 1145
423 Ga0496115_0023449 3300048918 Bacteria 4790
424 Ga0496117_0000014 3300048920 Bacteria 584427
425 Ga0496117_0004343 3300048920 Bacteria 15736
426 Ga0496119_0000665 3300048922 Bacteria 46063
427 Ga0496119_0033508 3300048922 Bacteria 3403
428 Ga0496120_0001067 3300048923 Bacteria 36237
429 Ga0496120_0002129 3300048923 Bacteria 21153
430 Ga0496121_0101249 3300048924 Bacteria 2222
431 Ga0496122_0003957 3300048925 Bacteria 18927
432 Ga0496122_0041296 3300048925 Bacteria 3650
433 Ga0496123_0001267 3300048926 Bacteria 36223
434 Ga0496124_0001548 3300048927 Bacteria 33313
435 Ga0496124_0048706 3300048927 Bacteria 3619
436 Ga0496125_0021761 3300048928 Bacteria 5967
437 Ga0496126_0000007 3300048929 Bacteria 787364
438 Ga0496126_0002989 3300048929 Bacteria 21953
439 Ga0496126_0034456 3300048929 Bacteria 4755
440 Ga0496126_0077804 3300048929 Bacteria 2940
441 Ga0496126_0092722 3300048929 Bacteria 2653
442 Ga0496126_0165395 3300048929 Bacteria 1888
443 Ga0496126_0181996 3300048929 Bacteria 1785
444 Ga0501034_0010414 3300049571 Bacteria 9690
445 Ga0501038_0046741 3300049574 Bacteria 3752
446 Ga0501047_0094784 3300049581 Bacteria 2864
447 Ga0501070_0000098 3300049586 Bacteria 75579
448 Ga0501270_004173 3300049767 Bacteria 1607
449 nmdc:mga00v17_106477_c1 3300050491 Bacteria 1775
450 nmdc:mga00v17_5228_c1 3300050491 Bacteria 6833
451 nmdc:mga0yw44_32558_c1 3300050492 Bacteria 3039
452 nmdc:mga06z11_123472_c1 3300050494 Bacteria 1447
453 nmdc:mga07m45_106094_c1 3300050496 Bacteria 1616
454 nmdc:mga05p37_47176_c1 3300050507 Bacteria 5298
455 nmdc:mga05p37_715_c1 3300050507 Bacteria 36765
456 nmdc:mga09592_22407_c1 3300050508 Bacteria 5212
457 nmdc:mga09592_3751_c1 3300050508 Bacteria 12240
458 nmdc:mga0qj67_22079_c1 3300050509 Bacteria 4885
459 nmdc:mga0qj67_6584_c1 3300050509 Bacteria 8534
460 nmdc:mga06r32_23130_c1 3300050510 Bacteria 5750
461 nmdc:mga06r32_56_c1 3300050510 Bacteria 71167
462 nmdc:mga08y16_12403_c1 3300050511 Bacteria 8965
463 nmdc:mga08y16_25638_c1 3300050511 Bacteria 6221
464 nmdc:mga08y16_26780_c1 3300050511 Bacteria 6076
465 nmdc:mga0n895_17011_c1 3300050512 Bacteria 6691
466 nmdc:mga0n895_4823_c1 3300050512 Bacteria 11166
467 nmdc:mga0n895_7424_c1 3300050512 Bacteria 9406
468 nmdc:mga0rr50_12460_c1 3300050513 Bacteria 5500
469 nmdc:mga0rr50_13386_c1 3300050513 Bacteria 5340
470 nmdc:mga0rr50_26819_c1 3300050513 Bacteria 4028
471 nmdc:mga08x19_8225_c1 3300050514 Bacteria 6200
472 nmdc:mga0a205_23435_c1 3300050515 Bacteria 5856
473 nmdc:mga0a205_25017_c1 3300050515 Bacteria 5684
474 nmdc:mga0a205_7906_c1 3300050515 Bacteria 9658
475 Ga0495612_0006259 3300053078 Bacteria 4905
476 Ga0495619_0196748 3300053085 Bacteria 1395
477 Ga0495619_0282867 3300053085 Bacteria 1149
478 Ga0500573_0013793 3300053140 Bacteria 4561
479 Ga0500616_0003035 3300053153 Bacteria 13226

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300022467 Ga0224712_10054803 Ga0224712_100548032 275
2 3300035089 Ga0373944_0024133 Ga0373944_0024133_11_847 275
3 3300035692 Ga0373935_0471643 Ga0373935_0471643_20_850 275
4 3300046455 Ga0495603_0260352 Ga0495603_0260352_152_988 275
5 3300048917 Ga0496114_0446746 Ga0496114_0446746_25_861 275
6 3300039453 Ga0436362_0798161 Ga0436362_0798161_114_1004 290
7 3300048912 Ga0496109_0182518 Ga0496109_0182518_200_1150 291
8 3300044694 Ga0466963_0077132 Ga0466963_0077132_315_1319 294
9 3300039447 Ga0436361_0482415 Ga0436361_0482415_396_1388 295
10 3300031456 Ga0307513_10002630 Ga0307513_1000263020 299
11 3300025931 Ga0207644_10192342 Ga0207644_101923422 301
12 3300042012 Ga0439455_0005850 Ga0439455_0005850_1568_2494 302
13 3300042016 Ga0439463_003339 Ga0439463_003339_2529_3455 302
14 3300042438 Ga0439459_0009516 Ga0439459_0009516_270_1208 302
15 3300005337 Ga0070682_100007342 Ga0070682_1000073423 303
16 3300005347 Ga0070668_100137868 Ga0070668_1001378682 303
17 3300005718 Ga0068866_10028539 Ga0068866_100285392 303
18 3300005937 Ga0081455_10011389 Ga0081455_100113892 303
19 3300009098 Ga0105245_10448253 Ga0105245_104482531 303
20 3300009148 Ga0105243_10003944 Ga0105243_100039442 303
21 3300009176 Ga0105242_10135756 Ga0105242_101357562 303
22 3300010375 Ga0105239_10047982 Ga0105239_100479823 303
23 3300013307 Ga0157372_10094103 Ga0157372_100941032 303
24 3300014326 Ga0157380_10030725 Ga0157380_100307254 303
25 3300025933 Ga0207706_10001492 Ga0207706_1000149218 303
26 3300025961 Ga0207712_10042805 Ga0207712_100428052 303
27 3300026118 Ga0207675_100018820 Ga0207675_1000188204 303
28 3300031727 Ga0316576_10006560 Ga0316576_100065604 303
29 3300031903 Ga0307407_10152056 Ga0307407_101520562 303
30 3300031995 Ga0307409_100545899 Ga0307409_1005458991 303
31 3300035691 Ga0373931_0142459 Ga0373931_0142459_50_973 303
32 3300041451 Ga0451791_0616002 Ga0451791_0616002_307_1233 303
33 3300041452 Ga0451793_0867764 Ga0451793_0867764_874_1800 303
34 3300041453 Ga0451797_0330067 Ga0451797_0330067_744_1670 303
35 3300041494 Ga0451837_1025066 Ga0451837_1025066_818_1744 303
36 3300041512 Ga0451853_0239579 Ga0451853_0239579_207_1127 303
37 3300042005 Ga0439448_0007405 Ga0439448_0007405_2182_3099 303
38 3300042016 Ga0439463_000980 Ga0439463_000980_6183_7100 303
39 3300042439 Ga0439464_0002196 Ga0439464_0002196_533_1450 303
40 3300042461 Ga0439460_0009369 Ga0439460_0009369_904_1821 303
41 3300046515 Ga0495620_0014723 Ga0495620_0014723_2607_3545 303
42 3300046525 Ga0495663_0029917 Ga0495663_0029917_608_1546 303
43 iso_pu_bacteria 2784132109 2784473190 303
44 3300005718 Ga0068866_10086160 Ga0068866_100861603 304
45 3300006051 Ga0075364_10007108 Ga0075364_100071082 304
46 3300026089 Ga0207648_10264035 Ga0207648_102640352 304
47 3300049767 Ga0501270_004173 Ga0501270_004173_141_1118 304
48 3300005289 Ga0065704_10013689 Ga0065704_100136891 305
49 3300005330 Ga0070690_100010742 Ga0070690_1000107422 305
50 3300005334 Ga0068869_100001068 Ga0068869_1000010687 305
51 3300005337 Ga0070682_100000058 Ga0070682_10000005880 305
52 3300005355 Ga0070671_100049432 Ga0070671_1000494322 305
53 3300005364 Ga0070673_100002546 Ga0070673_1000025468 305
54 3300005364 Ga0070673_100051230 Ga0070673_1000512301 305
55 3300005438 Ga0070701_10033237 Ga0070701_100332372 305
56 3300005445 Ga0070708_100009263 Ga0070708_1000092636 305
57 3300005467 Ga0070706_100104662 Ga0070706_1001046623 305
58 3300005468 Ga0070707_100357966 Ga0070707_1003579661 305
59 3300005471 Ga0070698_100000714 Ga0070698_10000071420 305
60 3300005471 Ga0070698_100161885 Ga0070698_1001618852 305
61 3300005536 Ga0070697_100000498 Ga0070697_10000049824 305
62 3300005544 Ga0070686_100011190 Ga0070686_1000111904 305
63 3300005545 Ga0070695_100128520 Ga0070695_1001285202 305
64 3300005546 Ga0070696_100099173 Ga0070696_1000991732 305
65 3300005617 Ga0068859_100275148 Ga0068859_1002751481 305
66 3300005719 Ga0068861_100024992 Ga0068861_1000249924 305
67 3300005985 Ga0081539_10000380 Ga0081539_1000038041 305
68 3300006931 Ga0097620_100275120 Ga0097620_1002751202 305
69 3300009094 Ga0111539_10009361 Ga0111539_100093617 305
70 3300009094 Ga0111539_10015527 Ga0111539_100155272 305
71 3300009098 Ga0105245_10116909 Ga0105245_101169092 305
72 3300009147 Ga0114129_10029868 Ga0114129_100298681 305
73 3300009148 Ga0105243_10039200 Ga0105243_100392004 305
74 3300009174 Ga0105241_10465943 Ga0105241_104659431 305
75 3300009176 Ga0105242_10031687 Ga0105242_100316871 305
76 3300009553 Ga0105249_10000686 Ga0105249_100006861 305
77 3300009553 Ga0105249_10239212 Ga0105249_102392122 305
78 3300013297 Ga0157378_10083575 Ga0157378_100835752 305
79 3300013297 Ga0157378_10185602 Ga0157378_101856022 305
80 3300013306 Ga0163162_10000714 Ga0163162_100007141 305
81 3300013306 Ga0163162_10017149 Ga0163162_100171494 305
82 3300013306 Ga0163162_10095574 Ga0163162_100955742 305
83 3300013307 Ga0157372_10042623 Ga0157372_100426232 305
84 3300013308 Ga0157375_10031357 Ga0157375_100313572 305
85 3300013308 Ga0157375_10461668 Ga0157375_104616681 305
86 3300014326 Ga0157380_10071792 Ga0157380_100717921 305
87 3300021384 Ga0213876_10000097 Ga0213876_1000009776 305
88 3300025923 Ga0207681_10001481 Ga0207681_100014816 305
89 3300025942 Ga0207689_10003120 Ga0207689_100031207 305
90 3300025960 Ga0207651_10002572 Ga0207651_100025722 305
91 3300025960 Ga0207651_10109600 Ga0207651_101096003 305
92 3300025961 Ga0207712_10094432 Ga0207712_100944321 305
93 3300025972 Ga0207668_10195572 Ga0207668_101955721 305
94 3300026116 Ga0207674_10337703 Ga0207674_103377031 305
95 3300026118 Ga0207675_100100967 Ga0207675_1001009673 305
96 3300028794 Ga0307515_10361680 Ga0307515_103616801 305
97 3300031852 Ga0307410_10022611 Ga0307410_100226113 305
98 3300031901 Ga0307406_10060327 Ga0307406_100603272 305
99 3300032005 Ga0307411_10027653 Ga0307411_100276533 305
100 3300037418 Ga0395900_0368741 Ga0395900_0368741_211_1140 305
101 3300039437 Ga0436365_1423688 Ga0436365_1423688_85366_86346 305
102 3300042126 Ga0450888_001537 Ga0450888_001537_1249_2178 305
103 3300042436 Ga0439435_0004082 Ga0439435_0004082_563_1492 305
104 3300042876 Ga0451577_0166319 Ga0451577_0166319_575_1504 305
105 3300046518 Ga0495631_0105871 Ga0495631_0105871_156_1100 305
106 3300046525 Ga0495663_0004240 Ga0495663_0004240_1341_2273 305
107 3300046537 Ga0495598_0000123 Ga0495598_0000123_2438_3370 305
108 3300046537 Ga0495598_0053546 Ga0495598_0053546_152_1096 305
109 3300046539 Ga0495621_0033329 Ga0495621_0033329_588_1562 305
110 3300046616 Ga0495668_0067024 Ga0495668_0067024_427_1359 305
111 3300048911 Ga0496108_0322664 Ga0496108_0322664_51_974 305
112 3300050507 nmdc:mga05p37_47176_c1 nmdc:mga05p37_47176_c1_482_1414 305
113 3300050508 nmdc:mga09592_22407_c1 nmdc:mga09592_22407_c1_889_1821 305
114 3300050510 nmdc:mga06r32_23130_c1 nmdc:mga06r32_23130_c1_1234_2166 305
115 3300050511 nmdc:mga08y16_12403_c1 nmdc:mga08y16_12403_c1_828_1862 305
116 3300050511 nmdc:mga08y16_26780_c1 nmdc:mga08y16_26780_c1_1288_2220 305
117 3300050512 nmdc:mga0n895_4823_c1 nmdc:mga0n895_4823_c1_7099_8031 305
118 3300050512 nmdc:mga0n895_7424_c1 nmdc:mga0n895_7424_c1_7895_8929 305
119 3300050513 nmdc:mga0rr50_12460_c1 nmdc:mga0rr50_12460_c1_45_977 305
120 3300050513 nmdc:mga0rr50_13386_c1 nmdc:mga0rr50_13386_c1_3925_4959 305
121 3300050515 nmdc:mga0a205_23435_c1 nmdc:mga0a205_23435_c1_3983_5017 305
122 3300050515 nmdc:mga0a205_7906_c1 nmdc:mga0a205_7906_c1_4694_5626 305
123 3300005337 Ga0070682_100106362 Ga0070682_1001063622 306
124 3300005457 Ga0070662_100164497 Ga0070662_1001644972 306
125 3300005467 Ga0070706_100002380 Ga0070706_10000238012 306
126 3300005937 Ga0081455_10027242 Ga0081455_100272424 306
127 3300005937 Ga0081455_10071989 Ga0081455_100719892 306
128 3300005985 Ga0081539_10000015 Ga0081539_10000015222 306
129 3300006844 Ga0075428_100024519 Ga0075428_1000245196 306
130 3300014326 Ga0157380_10298406 Ga0157380_102984062 306
131 3300017792 Ga0163161_10180319 Ga0163161_101803192 306
132 3300025927 Ga0207687_10076949 Ga0207687_100769491 306
133 3300025937 Ga0207669_10320820 Ga0207669_103208201 306
134 3300025944 Ga0207661_10274659 Ga0207661_102746592 306
135 3300028381 Ga0268264_10256560 Ga0268264_102565602 306
136 3300031548 Ga0307408_100007224 Ga0307408_1000072242 306
137 3300031731 Ga0307405_10000853 Ga0307405_100008531 306
138 3300031824 Ga0307413_10003683 Ga0307413_100036833 306
139 3300031903 Ga0307407_10000710 Ga0307407_100007103 306
140 3300031903 Ga0307407_10023064 Ga0307407_100230643 306
141 3300031911 Ga0307412_10035016 Ga0307412_100350162 306
142 3300031995 Ga0307409_100018426 Ga0307409_1000184264 306
143 3300032002 Ga0307416_100009589 Ga0307416_1000095893 306
144 3300032004 Ga0307414_10005251 Ga0307414_100052515 306
145 3300032004 Ga0307414_10010021 Ga0307414_100100215 306
146 3300032005 Ga0307411_10000384 Ga0307411_100003846 306
147 3300041512 Ga0451853_1222744 Ga0451853_1222744_364_1362 306
148 3300046462 Ga0495651_0164666 Ga0495651_0164666_558_1481 306
149 3300046463 Ga0495653_0017538 Ga0495653_0017538_1224_2189 306
150 3300050513 nmdc:mga0rr50_26819_c1 nmdc:mga0rr50_26819_c1_443_1420 306
151 3300005329 Ga0070683_100001274 Ga0070683_10000127411 307
152 3300005356 Ga0070674_100384800 Ga0070674_1003848001 307
153 3300005434 Ga0070709_10024506 Ga0070709_100245063 307
154 3300005435 Ga0070714_100185501 Ga0070714_1001855012 307
155 3300005436 Ga0070713_100248616 Ga0070713_1002486162 307
156 3300005437 Ga0070710_10033737 Ga0070710_100337372 307
157 3300005468 Ga0070707_100003789 Ga0070707_1000037898 307
158 3300005471 Ga0070698_100001437 Ga0070698_1000014378 307
159 3300005518 Ga0070699_100053439 Ga0070699_1000534393 307
160 3300005535 Ga0070684_100058667 Ga0070684_1000586672 307
161 3300005536 Ga0070697_100029782 Ga0070697_1000297822 307
162 3300006028 Ga0070717_10002872 Ga0070717_1000287214 307
163 3300006028 Ga0070717_10177824 Ga0070717_101778242 307
164 3300006844 Ga0075428_100006350 Ga0075428_10000635015 307
165 3300006871 Ga0075434_100239528 Ga0075434_1002395283 307
166 3300006914 Ga0075436_100060034 Ga0075436_1000600343 307
167 3300013306 Ga0163162_10373155 Ga0163162_103731552 307
168 3300014326 Ga0157380_10574639 Ga0157380_105746391 307
169 3300025905 Ga0207685_10022435 Ga0207685_100224352 307
170 3300025906 Ga0207699_10031730 Ga0207699_100317302 307
171 3300025910 Ga0207684_10011531 Ga0207684_100115312 307
172 3300025915 Ga0207693_10023030 Ga0207693_100230303 307
173 3300025922 Ga0207646_10001355 Ga0207646_1000135511 307
174 3300025928 Ga0207700_10075875 Ga0207700_100758752 307
175 3300025929 Ga0207664_10016628 Ga0207664_100166283 307
176 3300025939 Ga0207665_10021898 Ga0207665_100218984 307
177 3300025944 Ga0207661_10005787 Ga0207661_100057877 307
178 3300025945 Ga0207679_10080183 Ga0207679_100801832 307
179 3300026116 Ga0207674_10149299 Ga0207674_101492992 307
180 3300037068 Ga0373925_0010217 Ga0373925_0010217_246_1223 307
181 3300037466 Ga0395898_0453820 Ga0395898_0453820_84_1073 307
182 3300046517 Ga0495630_0135012 Ga0495630_0135012_399_1343 307
183 3300048907 Ga0496104_0001695 Ga0496104_0001695_14357_15337 307
184 3300048908 Ga0496105_0007144 Ga0496105_0007144_5007_5987 307
185 3300048911 Ga0496108_0019347 Ga0496108_0019347_37_1017 307
186 3300048912 Ga0496109_0056395 Ga0496109_0056395_1401_2381 307
187 3300048916 Ga0496113_0006984 Ga0496113_0006984_2586_3566 307
188 3300048918 Ga0496115_0023449 Ga0496115_0023449_3346_4326 307
189 3300050512 nmdc:mga0n895_17011_c1 nmdc:mga0n895_17011_c1_5516_6496 307
190 3300050514 nmdc:mga08x19_8225_c1 nmdc:mga08x19_8225_c1_3214_4194 307
191 3300050515 nmdc:mga0a205_25017_c1 nmdc:mga0a205_25017_c1_115_1086 307
192 3300003760 Ga0055527_1000004 Ga0055527_1000004191 308
193 3300003762 Ga0055542_1000307 Ga0055542_100030731 308
194 3300003763 Ga0055529_1000008 Ga0055529_1000008386 308
195 3300005334 Ga0068869_100065905 Ga0068869_1000659051 308
196 3300005341 Ga0070691_10019500 Ga0070691_100195004 308
197 3300005347 Ga0070668_100036466 Ga0070668_1000364662 308
198 3300005354 Ga0070675_100524807 Ga0070675_1005248071 308
199 3300005356 Ga0070674_100196885 Ga0070674_1001968852 308
200 3300005366 Ga0070659_100084619 Ga0070659_1000846193 308
201 3300005436 Ga0070713_100400917 Ga0070713_1004009171 308
202 3300005437 Ga0070710_10036755 Ga0070710_100367552 308
203 3300005438 Ga0070701_10036611 Ga0070701_100366113 308
204 3300005440 Ga0070705_100201873 Ga0070705_1002018732 308
205 3300005455 Ga0070663_100000466 Ga0070663_1000004664 308
206 3300005467 Ga0070706_100010066 Ga0070706_1000100663 308
207 3300005467 Ga0070706_100083189 Ga0070706_1000831893 308
208 3300005467 Ga0070706_100087100 Ga0070706_1000871002 308
209 3300005467 Ga0070706_100452652 Ga0070706_1004526521 308
210 3300005468 Ga0070707_100003232 Ga0070707_10000323215 308
211 3300005468 Ga0070707_100016745 Ga0070707_1000167454 308
212 3300005468 Ga0070707_100030838 Ga0070707_1000308382 308
213 3300005471 Ga0070698_100006891 Ga0070698_1000068914 308
214 3300005471 Ga0070698_100032056 Ga0070698_1000320563 308
215 3300005518 Ga0070699_100047802 Ga0070699_1000478023 308
216 3300005539 Ga0068853_100304606 Ga0068853_1003046061 308
217 3300005578 Ga0068854_100084121 Ga0068854_1000841212 308
218 3300005615 Ga0070702_100023668 Ga0070702_1000236683 308
219 3300005615 Ga0070702_100143758 Ga0070702_1001437581 308
220 3300005719 Ga0068861_100319490 Ga0068861_1003194902 308
221 3300005834 Ga0068851_10029742 Ga0068851_100297423 308
222 3300005840 Ga0068870_10046503 Ga0068870_100465032 308
223 3300005842 Ga0068858_100109711 Ga0068858_1001097113 308
224 3300005843 Ga0068860_100474080 Ga0068860_1004740802 308
225 3300005937 Ga0081455_10001759 Ga0081455_1000175913 308
226 3300005937 Ga0081455_10018266 Ga0081455_100182664 308
227 3300005981 Ga0081538_10001441 Ga0081538_1000144114 308
228 3300005981 Ga0081538_10043813 Ga0081538_100438132 308
229 3300005985 Ga0081539_10000362 Ga0081539_1000036258 308
230 3300005985 Ga0081539_10007107 Ga0081539_100071075 308
231 3300006028 Ga0070717_10169731 Ga0070717_101697311 308
232 3300006051 Ga0075364_10031335 Ga0075364_100313353 308
233 3300006051 Ga0075364_10081037 Ga0075364_100810371 308
234 3300006058 Ga0075432_10000184 Ga0075432_100001849 308
235 3300006058 Ga0075432_10003361 Ga0075432_100033612 308
236 3300006163 Ga0070715_10000657 Ga0070715_100006576 308
237 3300006163 Ga0070715_10020702 Ga0070715_100207022 308
238 3300006175 Ga0070712_100025975 Ga0070712_1000259752 308
239 3300006178 Ga0075367_10075177 Ga0075367_100751771 308
240 3300006353 Ga0075370_10029167 Ga0075370_100291672 308
241 3300006844 Ga0075428_100009656 Ga0075428_1000096565 308
242 3300006844 Ga0075428_100019966 Ga0075428_1000199661 308
243 3300006844 Ga0075428_100186544 Ga0075428_1001865442 308
244 3300006846 Ga0075430_100014397 Ga0075430_1000143972 308
245 3300006847 Ga0075431_100006189 Ga0075431_1000061895 308
246 3300006847 Ga0075431_100022671 Ga0075431_1000226715 308
247 3300006852 Ga0075433_10002351 Ga0075433_1000235114 308
248 3300006852 Ga0075433_10002630 Ga0075433_100026308 308
249 3300006871 Ga0075434_100003332 Ga0075434_1000033329 308
250 3300006871 Ga0075434_100164442 Ga0075434_1001644422 308
251 3300006880 Ga0075429_100000914 Ga0075429_10000091417 308
252 3300006880 Ga0075429_100024002 Ga0075429_1000240025 308
253 3300006881 Ga0068865_100018705 Ga0068865_1000187055 308
254 3300006914 Ga0075436_100008179 Ga0075436_1000081797 308
255 3300007076 Ga0075435_100001797 Ga0075435_1000017979 308
256 3300007076 Ga0075435_100014600 Ga0075435_1000146006 308
257 3300007265 Ga0099794_10025660 Ga0099794_100256602 308
258 3300009094 Ga0111539_10018696 Ga0111539_100186966 308
259 3300009098 Ga0105245_10405728 Ga0105245_104057282 308
260 3300009147 Ga0114129_10002093 Ga0114129_1000209315 308
261 3300009147 Ga0114129_10092576 Ga0114129_100925762 308
262 3300009148 Ga0105243_10169767 Ga0105243_101697672 308
263 3300009177 Ga0105248_10034951 Ga0105248_100349514 308
264 3300009551 Ga0105238_10063204 Ga0105238_100632043 308
265 3300011119 Ga0105246_10039969 Ga0105246_100399692 308
266 3300013105 Ga0157369_10212846 Ga0157369_102128462 308
267 3300013308 Ga0157375_10027019 Ga0157375_100270192 308
268 3300013308 Ga0157375_10168716 Ga0157375_101687162 308
269 3300014326 Ga0157380_10077643 Ga0157380_100776434 308
270 3300014969 Ga0157376_10142594 Ga0157376_101425942 308
271 3300014969 Ga0157376_10297748 Ga0157376_102977481 308
272 3300020069 Ga0197907_10936403 Ga0197907_109364031 308
273 3300021358 Ga0213873_10036333 Ga0213873_100363332 308
274 3300025228 Ga0209672_100011 Ga0209672_100011193 308
275 3300025229 Ga0209147_100238 Ga0209147_10023850 308
276 3300025242 Ga0209258_102859 Ga0209258_1028593 308
277 3300025254 Ga0209148_1000023 Ga0209148_100002331 308
278 3300025272 Ga0209455_1000023 Ga0209455_100002331 308
279 3300025910 Ga0207684_10062472 Ga0207684_100624722 308
280 3300025910 Ga0207684_10078962 Ga0207684_100789622 308
281 3300025910 Ga0207684_10296465 Ga0207684_102964652 308
282 3300025915 Ga0207693_10003243 Ga0207693_1000324311 308
283 3300025916 Ga0207663_10048691 Ga0207663_100486913 308
284 3300025918 Ga0207662_10182314 Ga0207662_101823142 308
285 3300025922 Ga0207646_10007603 Ga0207646_100076036 308
286 3300025922 Ga0207646_10017864 Ga0207646_100178645 308
287 3300025922 Ga0207646_10018738 Ga0207646_100187385 308
288 3300025926 Ga0207659_10362468 Ga0207659_103624681 308
289 3300025927 Ga0207687_10332037 Ga0207687_103320372 308
290 3300025928 Ga0207700_10197213 Ga0207700_101972132 308
291 3300025929 Ga0207664_10068591 Ga0207664_100685912 308
292 3300025929 Ga0207664_10474367 Ga0207664_104743671 308
293 3300025932 Ga0207690_10032143 Ga0207690_100321433 308
294 3300025932 Ga0207690_10241088 Ga0207690_102410882 308
295 3300025933 Ga0207706_10054731 Ga0207706_100547314 308
296 3300025934 Ga0207686_10077399 Ga0207686_100773992 308
297 3300025935 Ga0207709_10041876 Ga0207709_100418764 308
298 3300025935 Ga0207709_10058724 Ga0207709_100587241 308
299 3300025941 Ga0207711_10189771 Ga0207711_101897712 308
300 3300025942 Ga0207689_10038748 Ga0207689_100387484 308
301 3300025960 Ga0207651_10039690 Ga0207651_100396902 308
302 3300026035 Ga0207703_10098929 Ga0207703_100989292 308
303 3300026067 Ga0207678_10001240 Ga0207678_1000124024 308
304 3300026075 Ga0207708_10050427 Ga0207708_100504272 308
305 3300026089 Ga0207648_10061459 Ga0207648_100614592 308
306 3300026095 Ga0207676_10062318 Ga0207676_100623182 308
307 3300026118 Ga0207675_100195860 Ga0207675_1001958602 308
308 3300026118 Ga0207675_100215648 Ga0207675_1002156482 308
309 3300026121 Ga0207683_10357156 Ga0207683_103571561 308
310 3300027907 Ga0207428_10002940 Ga0207428_100029406 308
311 3300027907 Ga0207428_10003495 Ga0207428_100034959 308
312 3300027907 Ga0207428_10019672 Ga0207428_100196722 308
313 3300028794 Ga0307515_10061235 Ga0307515_100612355 308
314 3300030522 Ga0307512_10003620 Ga0307512_100036205 308
315 3300031548 Ga0307408_100014447 Ga0307408_1000144474 308
316 3300031548 Ga0307408_100097670 Ga0307408_1000976702 308
317 3300031616 Ga0307508_10308395 Ga0307508_103083952 308
318 3300031691 Ga0316579_10013858 Ga0316579_100138584 308
319 3300031727 Ga0316576_10002382 Ga0316576_100023823 308
320 3300031731 Ga0307405_10012780 Ga0307405_100127803 308
321 3300031838 Ga0307518_10000304 Ga0307518_100003046 308
322 3300031852 Ga0307410_10000043 Ga0307410_1000004319 308
323 3300031852 Ga0307410_10005698 Ga0307410_100056982 308
324 3300031852 Ga0307410_10006019 Ga0307410_100060192 308
325 3300031852 Ga0307410_10221690 Ga0307410_102216901 308
326 3300031889 Ga0326468_10000684 Ga0326468_100006842 308
327 3300031901 Ga0307406_10000008 Ga0307406_10000008125 308
328 3300031901 Ga0307406_10001097 Ga0307406_100010979 308
329 3300031901 Ga0307406_10084608 Ga0307406_100846082 308
330 3300031903 Ga0307407_10019224 Ga0307407_100192241 308
331 3300031911 Ga0307412_10285825 Ga0307412_102858251 308
332 3300031995 Ga0307409_100000014 Ga0307409_1000000149 308
333 3300031995 Ga0307409_100018590 Ga0307409_1000185904 308
334 3300031995 Ga0307409_100104053 Ga0307409_1001040534 308
335 3300032002 Ga0307416_100000088 Ga0307416_10000008832 308
336 3300032002 Ga0307416_100005302 Ga0307416_1000053028 308
337 3300032002 Ga0307416_100040502 Ga0307416_1000405023 308
338 3300032002 Ga0307416_100193113 Ga0307416_1001931132 308
339 3300032004 Ga0307414_10029734 Ga0307414_100297342 308
340 3300032004 Ga0307414_10525028 Ga0307414_105250281 308
341 3300032005 Ga0307411_10001875 Ga0307411_100018758 308
342 3300032005 Ga0307411_10124053 Ga0307411_101240532 308
343 3300032005 Ga0307411_10271422 Ga0307411_102714221 308
344 3300032126 Ga0307415_100005409 Ga0307415_1000054092 308
345 3300032133 Ga0316583_10022857 Ga0316583_100228572 308
346 3300032137 Ga0316585_10003308 Ga0316585_100033082 308
347 3300033179 Ga0307507_10081783 Ga0307507_100817835 308
348 3300035083 Ga0373926_0000105 Ga0373926_0000105_12154_13083 308
349 3300035083 Ga0373926_0020627 Ga0373926_0020627_129_1112 308
350 3300035091 Ga0373951_0000647 Ga0373951_0000647_7728_8717 308
351 3300035111 Ga0373923_0033268 Ga0373923_0033268_520_1503 308
352 3300035113 Ga0373936_0061346 Ga0373936_0061346_420_1403 308
353 3300035116 Ga0373945_0062352 Ga0373945_0062352_382_1365 308
354 3300035171 Ga0373946_0040448 Ga0373946_0040448_813_1796 308
355 3300035691 Ga0373931_0074438 Ga0373931_0074438_651_1634 308
356 3300035692 Ga0373935_0001250 Ga0373935_0001250_1233_2162 308
357 3300035695 Ga0373927_0004229 Ga0373927_0004229_8399_9382 308
358 3300035725 Ga0373947_0001176 Ga0373947_0001176_9078_10007 308
359 3300035725 Ga0373947_0100431 Ga0373947_0100431_777_1760 308
360 3300036647 Ga0316582_0167678 Ga0316582_0167678_221_1261 308
361 3300037068 Ga0373925_0121540 Ga0373925_0121540_98_1081 308
362 3300037068 Ga0373925_0160531 Ga0373925_0160531_45_1028 308
363 3300037068 Ga0373925_0247639 Ga0373925_0247639_20_973 308
364 3300037466 Ga0395898_0000270 Ga0395898_0000270_37951_38877 308
365 3300037471 Ga0395905_0068847 Ga0395905_0068847_2215_3198 308
366 3300037471 Ga0395905_0129753 Ga0395905_0129753_1067_2059 308
367 3300038443 Ga0395901_0364908 Ga0395901_0364908_434_1426 308
368 3300041410 Ga0439461_0030165 Ga0439461_0030165_34_1020 308
369 3300041413 Ga0439465_0023461 Ga0439465_0023461_629_1615 308
370 3300041509 Ga0451843_0941436 Ga0451843_0941436_44_1066 308
371 3300044693 Ga0466961_0005970 Ga0466961_0005970_36_1013 308
372 3300044719 Ga0466971_0021785 Ga0466971_0021785_1429_2406 308
373 3300044719 Ga0466971_0040643 Ga0466971_0040643_187_1188 308
374 3300044765 Ga0466970_0186519 Ga0466970_0186519_128_1123 308
375 3300044901 Ga0466960_0027543 Ga0466960_0027543_943_1938 308
376 3300045836 Ga0466958_0046436 Ga0466958_0046436_469_1446 308
377 3300046455 Ga0495603_0006482 Ga0495603_0006482_4442_5425 308
378 3300046459 Ga0495629_0011086 Ga0495629_0011086_5478_6461 308
379 3300046472 Ga0495580_0132131 Ga0495580_0132131_67_1050 308
380 3300046473 Ga0495582_0004074 Ga0495582_0004074_3881_4864 308
381 3300046475 Ga0495639_0012789 Ga0495639_0012789_2497_3480 308
382 3300046475 Ga0495639_0106346 Ga0495639_0106346_238_1221 308
383 3300046476 Ga0495662_0003736 Ga0495662_0003736_85_1068 308
384 3300046476 Ga0495662_0026767 Ga0495662_0026767_1772_2755 308
385 3300046477 Ga0495664_0105185 Ga0495664_0105185_638_1621 308
386 3300046492 Ga0495585_0039408 Ga0495585_0039408_1447_2430 308
387 3300046501 Ga0495607_0017446 Ga0495607_0017446_1620_2603 308
388 3300046517 Ga0495630_0020988 Ga0495630_0020988_1371_2354 308
389 3300046523 Ga0495644_0003246 Ga0495644_0003246_776_1759 308
390 3300046523 Ga0495644_0066524 Ga0495644_0066524_120_1073 308
391 3300046525 Ga0495663_0013025 Ga0495663_0013025_130_1113 308
392 3300046526 Ga0495666_0029314 Ga0495666_0029314_904_1887 308
393 3300046528 Ga0495642_0028718 Ga0495642_0028718_584_1567 308
394 3300046531 Ga0495665_0058263 Ga0495665_0058263_557_1540 308
395 3300046533 Ga0495640_0116918 Ga0495640_0116918_89_1072 308
396 3300046535 Ga0495586_0045416 Ga0495586_0045416_15_998 308
397 3300046537 Ga0495598_0014283 Ga0495598_0014283_76_1059 308
398 3300046538 Ga0495609_0114144 Ga0495609_0114144_131_1114 308
399 3300046539 Ga0495621_0076404 Ga0495621_0076404_115_1098 308
400 3300046642 Ga0495634_0006133 Ga0495634_0006133_359_1342 308
401 3300046642 Ga0495634_0009406 Ga0495634_0009406_638_1621 308
402 3300046663 Ga0495635_0019262 Ga0495635_0019262_155_1138 308
403 3300046663 Ga0495635_0136079 Ga0495635_0136079_665_1648 308
404 3300046664 Ga0495659_0010655 Ga0495659_0010655_391_1374 308
405 3300046665 Ga0495661_0065440 Ga0495661_0065440_744_1727 308
406 3300046674 Ga0495588_0057948 Ga0495588_0057948_882_1865 308
407 3300046679 Ga0495623_0020578 Ga0495623_0020578_2617_3600 308
408 3300046689 Ga0495613_0063298 Ga0495613_0063298_353_1336 308
409 3300046690 Ga0495624_0014329 Ga0495624_0014329_481_1464 308
410 3300046691 Ga0495670_0005250 Ga0495670_0005250_3976_4959 308
411 3300046794 Ga0495589_0023528 Ga0495589_0023528_1281_2264 308
412 3300047315 Ga0495581_0031033 Ga0495581_0031033_1816_2799 308
413 3300047315 Ga0495581_0037501 Ga0495581_0037501_1754_2737 308
414 3300047315 Ga0495581_0144457 Ga0495581_0144457_310_1293 308
415 3300047318 Ga0495636_0037345 Ga0495636_0037345_518_1501 308
416 3300047319 Ga0495674_0004486 Ga0495674_0004486_4860_5843 308
417 3300047319 Ga0495674_0007553 Ga0495674_0007553_5883_6866 308
418 3300047321 Ga0495676_0061387 Ga0495676_0061387_1419_2402 308
419 3300047321 Ga0495676_0202010 Ga0495676_0202010_87_1070 308
420 3300047322 Ga0495680_0002204 Ga0495680_0002204_48_1031 308
421 3300047445 Ga0495677_0023067 Ga0495677_0023067_425_1408 308
422 3300047471 Ga0495684_0082822 Ga0495684_0082822_537_1520 308
423 3300047471 Ga0495684_0370009 Ga0495684_0370009_13_996 308
424 3300047673 Ga0495593_0004911 Ga0495593_0004911_2989_3972 308
425 3300047673 Ga0495593_0084580 Ga0495593_0084580_56_1039 308
426 3300047673 Ga0495593_0160729 Ga0495593_0160729_77_1060 308
427 3300048903 Ga0496100_0165852 Ga0496100_0165852_207_1190 308
428 3300048905 Ga0496102_0087755 Ga0496102_0087755_1902_2861 308
429 3300048906 Ga0496103_0125117 Ga0496103_0125117_126_1109 308
430 3300048908 Ga0496105_0013764 Ga0496105_0013764_3225_4250 308
431 3300048911 Ga0496108_0030104 Ga0496108_0030104_2708_3691 308
432 3300048911 Ga0496108_0089642 Ga0496108_0089642_1361_2362 308
433 3300048912 Ga0496109_0000773 Ga0496109_0000773_22137_23162 308
434 3300048912 Ga0496109_0095547 Ga0496109_0095547_327_1307 308
435 3300048913 Ga0496110_0033053 Ga0496110_0033053_1917_2942 308
436 3300048914 Ga0496111_0011025 Ga0496111_0011025_3202_4227 308
437 3300048914 Ga0496111_0023172 Ga0496111_0023172_548_1531 308
438 3300048916 Ga0496113_0024066 Ga0496113_0024066_1413_2438 308
439 3300048917 Ga0496114_0091118 Ga0496114_0091118_1321_2310 308
440 3300048917 Ga0496114_0322565 Ga0496114_0322565_269_1270 308
441 3300048920 Ga0496117_0000014 Ga0496117_0000014_486079_487062 308
442 3300048920 Ga0496117_0004343 Ga0496117_0004343_11041_12018 308
443 3300048922 Ga0496119_0000665 Ga0496119_0000665_7669_8652 308
444 3300048922 Ga0496119_0033508 Ga0496119_0033508_1392_2375 308
445 3300048923 Ga0496120_0001067 Ga0496120_0001067_87_1070 308
446 3300048923 Ga0496120_0002129 Ga0496120_0002129_19519_20502 308
447 3300048924 Ga0496121_0101249 Ga0496121_0101249_269_1246 308
448 3300048925 Ga0496122_0003957 Ga0496122_0003957_1770_2753 308
449 3300048925 Ga0496122_0041296 Ga0496122_0041296_1118_2095 308
450 3300048926 Ga0496123_0001267 Ga0496123_0001267_27367_28350 308
451 3300048927 Ga0496124_0001548 Ga0496124_0001548_28330_29313 308
452 3300048927 Ga0496124_0048706 Ga0496124_0048706_294_1220 308
453 3300048928 Ga0496125_0021761 Ga0496125_0021761_1273_2250 308
454 3300048929 Ga0496126_0000007 Ga0496126_0000007_143583_144599 308
455 3300048929 Ga0496126_0002989 Ga0496126_0002989_14978_15961 308
456 3300048929 Ga0496126_0034456 Ga0496126_0034456_3003_3980 308
457 3300048929 Ga0496126_0077804 Ga0496126_0077804_703_1632 308
458 3300048929 Ga0496126_0092722 Ga0496126_0092722_776_1753 308
459 3300048929 Ga0496126_0165395 Ga0496126_0165395_258_1196 308
460 3300048929 Ga0496126_0181996 Ga0496126_0181996_400_1383 308
461 3300049571 Ga0501034_0010414 Ga0501034_0010414_3711_4697 308
462 3300049574 Ga0501038_0046741 Ga0501038_0046741_109_1086 308
463 3300049581 Ga0501047_0094784 Ga0501047_0094784_1777_2757 308
464 3300049586 Ga0501070_0000098 Ga0501070_0000098_46756_47715 308
465 3300050491 nmdc:mga00v17_106477_c1 nmdc:mga00v17_106477_c1_494_1507 308
466 3300050491 nmdc:mga00v17_5228_c1 nmdc:mga00v17_5228_c1_5677_6606 308
467 3300050492 nmdc:mga0yw44_32558_c1 nmdc:mga0yw44_32558_c1_1141_2154 308
468 3300050494 nmdc:mga06z11_123472_c1 nmdc:mga06z11_123472_c1_103_1116 308
469 3300050496 nmdc:mga07m45_106094_c1 nmdc:mga07m45_106094_c1_293_1306 308
470 3300050507 nmdc:mga05p37_715_c1 nmdc:mga05p37_715_c1_34732_35706 308
471 3300050508 nmdc:mga09592_3751_c1 nmdc:mga09592_3751_c1_8634_9608 308
472 3300050509 nmdc:mga0qj67_22079_c1 nmdc:mga0qj67_22079_c1_1315_2289 308
473 3300050509 nmdc:mga0qj67_6584_c1 nmdc:mga0qj67_6584_c1_5333_6319 308
474 3300050510 nmdc:mga06r32_56_c1 nmdc:mga06r32_56_c1_53051_54025 308
475 3300050511 nmdc:mga08y16_25638_c1 nmdc:mga08y16_25638_c1_4987_5961 308
476 3300053078 Ga0495612_0006259 Ga0495612_0006259_273_1247 308
477 3300053085 Ga0495619_0196748 Ga0495619_0196748_102_1085 308
478 3300053085 Ga0495619_0282867 Ga0495619_0282867_78_1061 308
479 3300053140 Ga0500573_0013793 Ga0500573_0013793_2865_3791 308
480 3300053153 Ga0500616_0003035 Ga0500616_0003035_3459_4409 308
481 iso_pu_bacteria 2551306166 2552111075 308
482 iso_pu_bacteria 2582580736 2583148862 308
483 iso_pu_bacteria 2643221601 2644014627 308
484 iso_pu_bacteria 2643221631 2644176062 308
485 iso_pu_bacteria 2643221692 2644514149 308
486 iso_pu_bacteria 2757320536 2758225605 308
487 iso_pu_bacteria 2832004796 2832010234 308
488 iso_pu_bacteria 2856741275 2856746213 308
489 iso_pu_bacteria 2857727296 2857727688 308
490 iso_pu_bacteria 2858895516 2858900124 308
491 iso_pu_bacteria 2858902515 2858902808 308
492 iso_pu_bacteria 2891395885 2891402614 308
493 iso_pu_bacteria 2891554331 2891554942 308
494 iso_pu_bacteria 2891562705 2891562759 308
495 iso_pu_bacteria 2899359706 2899361158 308
496 iso_pu_bacteria 2899370129 2899373739 308
497 iso_pu_bacteria 2919395869 2919397353 308
498 iso_pu_bacteria 2919713450 2919719975 308
499 iso_pu_bacteria 2946080515 2946083650 308
500 iso_pu_bacteria 2974294766 2974295895 308
501 iso_pu_bacteria 2974324384 2974327842 308
502 iso_pu_bacteria 2990256926 2990258007 308
503 iso_pu_bacteria 8003870546 8003870823 308
504 iso_pu_bacteria 8004182704 8004184092 308
505 iso_pu_bacteria 8016254467 8016256111 308
506 iso_pu_bacteria 8055034563 8055037120 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00490

ALAD

Delta-aminolevulinic acid dehydratase

61

378

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c1h-assembly1.cif.gz_A the x-ray structure of chlorobium vibrioforme 5-aminolaevulinic acid dehydratase complexed with a diacid inhibitor 0.9828 2 308
1b4e-assembly1.cif.gz_A x-ray structure of 5-aminolevulinic acid dehydratase complexed with the inhibitor levulinic acid 0.9801 2 307
1i8j-assembly1.cif.gz_A crystal structure of porphobilinogen synthase complexed with the inhibitor 4,7-dioxosebacic acid 0.98 2 307
1w5o-assembly1.cif.gz_A stepwise introduction of zinc binding site into porphobilinogen synthase of pseudomonas aeruginosa (mutations a129c, d131c and d139c) 0.9783 2 308
1w54-assembly1.cif.gz_A stepwise introduction of a zinc binding site into porphobilinogen synthase from pseudomonas aeruginosa (mutation d139c) 0.9776 2 308
ID Description Score Start End Superfamily
af_P9WMP5_2_329_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9973 2 308 3.20.20.70
af_P9WMP5_2_329_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9909 2 308 3.20.20.70
af_Q60178_5_334_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9858 2 304 3.20.20.70
1i8jA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.98 2 307 3.20.20.70
2c19A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9738 2 304 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A848S1D4-F1-model_v4 Delta-aminolevulinic acid dehydratase (EC 4.2.1.24) 1 2 308 GO:0004655
GO:0005829
GO:0006782
GO:0008270
AF-A0A2N6VIQ8-F1-model_v4 Delta-aminolevulinic acid dehydratase (EC 4.2.1.24) 0.9998 133 261 GO:0004655
GO:0005829
GO:0006782
GO:0008270
AF-A0A410HC11-F1-model_v4 deleted 0.9996 2 308
AF-A0A4V2EUH2-F1-model_v4 Delta-aminolevulinic acid dehydratase (EC 4.2.1.24) 0.9996 2 306 GO:0004655
GO:0005829
GO:0006782
GO:0008270
AF-A0A1G8P8P6-F1-model_v4 Delta-aminolevulinic acid dehydratase (EC 4.2.1.24) 0.9995 2 308 GO:0004655
GO:0005829
GO:0006782
GO:0008270

Feature Viewer

pLDDT pTM Quality
96.29 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map