F456489

General Info

Members Datasets Scaffolds Average Seq Length
506 306 1012 125

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_101311260|Ga0070665_1013112601
Length 137
Sequence MRATSLTEIAMTRQIIHTDHAPAAIGPYSQAVRSGNTVYFSGQIPLDPATGNLVEGDIAVQARRAFDNLKAVAEAAGGSLAQIVRLGLYLTDLGQFTAVNAVMQEYFNAPFPARSTVEVSALPKGAVFEVDAIMVID

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
159 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
193 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
194 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
195 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
196 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
197 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
198 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
199 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
202 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
203 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
206 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
207 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
208 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
209 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
210 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
279 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
280 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
281 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
286 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
299 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
300 2643221559 Lysobacter sp. Root559 Isolate Unclassified
301 2643221586 Lysobacter sp. Root667 Isolate Unclassified
302 2643221593 Lysobacter sp. Root690 Isolate Unclassified
303 2643221612 Lysobacter sp. Root76 Isolate Unclassified
304 2643221695 Lysobacter sp. Root494 Isolate Unclassified
305 2643221727 Lysobacter sp. Root96 Isolate Unclassified
306 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.78
Nodule 0.2
Rhizoplane 16.01
Rhizosphere 79.64
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_101311260 3300005548 Bacteria 734
2 JGI24750J21931_1065328 3300002070 Bacteria 587
3 Ga0055531_10005650 3300003794 Bacteria 7269
4 Ga0070658_10230644 3300005327 Bacteria 1567
5 Ga0070683_100000899 3300005329 Bacteria 22109
6 Ga0070690_100034555 3300005330 Bacteria 3168
7 Ga0070670_100086110 3300005331 Bacteria 2700
8 Ga0068869_100056891 3300005334 Bacteria 2853
9 Ga0070666_10071571 3300005335 Bacteria 2360
10 Ga0070666_10168312 3300005335 Bacteria 1534
11 Ga0070682_100021985 3300005337 Bacteria 3772
12 Ga0070682_100788691 3300005337 Bacteria 771
13 Ga0068868_100104058 3300005338 Bacteria 2300
14 Ga0070660_100544278 3300005339 Bacteria 968
15 Ga0070660_101588301 3300005339 Unclassified 557
16 Ga0070689_100228715 3300005340 Bacteria 1528
17 Ga0070687_100214796 3300005343 Bacteria 1174
18 Ga0070661_100053092 3300005344 Bacteria 2966
19 Ga0070661_100357393 3300005344 Bacteria 1147
20 Ga0070668_100052877 3300005347 Bacteria 3132
21 Ga0070668_100069469 3300005347 Bacteria 2740
22 Ga0070675_100134294 3300005354 Bacteria 2111
23 Ga0070671_100019539 3300005355 Bacteria 5516
24 Ga0070674_100019904 3300005356 Bacteria 4275
25 Ga0070674_101368416 3300005356 Bacteria 633
26 Ga0070674_101510331 3300005356 Bacteria 604
27 Ga0070673_100385187 3300005364 Bacteria 1251
28 Ga0070659_100414042 3300005366 Unclassified 1139
29 Ga0070659_100680020 3300005366 Bacteria 889
30 Ga0070659_100893226 3300005366 Bacteria 776
31 Ga0070667_100011036 3300005367 Bacteria 7472
32 Ga0070703_10556079 3300005406 Bacteria 524
33 Ga0070709_10127042 3300005434 Bacteria 1736
34 Ga0070714_100255630 3300005435 Bacteria 1621
35 Ga0070714_101258391 3300005435 Bacteria 722
36 Ga0070701_10029329 3300005438 Bacteria 2713
37 Ga0070701_10799653 3300005438 Bacteria 643
38 Ga0070700_100085745 3300005441 Bacteria 2043
39 Ga0070694_100159331 3300005444 Bacteria 1655
40 Ga0070663_100072803 3300005455 Bacteria 2505
41 Ga0070663_100388717 3300005455 Bacteria 1138
42 Ga0070663_101133034 3300005455 Bacteria 685
43 Ga0070678_100004161 3300005456 Bacteria 8160
44 Ga0070678_100011328 3300005456 Bacteria 5496
45 Ga0070678_100311217 3300005456 Bacteria 1342
46 Ga0070662_100846949 3300005457 Unclassified 778
47 Ga0070681_10011647 3300005458 Bacteria 8708
48 Ga0068867_100035397 3300005459 Bacteria 3621
49 Ga0070706_100214966 3300005467 Bacteria 1795
50 Ga0070698_100302560 3300005471 Bacteria 1530
51 Ga0070698_100453913 3300005471 Bacteria 1217
52 Ga0070699_100156219 3300005518 Bacteria 2019
53 Ga0070679_100036721 3300005530 Bacteria 4863
54 Ga0070684_100005453 3300005535 Bacteria 9744
55 Ga0070684_100820447 3300005535 Bacteria 870
56 Ga0070684_101354737 3300005535 Bacteria 670
57 Ga0070697_100476170 3300005536 Bacteria 1090
58 Ga0070672_100011428 3300005543 Bacteria 6193
59 Ga0070672_100387530 3300005543 Bacteria 1196
60 Ga0070672_101292992 3300005543 Bacteria 651
61 Ga0070686_100141854 3300005544 Bacteria 1673
62 Ga0070686_100152314 3300005544 Bacteria 1620
63 Ga0070695_100550336 3300005545 Bacteria 899
64 Ga0070696_100351755 3300005546 Bacteria 1141
65 Ga0070693_100002761 3300005547 Bacteria 8080
66 Ga0070693_100011863 3300005547 Bacteria 4397
67 Ga0070665_100304746 3300005548 Bacteria 1596
68 Ga0070704_100153120 3300005549 Bacteria 1815
69 Ga0070664_100002816 3300005564 Bacteria 14064
70 Ga0070664_100016764 3300005564 Bacteria 6012
71 Ga0068854_101107400 3300005578 Unclassified 706
72 Ga0068856_100008969 3300005614 Bacteria 9731
73 Ga0068856_100016941 3300005614 Bacteria 7061
74 Ga0068856_102470171 3300005614 Bacteria 527
75 Ga0070702_100035894 3300005615 Bacteria 2742
76 Ga0070702_100049398 3300005615 Bacteria 2399
77 Ga0068852_100123820 3300005616 Bacteria 2371
78 Ga0068859_100327136 3300005617 Bacteria 1627
79 Ga0068859_100592468 3300005617 Bacteria 1202
80 Ga0068864_102402785 3300005618 Bacteria 533
81 Ga0068866_10438762 3300005718 Bacteria 851
82 Ga0068861_101473207 3300005719 Bacteria 667
83 Ga0068851_10081043 3300005834 Bacteria 1695
84 Ga0068870_10075763 3300005840 Bacteria 1846
85 Ga0068858_100079530 3300005842 Bacteria 3046
86 Ga0068862_100035301 3300005844 Bacteria 4233
87 Ga0081455_10000321 3300005937 Bacteria 62752
88 Ga0081455_10255002 3300005937 Bacteria 1281
89 Ga0081455_10593802 3300005937 Bacteria 723
90 Ga0081455_10711100 3300005937 Bacteria 639
91 Ga0070716_100005504 3300006173 Bacteria 6139
92 Ga0070712_100089294 3300006175 Bacteria 2254
93 Ga0070712_100292264 3300006175 Bacteria 1316
94 Ga0070712_100294605 3300006175 Bacteria 1311
95 Ga0075369_10131317 3300006186 Bacteria 1138
96 Ga0097621_100147570 3300006237 Bacteria 2015
97 Ga0068871_100148640 3300006358 Bacteria 1997
98 Ga0068871_101613022 3300006358 Bacteria 614
99 Ga0075428_100832961 3300006844 Bacteria 980
100 Ga0075430_100167660 3300006846 Bacteria 1827
101 Ga0075431_100849556 3300006847 Bacteria 884
102 Ga0075431_101281236 3300006847 Bacteria 694
103 Ga0068865_100020296 3300006881 Bacteria 4308
104 Ga0068865_101521627 3300006881 Bacteria 600
105 Ga0097620_100327122 3300006931 Bacteria 1627
106 Ga0097620_100592480 3300006931 Bacteria 1202
107 Ga0105240_11941348 3300009093 Bacteria 612
108 Ga0111539_10377506 3300009094 Bacteria 1650
109 Ga0105245_10018086 3300009098 Bacteria 6159
110 Ga0105245_10070392 3300009098 Bacteria 3174
111 Ga0105245_10970336 3300009098 Bacteria 893
112 Ga0105245_11050814 3300009098 Bacteria 860
113 Ga0105245_11167395 3300009098 Bacteria 817
114 Ga0105245_11290438 3300009098 Bacteria 779
115 Ga0105245_11730282 3300009098 Bacteria 678
116 Ga0105247_10014554 3300009101 Bacteria 4718
117 Ga0114129_10351709 3300009147 Bacteria 1952
118 Ga0114129_10969336 3300009147 Unclassified 1073
119 Ga0114129_11788774 3300009147 Bacteria 748
120 Ga0105243_10258053 3300009148 Bacteria 1559
121 Ga0105243_10466109 3300009148 Bacteria 1189
122 Ga0105241_10039229 3300009174 Bacteria 3571
123 Ga0105241_11497519 3300009174 Bacteria 649
124 Ga0105242_10010367 3300009176 Bacteria 7147
125 Ga0105242_11107377 3300009176 Bacteria 806
126 Ga0105242_11827368 3300009176 Bacteria 647
127 Ga0105242_12995367 3300009176 Bacteria 523
128 Ga0105248_10152444 3300009177 Bacteria 2608
129 Ga0105248_10886117 3300009177 Bacteria 1007
130 Ga0105248_11253610 3300009177 Bacteria 838
131 Ga0105237_11101980 3300009545 Bacteria 801
132 Ga0105238_10062780 3300009551 Bacteria 3716
133 Ga0105238_10564671 3300009551 Bacteria 1143
134 Ga0105249_10021634 3300009553 Bacteria 5759
135 Ga0105249_10437148 3300009553 Bacteria 1345
136 Ga0105239_10185338 3300010375 Bacteria 2329
137 Ga0105239_10259390 3300010375 Bacteria 1953
138 Ga0105239_10451613 3300010375 Bacteria 1458
139 Ga0157371_10318278 3300013102 Bacteria 1129
140 Ga0157374_10034631 3300013296 Bacteria 4615
141 Ga0157374_10170131 3300013296 Bacteria 2125
142 Ga0157378_10037644 3300013297 Bacteria 4286
143 Ga0157378_11269541 3300013297 Bacteria 777
144 Ga0157378_11510228 3300013297 Bacteria 716
145 Ga0163162_10571320 3300013306 Bacteria 1258
146 Ga0157375_10017064 3300013308 Bacteria 6542
147 Ga0157375_10333297 3300013308 Bacteria 1682
148 Ga0157375_10456852 3300013308 Bacteria 1443
149 Ga0163163_10064360 3300014325 Bacteria 3638
150 Ga0163163_10523602 3300014325 Bacteria 1248
151 Ga0163163_10846467 3300014325 Bacteria 978
152 Ga0163163_12149341 3300014325 Bacteria 618
153 Ga0182008_10034018 3300014497 Bacteria 2556
154 Ga0182008_10304318 3300014497 Bacteria 835
155 Ga0157377_10108423 3300014745 Bacteria 1666
156 Ga0157377_10154664 3300014745 Bacteria 1421
157 Ga0157377_10438721 3300014745 Bacteria 899
158 Ga0157379_10011596 3300014968 Bacteria 7697
159 Ga0157376_10328771 3300014969 Bacteria 1456
160 Ga0157376_10408626 3300014969 Bacteria 1314
161 Ga0157376_10976244 3300014969 Unclassified 869
162 Ga0163161_10063056 3300017792 Bacteria 2701
163 Ga0163161_10370700 3300017792 Unclassified 1142
164 Ga0207425_1001346 3300025245 Bacteria 10519
165 Ga0209025_1000023 3300025294 Bacteria 541307
166 Ga0209257_1000046 3300025304 Bacteria 477765
167 Ga0207656_10078644 3300025321 Bacteria 1478
168 Ga0207710_10244662 3300025900 Bacteria 896
169 Ga0207680_10158022 3300025903 Bacteria 1517
170 Ga0207685_10176480 3300025905 Bacteria 987
171 Ga0207645_10409218 3300025907 Bacteria 913
172 Ga0207684_10124523 3300025910 Bacteria 2211
173 Ga0207707_11268719 3300025912 Bacteria 593
174 Ga0207671_11243669 3300025914 Bacteria 581
175 Ga0207693_10107093 3300025915 Bacteria 2193
176 Ga0207693_10335572 3300025915 Bacteria 1183
177 Ga0207693_10825955 3300025915 Bacteria 713
178 Ga0207663_10068795 3300025916 Bacteria 2275
179 Ga0207662_10223560 3300025918 Bacteria 1227
180 Ga0207662_10663983 3300025918 Unclassified 729
181 Ga0207657_10366090 3300025919 Bacteria 1136
182 Ga0207652_10029031 3300025921 Bacteria 4620
183 Ga0207681_10941040 3300025923 Bacteria 724
184 Ga0207694_10637794 3300025924 Bacteria 897
185 Ga0207650_10109298 3300025925 Bacteria 2138
186 Ga0207659_10252996 3300025926 Bacteria 1430
187 Ga0207659_10804831 3300025926 Unclassified 807
188 Ga0207687_10007375 3300025927 Bacteria 7245
189 Ga0207687_10013462 3300025927 Bacteria 5341
190 Ga0207687_10410323 3300025927 Bacteria 1116
191 Ga0207687_10466522 3300025927 Bacteria 1049
192 Ga0207687_10535555 3300025927 Bacteria 981
193 Ga0207700_10336394 3300025928 Bacteria 1311
194 Ga0207664_10893071 3300025929 Bacteria 798
195 Ga0207644_10030266 3300025931 Bacteria 3763
196 Ga0207644_10844548 3300025931 Bacteria 767
197 Ga0207690_10144520 3300025932 Bacteria 1757
198 Ga0207690_10839134 3300025932 Bacteria 760
199 Ga0207706_11391117 3300025933 Bacteria 576
200 Ga0207686_10001474 3300025934 Bacteria 13282
201 Ga0207686_10854757 3300025934 Bacteria 732
202 Ga0207709_11233281 3300025935 Bacteria 617
203 Ga0207669_10015014 3300025937 Bacteria 3896
204 Ga0207669_10283130 3300025937 Bacteria 1251
205 Ga0207704_10245637 3300025938 Bacteria 1340
206 Ga0207704_11433932 3300025938 Bacteria 592
207 Ga0207691_10018736 3300025940 Bacteria 6557
208 Ga0207691_10617331 3300025940 Bacteria 917
209 Ga0207711_10048054 3300025941 Bacteria 3650
210 Ga0207689_10351346 3300025942 Bacteria 1226
211 Ga0207661_10012036 3300025944 Bacteria 6285
212 Ga0207679_10001973 3300025945 Bacteria 12721
213 Ga0207679_10019401 3300025945 Bacteria 4566
214 Ga0207651_10185722 3300025960 Bacteria 1654
215 Ga0207712_10108161 3300025961 Bacteria 2080
216 Ga0207668_10052546 3300025972 Bacteria 2819
217 Ga0207668_10109767 3300025972 Unclassified 2067
218 Ga0207640_10091778 3300025981 Bacteria 2105
219 Ga0207658_10084587 3300025986 Bacteria 2441
220 Ga0207677_10003025 3300026023 Bacteria 8880
221 Ga0207677_10046775 3300026023 Bacteria 2900
222 Ga0207677_10102565 3300026023 Bacteria 2110
223 Ga0207703_10182077 3300026035 Bacteria 1855
224 Ga0207639_11399666 3300026041 Bacteria 656
225 Ga0207678_10265526 3300026067 Unclassified 1471
226 Ga0207678_10537032 3300026067 Bacteria 1022
227 Ga0207708_10250651 3300026075 Bacteria 1427
228 Ga0207702_10006766 3300026078 Bacteria 9833
229 Ga0207702_10024686 3300026078 Bacteria 4988
230 Ga0207702_10661074 3300026078 Unclassified 1028
231 Ga0207648_10114241 3300026089 Bacteria 2372
232 Ga0207676_11729560 3300026095 Bacteria 624
233 Ga0207675_100403042 3300026118 Bacteria 1348
234 Ga0207675_101981328 3300026118 Bacteria 600
235 Ga0207683_10007207 3300026121 Bacteria 9533
236 Ga0207683_10013949 3300026121 Bacteria 6853
237 Ga0207683_10146775 3300026121 Bacteria 2127
238 Ga0207698_11951861 3300026142 Bacteria 601
239 Ga0207698_12180025 3300026142 Bacteria 567
240 Ga0209967_1036268 3300027364 Bacteria 745
241 Ga0209995_1000939 3300027471 Bacteria 4528
242 Ga0209999_1000318 3300027543 Bacteria 7200
243 Ga0209982_1001308 3300027552 Bacteria 3373
244 Ga0209983_1070897 3300027665 Bacteria 776
245 Ga0209971_1000679 3300027682 Bacteria 8812
246 Ga0268266_10335498 3300028379 Bacteria 1418
247 Ga0268265_10030876 3300028380 Bacteria 3864
248 Ga0268265_11560947 3300028380 Bacteria 665
249 Ga0307515_10234700 3300028794 Bacteria 1618
250 Ga0265338_10213217 3300028800 Bacteria 1448
251 Ga0316181_1040277 3300030744 Bacteria 564
252 Ga0265330_10003677 3300031235 Bacteria 7962
253 Ga0265332_10000251 3300031238 Bacteria 43021
254 Ga0265328_10005239 3300031239 Bacteria 5570
255 Ga0265320_10035067 3300031240 Bacteria 2545
256 Ga0265329_10020115 3300031242 Bacteria 2258
257 Ga0265340_10183435 3300031247 Unclassified 945
258 Ga0265339_10025297 3300031249 Bacteria 3408
259 Ga0265331_10000032 3300031250 Bacteria 210525
260 Ga0265316_10000070 3300031344 Bacteria 103909
261 Ga0307513_10129267 3300031456 Bacteria 2474
262 Ga0307408_100962990 3300031548 Bacteria 784
263 Ga0265313_10114895 3300031595 Unclassified 1180
264 Ga0265314_10000300 3300031711 Bacteria 71087
265 Ga0265342_10002144 3300031712 Bacteria 17406
266 Ga0316576_10000018 3300031727 Bacteria 46638
267 Ga0316578_10002330 3300031728 Bacteria 8267
268 Ga0307405_11367920 3300031731 Bacteria 618
269 Ga0307405_11532793 3300031731 Bacteria 586
270 Ga0316577_10000182 3300031733 Bacteria 20455
271 Ga0307413_10005208 3300031824 Bacteria 5771
272 Ga0307410_10155017 3300031852 Bacteria 1710
273 Ga0307410_10754346 3300031852 Bacteria 824
274 Ga0307406_10329023 3300031901 Bacteria 1185
275 Ga0307407_10572809 3300031903 Bacteria 837
276 Ga0307409_102167653 3300031995 Bacteria 585
277 Ga0307409_102507910 3300031995 Bacteria 544
278 Ga0307416_101597053 3300032002 Bacteria 757
279 Ga0307414_10016406 3300032004 Bacteria 4501
280 Ga0307414_10118045 3300032004 Bacteria 2034
281 Ga0307414_10203090 3300032004 Bacteria 1613
282 Ga0307414_11345121 3300032004 Bacteria 663
283 Ga0307414_11968560 3300032004 Bacteria 545
284 Ga0307415_100762688 3300032126 Bacteria 879
285 Ga0307415_101131448 3300032126 Bacteria 734
286 Ga0373932_0267331 3300035112 Bacteria 629
287 Ga0316574_0829233 3300035398 Bacteria 562
288 Ga0373931_0329392 3300035691 Bacteria 951
289 Ga0316582_0136381 3300036647 Bacteria 1652
290 Ga0316584_0017026 3300036712 Bacteria 5218
291 Ga0395899_0071456 3300037312 Bacteria 2540
292 Ga0395900_0090195 3300037418 Bacteria 3151
293 Ga0395900_1913265 3300037418 Bacteria 504
294 Ga0395898_0002002 3300037466 Bacteria 25558
295 Ga0395905_0593110 3300037471 Bacteria 1010
296 Ga0395901_0006270 3300038443 Bacteria 12052
297 Ga0395901_0925387 3300038443 Unclassified 852
298 Ga0395901_0954277 3300038443 Bacteria 836
299 Ga0439436_0056816 3300041404 Bacteria 1098
300 Ga0439439_0000567 3300041406 Bacteria 6439
301 Ga0439461_0224226 3300041410 Bacteria 513
302 Ga0439465_0127436 3300041413 Bacteria 896
303 Ga0451791_1340119 3300041451 Bacteria 590
304 Ga0451793_1386602 3300041452 Bacteria 858
305 Ga0451795_0847706 3300041456 Bacteria 1251
306 Ga0451795_0928848 3300041456 Bacteria 1503
307 Ga0451843_0258499 3300041509 Bacteria 1317
308 Ga0451853_3623803 3300041512 Bacteria 766
309 Ga0439431_0017018 3300041997 Bacteria 1706
310 Ga0439433_0010263 3300041999 Bacteria 2044
311 Ga0439433_0195081 3300041999 Bacteria 534
312 Ga0439441_107448 3300042001 Bacteria 630
313 Ga0439445_0125907 3300042004 Bacteria 737
314 Ga0439432_009135 3300042006 Bacteria 3462
315 Ga0439449_0012640 3300042007 Bacteria 3176
316 Ga0450917_008663 3300042120 Bacteria 790
317 Ga0450889_005813 3300042144 Bacteria 1233
318 Ga0439435_0363672 3300042436 Bacteria 504
319 Ga0439464_0188626 3300042439 Bacteria 655
320 Ga0453683_0174636 3300044673 Bacteria 1361
321 Ga0453684_0023944 3300044712 Bacteria 8953
322 Ga0495603_0126022 3300046455 Bacteria 1492
323 Ga0495641_0445988 3300046461 Unclassified 589
324 Ga0495582_0386802 3300046473 Bacteria 806
325 Ga0495585_0622332 3300046492 Bacteria 507
326 Ga0495594_0113718 3300046499 Bacteria 1527
327 Ga0495616_0286549 3300046513 Bacteria 699
328 Ga0495630_0215701 3300046517 Bacteria 1465
329 Ga0495663_0001500 3300046525 Bacteria 7332
330 Ga0495663_0382908 3300046525 Bacteria 515
331 Ga0495654_0156379 3300046530 Bacteria 1004
332 Ga0495640_0737789 3300046533 Bacteria 589
333 Ga0495621_0000021 3300046539 Bacteria 29166
334 Ga0495656_0153084 3300046615 Bacteria 1115
335 Ga0495656_0400915 3300046615 Bacteria 717
336 Ga0495634_0198560 3300046642 Bacteria 1247
337 Ga0495611_0545931 3300046648 Bacteria 525
338 Ga0495659_0006807 3300046664 Bacteria 3612
339 Ga0495647_0035745 3300046681 Bacteria 1867
340 Ga0495658_0146536 3300046683 Bacteria 1447
341 Ga0495613_0063176 3300046689 Bacteria 2709
342 Ga0495670_0149368 3300046691 Bacteria 1225
343 Ga0495671_0020659 3300046692 Bacteria 3468
344 Ga0495581_0185907 3300047315 Bacteria 1215
345 Ga0495676_0075693 3300047321 Bacteria 2573
346 Ga0495615_0044352 3300048090 Bacteria 1122
347 Ga0496100_0006149 3300048903 Bacteria 6531
348 Ga0496100_0147633 3300048903 Bacteria 1674
349 Ga0496100_0436314 3300048903 Bacteria 1002
350 Ga0496100_0497776 3300048903 Bacteria 939
351 Ga0496100_0721043 3300048903 Bacteria 779
352 Ga0496101_0000726 3300048904 Bacteria 19616
353 Ga0496101_0047506 3300048904 Bacteria 3082
354 Ga0496101_0054525 3300048904 Bacteria 2886
355 Ga0496101_0280685 3300048904 Bacteria 1302
356 Ga0496102_0002953 3300048905 Bacteria 14410
357 Ga0496102_0006974 3300048905 Bacteria 9640
358 Ga0496102_0032382 3300048905 Bacteria 4696
359 Ga0496102_1002569 3300048905 Bacteria 756
360 Ga0496103_0018412 3300048906 Bacteria 4189
361 Ga0496103_0163235 3300048906 Bacteria 1429
362 Ga0496104_0000448 3300048907 Bacteria 35698
363 Ga0496104_0041670 3300048907 Bacteria 4306
364 Ga0496104_0171012 3300048907 Bacteria 2084
365 Ga0496104_0173852 3300048907 Bacteria 2064
366 Ga0496104_1046094 3300048907 Bacteria 720
367 Ga0496105_0000277 3300048908 Bacteria 33919
368 Ga0496105_0038143 3300048908 Bacteria 3958
369 Ga0496105_0112227 3300048908 Bacteria 2250
370 Ga0496106_0006563 3300048909 Bacteria 8616
371 Ga0496106_0267046 3300048909 Bacteria 1370
372 Ga0496106_0353020 3300048909 Bacteria 1181
373 Ga0496106_0692664 3300048909 Bacteria 812
374 Ga0496107_0001501 3300048910 Bacteria 14485
375 Ga0496107_0061976 3300048910 Bacteria 2709
376 Ga0496107_0078003 3300048910 Bacteria 2413
377 Ga0496107_0165310 3300048910 Bacteria 1640
378 Ga0496107_0839780 3300048910 Bacteria 671
379 Ga0496108_0003639 3300048911 Bacteria 12354
380 Ga0496108_0028502 3300048911 Bacteria 4620
381 Ga0496108_0288849 3300048911 Bacteria 1428
382 Ga0496108_0299862 3300048911 Bacteria 1400
383 Ga0496108_0360898 3300048911 Bacteria 1268
384 Ga0496108_0635686 3300048911 Bacteria 928
385 Ga0496109_0000295 3300048912 Bacteria 47285
386 Ga0496109_0007092 3300048912 Bacteria 9458
387 Ga0496109_0007295 3300048912 Bacteria 9345
388 Ga0496109_0012974 3300048912 Bacteria 7202
389 Ga0496109_0534007 3300048912 Bacteria 1107
390 Ga0496109_1372011 3300048912 Bacteria 642
391 Ga0496109_1810326 3300048912 Bacteria 544
392 Ga0496110_0000245 3300048913 Bacteria 35097
393 Ga0496110_0002764 3300048913 Bacteria 13252
394 Ga0496110_0006478 3300048913 Bacteria 9280
395 Ga0496110_0015933 3300048913 Bacteria 6269
396 Ga0496110_0200367 3300048913 Bacteria 1814
397 Ga0496111_0000392 3300048914 Bacteria 21948
398 Ga0496111_0003495 3300048914 Bacteria 9721
399 Ga0496111_0023461 3300048914 Bacteria 4332
400 Ga0496111_0133995 3300048914 Bacteria 1834
401 Ga0496111_0283990 3300048914 Bacteria 1228
402 Ga0496111_0457173 3300048914 Bacteria 942
403 Ga0496111_0463486 3300048914 Bacteria 934
404 Ga0496112_0005893 3300048915 Bacteria 10680
405 Ga0496112_0294440 3300048915 Bacteria 1569
406 Ga0496112_0366074 3300048915 Bacteria 1383
407 Ga0496112_0601884 3300048915 Bacteria 1031
408 Ga0496112_0779917 3300048915 Unclassified 881
409 Ga0496113_0020360 3300048916 Bacteria 4663
410 Ga0496113_0330432 3300048916 Bacteria 1222
411 Ga0496113_0373468 3300048916 Bacteria 1144
412 Ga0496113_0632376 3300048916 Bacteria 856
413 Ga0496113_1479189 3300048916 Bacteria 525
414 Ga0496114_0000223 3300048917 Bacteria 41188
415 Ga0496114_0000352 3300048917 Bacteria 33647
416 Ga0496114_0001679 3300048917 Bacteria 16797
417 Ga0496114_0009925 3300048917 Bacteria 7568
418 Ga0496114_0057784 3300048917 Bacteria 3239
419 Ga0496114_0096937 3300048917 Bacteria 2511
420 Ga0496114_0449462 3300048917 Bacteria 1141
421 Ga0496115_0033533 3300048918 Bacteria 4054
422 Ga0496115_0544968 3300048918 Bacteria 928
423 Ga0496115_0585117 3300048918 Bacteria 889
424 Ga0496122_0095978 3300048925 Bacteria 2001
425 Ga0496123_0038476 3300048926 Bacteria 3360
426 Ga0501031_0004702 3300049568 Bacteria 8857
427 Ga0501031_0759450 3300049568 Bacteria 622
428 Ga0501032_0065723 3300049569 Bacteria 2425
429 Ga0501033_0701416 3300049570 Unclassified 689
430 Ga0501034_0000980 3300049571 Bacteria 41015
431 Ga0501036_0004556 3300049572 Bacteria 11194
432 Ga0501036_0573360 3300049572 Bacteria 937
433 Ga0501037_0495467 3300049573 Bacteria 829
434 Ga0501038_0014787 3300049574 Bacteria 7109
435 Ga0501039_0045703 3300049575 Bacteria 3383
436 Ga0501039_0311262 3300049575 Bacteria 1238
437 Ga0501040_0331334 3300049576 Unclassified 1089
438 Ga0501041_0023384 3300049577 Bacteria 3706
439 Ga0501041_0026615 3300049577 Bacteria 3480
440 Ga0501041_0351589 3300049577 Bacteria 931
441 Ga0501042_0002742 3300049578 Bacteria 10863
442 Ga0501042_0218605 3300049578 Bacteria 1374
443 Ga0501043_0335684 3300049579 Bacteria 1150
444 Ga0501046_0004548 3300049580 Bacteria 12567
445 Ga0501046_0398349 3300049580 Bacteria 995
446 Ga0501048_0002148 3300049582 Bacteria 15046
447 Ga0501068_0139873 3300049584 Bacteria 1517
448 Ga0501069_0032802 3300049585 Bacteria 2859
449 Ga0501070_0103792 3300049586 Bacteria 2351
450 Ga0501071_0038012 3300049587 Bacteria 3438
451 Ga0501072_0008230 3300049588 Bacteria 7921
452 Ga0501073_0059046 3300049589 Bacteria 2680
453 Ga0501074_0004601 3300049590 Bacteria 9880
454 Ga0501074_0266191 3300049590 Unclassified 1218
455 Ga0501075_0004383 3300049591 Bacteria 9549
456 Ga0501075_0087591 3300049591 Bacteria 2360
457 Ga0501075_0093229 3300049591 Bacteria 2286
458 Ga0501075_0162190 3300049591 Bacteria 1706
459 Ga0501076_0006613 3300049592 Bacteria 8407
460 Ga0501076_0173492 3300049592 Bacteria 1758
461 Ga0501076_0539270 3300049592 Bacteria 962
462 Ga0501076_1029257 3300049592 Bacteria 678
463 Ga0501077_0016808 3300049593 Bacteria 4615
464 Ga0501077_0080264 3300049593 Bacteria 2067
465 Ga0501077_0765743 3300049593 Unclassified 621
466 Ga0501207_044780 3300049654 Bacteria 778
467 Ga0501209_169065 3300049656 Bacteria 664
468 Ga0501223_054224 3300049663 Bacteria 779
469 Ga0501079_0002853 3300049741 Bacteria 12609
470 Ga0501079_0167375 3300049741 Bacteria 1714
471 Ga0501080_0372470 3300049742 Bacteria 1287
472 Ga0501081_0000280 3300049743 Bacteria 26904
473 Ga0501081_0047756 3300049743 Bacteria 2945
474 Ga0501081_0266085 3300049743 Bacteria 1253
475 Ga0501081_1014530 3300049743 Bacteria 627
476 Ga0501083_0181985 3300049744 Bacteria 1372
477 Ga0501268_024543 3300049765 Bacteria 1054
478 Ga0501270_108471 3300049767 Bacteria 589
479 Ga0501044_0306362 3300049823 Bacteria 1516
480 Ga0501045_0001032 3300049824 Bacteria 18298
481 Ga0501045_0468641 3300049824 Bacteria 936
482 Ga0501045_1145491 3300049824 Bacteria 568
483 nmdc:mga00v17_12229_c1 3300050491 Bacteria 4735
484 nmdc:mga00v17_455517_c1 3300050491 Bacteria 830
485 nmdc:mga0qj67_122783_c1 3300050509 Bacteria 2101
486 nmdc:mga08y16_523558_c1 3300050511 Unclassified 1202
487 nmdc:mga08y16_563001_c1 3300050511 Bacteria 1152
488 nmdc:mga0n895_1916930_c1 3300050512 Bacteria 551
489 nmdc:mga0rr50_672526_c1 3300050513 Bacteria 883
490 nmdc:mga0sz30_128189_c1 3300050516 Bacteria 1117
491 Ga0500577_0187754 3300053142 Bacteria 889
492 Ga0501084_0001558 3300054114 Bacteria 18206
493 Ga0501084_0014663 3300054114 Bacteria 6499
494 Ga0501084_0103166 3300054114 Bacteria 2395
495 Ga0501084_0281006 3300054114 Unclassified 1406
496 Ga0501082_0009322 3300060353 Bacteria 8460
497 Ga0501082_0245221 3300060353 Bacteria 1559
498 Ga0530510_0017802 3300061734 Bacteria 5037
499 2509077514 2508501114 Bacteria 7082538
500 2643816779 2643221559 Bacteria 4424915
501 2643938541 2643221586 Bacteria 4446529
502 2643973761 2643221593 Bacteria 6296053
503 2644077712 2643221612 Bacteria 4361984
504 2644528271 2643221695 Bacteria 3441323
505 2644693973 2643221727 Bacteria 4415595
506 2923517340 2923516293 Bacteria 3716336
507 Ga0070665_101311260
508 JGI24750J21931_1065328
509 Ga0055531_10005650
510 Ga0070658_10230644
511 Ga0070683_100000899
512 Ga0070690_100034555
513 Ga0070670_100086110
514 Ga0068869_100056891
515 Ga0070666_10071571
516 Ga0070666_10168312
517 Ga0070682_100021985
518 Ga0070682_100788691
519 Ga0068868_100104058
520 Ga0070660_100544278
521 Ga0070660_101588301
522 Ga0070689_100228715
523 Ga0070687_100214796
524 Ga0070661_100053092
525 Ga0070661_100357393
526 Ga0070668_100052877
527 Ga0070668_100069469
528 Ga0070675_100134294
529 Ga0070671_100019539
530 Ga0070674_100019904
531 Ga0070674_101368416
532 Ga0070674_101510331
533 Ga0070673_100385187
534 Ga0070659_100414042
535 Ga0070659_100680020
536 Ga0070659_100893226
537 Ga0070667_100011036
538 Ga0070703_10556079
539 Ga0070709_10127042
540 Ga0070714_100255630
541 Ga0070714_101258391
542 Ga0070701_10029329
543 Ga0070701_10799653
544 Ga0070700_100085745
545 Ga0070694_100159331
546 Ga0070663_100072803
547 Ga0070663_100388717
548 Ga0070663_101133034
549 Ga0070678_100004161
550 Ga0070678_100011328
551 Ga0070678_100311217
552 Ga0070662_100846949
553 Ga0070681_10011647
554 Ga0068867_100035397
555 Ga0070706_100214966
556 Ga0070698_100302560
557 Ga0070698_100453913
558 Ga0070699_100156219
559 Ga0070679_100036721
560 Ga0070684_100005453
561 Ga0070684_100820447
562 Ga0070684_101354737
563 Ga0070697_100476170
564 Ga0070672_100011428
565 Ga0070672_100387530
566 Ga0070672_101292992
567 Ga0070686_100141854
568 Ga0070686_100152314
569 Ga0070695_100550336
570 Ga0070696_100351755
571 Ga0070693_100002761
572 Ga0070693_100011863
573 Ga0070665_100304746
574 Ga0070704_100153120
575 Ga0070664_100002816
576 Ga0070664_100016764
577 Ga0068854_101107400
578 Ga0068856_100008969
579 Ga0068856_100016941
580 Ga0068856_102470171
581 Ga0070702_100035894
582 Ga0070702_100049398
583 Ga0068852_100123820
584 Ga0068859_100327136
585 Ga0068859_100592468
586 Ga0068864_102402785
587 Ga0068866_10438762
588 Ga0068861_101473207
589 Ga0068851_10081043
590 Ga0068870_10075763
591 Ga0068858_100079530
592 Ga0068862_100035301
593 Ga0081455_10000321
594 Ga0081455_10255002
595 Ga0081455_10593802
596 Ga0081455_10711100
597 Ga0070716_100005504
598 Ga0070712_100089294
599 Ga0070712_100292264
600 Ga0070712_100294605
601 Ga0075369_10131317
602 Ga0097621_100147570
603 Ga0068871_100148640
604 Ga0068871_101613022
605 Ga0075428_100832961
606 Ga0075430_100167660
607 Ga0075431_100849556
608 Ga0075431_101281236
609 Ga0068865_100020296
610 Ga0068865_101521627
611 Ga0097620_100327122
612 Ga0097620_100592480
613 Ga0105240_11941348
614 Ga0111539_10377506
615 Ga0105245_10018086
616 Ga0105245_10070392
617 Ga0105245_10970336
618 Ga0105245_11050814
619 Ga0105245_11167395
620 Ga0105245_11290438
621 Ga0105245_11730282
622 Ga0105247_10014554
623 Ga0114129_10351709
624 Ga0114129_10969336
625 Ga0114129_11788774
626 Ga0105243_10258053
627 Ga0105243_10466109
628 Ga0105241_10039229
629 Ga0105241_11497519
630 Ga0105242_10010367
631 Ga0105242_11107377
632 Ga0105242_11827368
633 Ga0105242_12995367
634 Ga0105248_10152444
635 Ga0105248_10886117
636 Ga0105248_11253610
637 Ga0105237_11101980
638 Ga0105238_10062780
639 Ga0105238_10564671
640 Ga0105249_10021634
641 Ga0105249_10437148
642 Ga0105239_10185338
643 Ga0105239_10259390
644 Ga0105239_10451613
645 Ga0157371_10318278
646 Ga0157374_10034631
647 Ga0157374_10170131
648 Ga0157378_10037644
649 Ga0157378_11269541
650 Ga0157378_11510228
651 Ga0163162_10571320
652 Ga0157375_10017064
653 Ga0157375_10333297
654 Ga0157375_10456852
655 Ga0163163_10064360
656 Ga0163163_10523602
657 Ga0163163_10846467
658 Ga0163163_12149341
659 Ga0182008_10034018
660 Ga0182008_10304318
661 Ga0157377_10108423
662 Ga0157377_10154664
663 Ga0157377_10438721
664 Ga0157379_10011596
665 Ga0157376_10328771
666 Ga0157376_10408626
667 Ga0157376_10976244
668 Ga0163161_10063056
669 Ga0163161_10370700
670 Ga0207425_1001346
671 Ga0209025_1000023
672 Ga0209257_1000046
673 Ga0207656_10078644
674 Ga0207710_10244662
675 Ga0207680_10158022
676 Ga0207685_10176480
677 Ga0207645_10409218
678 Ga0207684_10124523
679 Ga0207707_11268719
680 Ga0207671_11243669
681 Ga0207693_10107093
682 Ga0207693_10335572
683 Ga0207693_10825955
684 Ga0207663_10068795
685 Ga0207662_10223560
686 Ga0207662_10663983
687 Ga0207657_10366090
688 Ga0207652_10029031
689 Ga0207681_10941040
690 Ga0207694_10637794
691 Ga0207650_10109298
692 Ga0207659_10252996
693 Ga0207659_10804831
694 Ga0207687_10007375
695 Ga0207687_10013462
696 Ga0207687_10410323
697 Ga0207687_10466522
698 Ga0207687_10535555
699 Ga0207700_10336394
700 Ga0207664_10893071
701 Ga0207644_10030266
702 Ga0207644_10844548
703 Ga0207690_10144520
704 Ga0207690_10839134
705 Ga0207706_11391117
706 Ga0207686_10001474
707 Ga0207686_10854757
708 Ga0207709_11233281
709 Ga0207669_10015014
710 Ga0207669_10283130
711 Ga0207704_10245637
712 Ga0207704_11433932
713 Ga0207691_10018736
714 Ga0207691_10617331
715 Ga0207711_10048054
716 Ga0207689_10351346
717 Ga0207661_10012036
718 Ga0207679_10001973
719 Ga0207679_10019401
720 Ga0207651_10185722
721 Ga0207712_10108161
722 Ga0207668_10052546
723 Ga0207668_10109767
724 Ga0207640_10091778
725 Ga0207658_10084587
726 Ga0207677_10003025
727 Ga0207677_10046775
728 Ga0207677_10102565
729 Ga0207703_10182077
730 Ga0207639_11399666
731 Ga0207678_10265526
732 Ga0207678_10537032
733 Ga0207708_10250651
734 Ga0207702_10006766
735 Ga0207702_10024686
736 Ga0207702_10661074
737 Ga0207648_10114241
738 Ga0207676_11729560
739 Ga0207675_100403042
740 Ga0207675_101981328
741 Ga0207683_10007207
742 Ga0207683_10013949
743 Ga0207683_10146775
744 Ga0207698_11951861
745 Ga0207698_12180025
746 Ga0209967_1036268
747 Ga0209995_1000939
748 Ga0209999_1000318
749 Ga0209982_1001308
750 Ga0209983_1070897
751 Ga0209971_1000679
752 Ga0268266_10335498
753 Ga0268265_10030876
754 Ga0268265_11560947
755 Ga0307515_10234700
756 Ga0265338_10213217
757 Ga0316181_1040277
758 Ga0265330_10003677
759 Ga0265332_10000251
760 Ga0265328_10005239
761 Ga0265320_10035067
762 Ga0265329_10020115
763 Ga0265340_10183435
764 Ga0265339_10025297
765 Ga0265331_10000032
766 Ga0265316_10000070
767 Ga0307513_10129267
768 Ga0307408_100962990
769 Ga0265313_10114895
770 Ga0265314_10000300
771 Ga0265342_10002144
772 Ga0316576_10000018
773 Ga0316578_10002330
774 Ga0307405_11367920
775 Ga0307405_11532793
776 Ga0316577_10000182
777 Ga0307413_10005208
778 Ga0307410_10155017
779 Ga0307410_10754346
780 Ga0307406_10329023
781 Ga0307407_10572809
782 Ga0307409_102167653
783 Ga0307409_102507910
784 Ga0307416_101597053
785 Ga0307414_10016406
786 Ga0307414_10118045
787 Ga0307414_10203090
788 Ga0307414_11345121
789 Ga0307414_11968560
790 Ga0307415_100762688
791 Ga0307415_101131448
792 Ga0373932_0267331
793 Ga0316574_0829233
794 Ga0373931_0329392
795 Ga0316582_0136381
796 Ga0316584_0017026
797 Ga0395899_0071456
798 Ga0395900_0090195
799 Ga0395900_1913265
800 Ga0395898_0002002
801 Ga0395905_0593110
802 Ga0395901_0006270
803 Ga0395901_0925387
804 Ga0395901_0954277
805 Ga0439436_0056816
806 Ga0439439_0000567
807 Ga0439461_0224226
808 Ga0439465_0127436
809 Ga0451791_1340119
810 Ga0451793_1386602
811 Ga0451795_0847706
812 Ga0451795_0928848
813 Ga0451843_0258499
814 Ga0451853_3623803
815 Ga0439431_0017018
816 Ga0439433_0010263
817 Ga0439433_0195081
818 Ga0439441_107448
819 Ga0439445_0125907
820 Ga0439432_009135
821 Ga0439449_0012640
822 Ga0450917_008663
823 Ga0450889_005813
824 Ga0439435_0363672
825 Ga0439464_0188626
826 Ga0453683_0174636
827 Ga0453684_0023944
828 Ga0495603_0126022
829 Ga0495641_0445988
830 Ga0495582_0386802
831 Ga0495585_0622332
832 Ga0495594_0113718
833 Ga0495616_0286549
834 Ga0495630_0215701
835 Ga0495663_0001500
836 Ga0495663_0382908
837 Ga0495654_0156379
838 Ga0495640_0737789
839 Ga0495621_0000021
840 Ga0495656_0153084
841 Ga0495656_0400915
842 Ga0495634_0198560
843 Ga0495611_0545931
844 Ga0495659_0006807
845 Ga0495647_0035745
846 Ga0495658_0146536
847 Ga0495613_0063176
848 Ga0495670_0149368
849 Ga0495671_0020659
850 Ga0495581_0185907
851 Ga0495676_0075693
852 Ga0495615_0044352
853 Ga0496100_0006149
854 Ga0496100_0147633
855 Ga0496100_0436314
856 Ga0496100_0497776
857 Ga0496100_0721043
858 Ga0496101_0000726
859 Ga0496101_0047506
860 Ga0496101_0054525
861 Ga0496101_0280685
862 Ga0496102_0002953
863 Ga0496102_0006974
864 Ga0496102_0032382
865 Ga0496102_1002569
866 Ga0496103_0018412
867 Ga0496103_0163235
868 Ga0496104_0000448
869 Ga0496104_0041670
870 Ga0496104_0171012
871 Ga0496104_0173852
872 Ga0496104_1046094
873 Ga0496105_0000277
874 Ga0496105_0038143
875 Ga0496105_0112227
876 Ga0496106_0006563
877 Ga0496106_0267046
878 Ga0496106_0353020
879 Ga0496106_0692664
880 Ga0496107_0001501
881 Ga0496107_0061976
882 Ga0496107_0078003
883 Ga0496107_0165310
884 Ga0496107_0839780
885 Ga0496108_0003639
886 Ga0496108_0028502
887 Ga0496108_0288849
888 Ga0496108_0299862
889 Ga0496108_0360898
890 Ga0496108_0635686
891 Ga0496109_0000295
892 Ga0496109_0007092
893 Ga0496109_0007295
894 Ga0496109_0012974
895 Ga0496109_0534007
896 Ga0496109_1372011
897 Ga0496109_1810326
898 Ga0496110_0000245
899 Ga0496110_0002764
900 Ga0496110_0006478
901 Ga0496110_0015933
902 Ga0496110_0200367
903 Ga0496111_0000392
904 Ga0496111_0003495
905 Ga0496111_0023461
906 Ga0496111_0133995
907 Ga0496111_0283990
908 Ga0496111_0457173
909 Ga0496111_0463486
910 Ga0496112_0005893
911 Ga0496112_0294440
912 Ga0496112_0366074
913 Ga0496112_0601884
914 Ga0496112_0779917
915 Ga0496113_0020360
916 Ga0496113_0330432
917 Ga0496113_0373468
918 Ga0496113_0632376
919 Ga0496113_1479189
920 Ga0496114_0000223
921 Ga0496114_0000352
922 Ga0496114_0001679
923 Ga0496114_0009925
924 Ga0496114_0057784
925 Ga0496114_0096937
926 Ga0496114_0449462
927 Ga0496115_0033533
928 Ga0496115_0544968
929 Ga0496115_0585117
930 Ga0496122_0095978
931 Ga0496123_0038476
932 Ga0501031_0004702
933 Ga0501031_0759450
934 Ga0501032_0065723
935 Ga0501033_0701416
936 Ga0501034_0000980
937 Ga0501036_0004556
938 Ga0501036_0573360
939 Ga0501037_0495467
940 Ga0501038_0014787
941 Ga0501039_0045703
942 Ga0501039_0311262
943 Ga0501040_0331334
944 Ga0501041_0023384
945 Ga0501041_0026615
946 Ga0501041_0351589
947 Ga0501042_0002742
948 Ga0501042_0218605
949 Ga0501043_0335684
950 Ga0501046_0004548
951 Ga0501046_0398349
952 Ga0501048_0002148
953 Ga0501068_0139873
954 Ga0501069_0032802
955 Ga0501070_0103792
956 Ga0501071_0038012
957 Ga0501072_0008230
958 Ga0501073_0059046
959 Ga0501074_0004601
960 Ga0501074_0266191
961 Ga0501075_0004383
962 Ga0501075_0087591
963 Ga0501075_0093229
964 Ga0501075_0162190
965 Ga0501076_0006613
966 Ga0501076_0173492
967 Ga0501076_0539270
968 Ga0501076_1029257
969 Ga0501077_0016808
970 Ga0501077_0080264
971 Ga0501077_0765743
972 Ga0501207_044780
973 Ga0501209_169065
974 Ga0501223_054224
975 Ga0501079_0002853
976 Ga0501079_0167375
977 Ga0501080_0372470
978 Ga0501081_0000280
979 Ga0501081_0047756
980 Ga0501081_0266085
981 Ga0501081_1014530
982 Ga0501083_0181985
983 Ga0501268_024543
984 Ga0501270_108471
985 Ga0501044_0306362
986 Ga0501045_0001032
987 Ga0501045_0468641
988 Ga0501045_1145491
989 nmdc:mga00v17_12229_c1
990 nmdc:mga00v17_455517_c1
991 nmdc:mga0qj67_122783_c1
992 nmdc:mga08y16_523558_c1
993 nmdc:mga08y16_563001_c1
994 nmdc:mga0n895_1916930_c1
995 nmdc:mga0rr50_672526_c1
996 nmdc:mga0sz30_128189_c1
997 Ga0500577_0187754
998 Ga0501084_0001558
999 Ga0501084_0014663
1000 Ga0501084_0103166
1001 Ga0501084_0281006
1002 Ga0501082_0009322
1003 Ga0501082_0245221
1004 Ga0530510_0017802
1005 2509077514
1006 2643816779
1007 2643938541
1008 2643973761
1009 2644077712
1010 2644528271
1011 2644693973
1012 2923517340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

18

136

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nq3-assembly2.cif.gz_E crystal structure of the mammalian tumor associated antigen uk114 0.9728 2 126
1oni-assembly2.cif.gz_D crystal structure of a human p14.5, a translational inhibitor reveals different mode of ligand binding near the invariant residues of the yjgf/uk114 protein family 0.9727 2 126
1xrg-assembly1.cif.gz_A conserved hypothetical protein from clostridium thermocellum cth-2968 0.9722 2 126
1xrg-assembly1.cif.gz_C conserved hypothetical protein from clostridium thermocellum cth-2968 0.9713 3 126
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.9711 19 126
ID Description Score Start End Superfamily
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9744 19 126 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9723 2 126 3.30.1330.40
3k0tB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9687 4 126 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9656 19 126 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9654 1 125 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A2V9MT62-F1-model_v4 Reactive intermediate/imine deaminase 0.9978 1 126 GO:0005829
GO:0019239
AF-A0A2V6LLV0-F1-model_v4 Reactive intermediate/imine deaminase 0.9957 1 126 GO:0005829
GO:0019239
AF-A0A2A4NIQ8-F1-model_v4 Reactive intermediate/imine deaminase 0.9853 1 126 GO:0005829
GO:0019239
AF-A0A0K1EU92-F1-model_v4 Deaminase 0.9849 2 125 GO:0005829
GO:0019239
AF-A0A6N8UV65-F1-model_v4 deleted 0.9848 23 126

Map