F456403

General Info

Members Datasets Scaffolds Average Seq Length
505 238 505 343

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0070789|Ga0466967_0070789_1222_2340
Length 372
Sequence MLVAGLWPPNAPGRPLARVAADPSSIGVNVRRALITGVTGQDGSYLAELLLGKGYEVHGLIRRASMFNTGRIDHLYRDPHDESARLYLHYGDLTDGARLVSLMREIDPDEVYNLGAQSHVRVSFDEPEYTGNTTALGAMRLLEAVRMSGVECRYYQASSSEMFGSEAPPQSETTPFYPRSPYGVAKVYAYWAARNYREAYGLFAVNGILFNHESPRRGETFVTRKITRAAARIKAGLDDYVYLGNLDAERDWGYAPEFVEGMWRMLQADEPDDFVLATGSSMTVRDFLDASFSHLGLAWQDHVKFDERYLRPSEVDALRGDASKAEKVLGWKPKVDGQKLAQIMVEADLEALEHAGRPWIDKVVLSDWPATP

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
132 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
133 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
238 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 0
Rhizoplane 2.18
Rhizosphere 93.86
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10074099 3300005289 Bacteria 6521
2 Ga0065704_10096841 3300005289 Bacteria 2422
3 Ga0065712_10073890 3300005290 Bacteria 4232
4 Ga0065715_10109939 3300005293 Bacteria 2645
5 Ga0065715_10188707 3300005293 Bacteria 1429
6 Ga0065707_10083075 3300005295 Bacteria 10603
7 Ga0065707_10083441 3300005295 Bacteria 9176
8 Ga0065707_10088234 3300005295 Bacteria 4728
9 Ga0065707_10099918 3300005295 Bacteria 2969
10 Ga0070683_100017063 3300005329 Bacteria 6408
11 Ga0070683_100110947 3300005329 Bacteria 2587
12 Ga0070690_100047234 3300005330 Bacteria 2739
13 Ga0068869_100008875 3300005334 Bacteria 6504
14 Ga0068869_100021295 3300005334 Bacteria 4459
15 Ga0068869_100034057 3300005334 Bacteria 3601
16 Ga0070682_100000123 3300005337 Bacteria 68616
17 Ga0070689_100037996 3300005340 Bacteria 3682
18 Ga0070689_100067906 3300005340 Bacteria 2780
19 Ga0070689_100092978 3300005340 Bacteria 2380
20 Ga0070689_100094348 3300005340 Bacteria 2362
21 Ga0070689_100097858 3300005340 Bacteria 2320
22 Ga0070669_100000544 3300005353 Bacteria 28111
23 Ga0070671_100053815 3300005355 Bacteria 3346
24 Ga0070688_100062435 3300005365 Bacteria 2358
25 Ga0070688_100105428 3300005365 Unclassified 1866
26 Ga0070667_100121922 3300005367 Bacteria 2268
27 Ga0070667_100236161 3300005367 Bacteria 1631
28 Ga0070705_100058587 3300005440 Bacteria 2277
29 Ga0070705_100064908 3300005440 Bacteria 2183
30 Ga0070708_100007541 3300005445 Bacteria 8710
31 Ga0070708_100014498 3300005445 Bacteria 6488
32 Ga0070708_100015055 3300005445 Bacteria 6381
33 Ga0070708_100015563 3300005445 Bacteria 6287
34 Ga0070708_100146062 3300005445 Bacteria 2197
35 Ga0070678_100032388 3300005456 Bacteria 3618
36 Ga0070662_100166995 3300005457 Bacteria 1725
37 Ga0070681_10002938 3300005458 Bacteria 15800
38 Ga0070681_10204887 3300005458 Bacteria 1890
39 Ga0068867_100080922 3300005459 Bacteria 2447
40 Ga0070685_10079067 3300005466 Bacteria 1967
41 Ga0070706_100000784 3300005467 Bacteria 35492
42 Ga0070706_100001479 3300005467 Bacteria 24663
43 Ga0070706_100002727 3300005467 Bacteria 17658
44 Ga0070706_100059192 3300005467 Bacteria 3535
45 Ga0070706_100074824 3300005467 Bacteria 3134
46 Ga0070706_100234858 3300005467 Bacteria 1712
47 Ga0070706_100399356 3300005467 Bacteria 1280
48 Ga0070707_100015744 3300005468 Bacteria 7099
49 Ga0070707_100016067 3300005468 Bacteria 7022
50 Ga0070707_100030686 3300005468 Bacteria 5119
51 Ga0070698_100003590 3300005471 Bacteria 17052
52 Ga0070698_100007126 3300005471 Bacteria 12109
53 Ga0070698_100015564 3300005471 Bacteria 8031
54 Ga0070698_100020782 3300005471 Bacteria 6880
55 Ga0070698_100028632 3300005471 Bacteria 5785
56 Ga0070698_100093499 3300005471 Bacteria 2986
57 Ga0070698_100278631 3300005471 Bacteria 1604
58 Ga0070699_100000667 3300005518 Bacteria 32069
59 Ga0070699_100002679 3300005518 Bacteria 15914
60 Ga0070699_100132859 3300005518 Bacteria 2195
61 Ga0070699_100260438 3300005518 Bacteria 1551
62 Ga0070699_100417437 3300005518 Bacteria 1214
63 Ga0070679_100108148 3300005530 Bacteria 2767
64 Ga0070684_100034584 3300005535 Bacteria 4321
65 Ga0070697_100000406 3300005536 Bacteria 33231
66 Ga0070697_100002369 3300005536 Bacteria 14497
67 Ga0070697_100003496 3300005536 Bacteria 12071
68 Ga0070697_100008918 3300005536 Bacteria 7835
69 Ga0070697_100042664 3300005536 Unclassified 3671
70 Ga0070697_100067241 3300005536 Bacteria 2931
71 Ga0070697_100220413 3300005536 Bacteria 1617
72 Ga0068853_100042949 3300005539 Bacteria 3867
73 Ga0070672_100110246 3300005543 Bacteria 2242
74 Ga0070686_100008320 3300005544 Bacteria 5810
75 Ga0070686_100045408 3300005544 Bacteria 2767
76 Ga0070686_100054890 3300005544 Bacteria 2550
77 Ga0070696_100049425 3300005546 Unclassified 2921
78 Ga0070696_100064970 3300005546 Bacteria 2557
79 Ga0070696_100132162 3300005546 Bacteria 1817
80 Ga0070696_100153080 3300005546 Bacteria 1694
81 Ga0070693_100002195 3300005547 Bacteria 8952
82 Ga0070665_100000996 3300005548 Bacteria 35909
83 Ga0070665_100155972 3300005548 Bacteria 2285
84 Ga0070704_100018229 3300005549 Bacteria 4483
85 Ga0070704_100031837 3300005549 Bacteria 3551
86 Ga0070704_100116684 3300005549 Bacteria 2042
87 Ga0068855_100074130 3300005563 Bacteria 3953
88 Ga0070664_100015607 3300005564 Bacteria 6215
89 Ga0070664_100016708 3300005564 Bacteria 6018
90 Ga0070664_100085741 3300005564 Bacteria 2720
91 Ga0070664_100177059 3300005564 Bacteria 1894
92 Ga0068856_100000160 3300005614 Bacteria 69926
93 Ga0070702_100040565 3300005615 Bacteria 2605
94 Ga0068852_100219087 3300005616 Bacteria 1809
95 Ga0068859_100066493 3300005617 Bacteria 3640
96 Ga0068864_100003095 3300005618 Bacteria 13745
97 Ga0068864_100253820 3300005618 Bacteria 1634
98 Ga0068866_10051104 3300005718 Bacteria 2102
99 Ga0068863_100170342 3300005841 Bacteria 2088
100 Ga0068863_100204507 3300005841 Bacteria 1900
101 Ga0068863_100297749 3300005841 Bacteria 1564
102 Ga0068858_100029386 3300005842 Bacteria 5103
103 Ga0068858_100036628 3300005842 Bacteria 4548
104 Ga0068858_100447221 3300005842 Bacteria 1245
105 Ga0068860_100055395 3300005843 Bacteria 3770
106 Ga0068860_100432613 3300005843 Bacteria 1306
107 Ga0068862_100156575 3300005844 Bacteria 2031
108 Ga0081455_10002146 3300005937 Bacteria 23521
109 Ga0081540_1001119 3300005983 Bacteria 23729
110 Ga0081539_10000492 3300005985 Bacteria 83156
111 Ga0081539_10003410 3300005985 Bacteria 19594
112 Ga0070717_10054713 3300006028 Bacteria 3291
113 Ga0070717_10405594 3300006028 Bacteria 1225
114 Ga0070716_100064172 3300006173 Bacteria 2134
115 Ga0070712_100285770 3300006175 Bacteria 1330
116 Ga0075366_10016465 3300006195 Bacteria 4250
117 Ga0097621_100016162 3300006237 Bacteria 5635
118 Ga0097621_100092273 3300006237 Bacteria 2536
119 Ga0097621_100269004 3300006237 Bacteria 1497
120 Ga0068871_100039617 3300006358 Bacteria 3771
121 Ga0068871_100072069 3300006358 Bacteria 2844
122 Ga0075428_100002910 3300006844 Bacteria 18638
123 Ga0075428_100026856 3300006844 Bacteria 6374
124 Ga0075428_100033167 3300006844 Bacteria 5702
125 Ga0075428_100069430 3300006844 Bacteria 3852
126 Ga0075428_100115379 3300006844 Bacteria 2926
127 Ga0075428_100684796 3300006844 Bacteria 1092
128 Ga0075430_100003362 3300006846 Bacteria 13391
129 Ga0075430_100034660 3300006846 Bacteria 4285
130 Ga0075430_100066163 3300006846 Bacteria 3035
131 Ga0075431_100013003 3300006847 Bacteria 8405
132 Ga0075431_100072920 3300006847 Bacteria 3542
133 Ga0075431_100168185 3300006847 Bacteria 2253
134 Ga0075431_100207492 3300006847 Bacteria 2003
135 Ga0075433_10005536 3300006852 Bacteria 9915
136 Ga0075433_10030338 3300006852 Bacteria 4612
137 Ga0075433_10034647 3300006852 Bacteria 4338
138 Ga0075433_10251471 3300006852 Unclassified 1568
139 Ga0075434_100001928 3300006871 Bacteria 17990
140 Ga0075434_100002547 3300006871 Bacteria 16081
141 Ga0075434_100156482 3300006871 Bacteria 2298
142 Ga0075429_100000249 3300006880 Bacteria 37106
143 Ga0075429_100236294 3300006880 Bacteria 1601
144 Ga0075436_100007039 3300006914 Bacteria 7700
145 Ga0075436_100025523 3300006914 Bacteria 4068
146 Ga0097620_100066493 3300006931 Bacteria 3640
147 Ga0075435_100028881 3300007076 Bacteria 4351
148 Ga0075435_100132279 3300007076 Bacteria 2088
149 Ga0075435_100165949 3300007076 Bacteria 1862
150 Ga0075435_100278588 3300007076 Bacteria 1427
151 Ga0105240_10048964 3300009093 Bacteria 5338
152 Ga0111539_10033023 3300009094 Bacteria 6283
153 Ga0111539_10101081 3300009094 Bacteria 3385
154 Ga0111539_10180905 3300009094 Bacteria 2462
155 Ga0105245_10016138 3300009098 Bacteria 6508
156 Ga0114129_10006478 3300009147 Bacteria 16607
157 Ga0114129_10007007 3300009147 Bacteria 16047
158 Ga0114129_10018774 3300009147 Bacteria 9850
159 Ga0114129_10022653 3300009147 Bacteria 8909
160 Ga0114129_10026555 3300009147 Bacteria 8201
161 Ga0114129_10031645 3300009147 Bacteria 7478
162 Ga0114129_10039007 3300009147 Bacteria 6696
163 Ga0114129_10131976 3300009147 Bacteria 3429
164 Ga0114129_10176184 3300009147 Bacteria 2913
165 Ga0114129_10196701 3300009147 Bacteria 2733
166 Ga0114129_10363683 3300009147 Bacteria 1914
167 Ga0105243_10044780 3300009148 Bacteria 3474
168 Ga0105241_10024978 3300009174 Bacteria 4440
169 Ga0105241_10043229 3300009174 Bacteria 3412
170 Ga0105242_10028751 3300009176 Bacteria 4427
171 Ga0105242_10275446 3300009176 Bacteria 1526
172 Ga0105248_10004250 3300009177 Bacteria 15849
173 Ga0105237_10005589 3300009545 Bacteria 14172
174 Ga0105237_10110544 3300009545 Bacteria 2740
175 Ga0105238_10378186 3300009551 Bacteria 1407
176 Ga0105249_10058027 3300009553 Bacteria 3547
177 Ga0105249_10148162 3300009553 Bacteria 2257
178 Ga0105249_10359233 3300009553 Bacteria 1478
179 Ga0105249_10379771 3300009553 Bacteria 1439
180 Ga0105239_10065462 3300010375 Bacteria 3992
181 Ga0105239_10091534 3300010375 Bacteria 3356
182 Ga0157369_10115088 3300013105 Bacteria 2856
183 Ga0157378_10014624 3300013297 Bacteria 6870
184 Ga0157378_10049442 3300013297 Bacteria 3741
185 Ga0163162_10001497 3300013306 Bacteria 21760
186 Ga0163162_10025381 3300013306 Bacteria 5854
187 Ga0157372_10122265 3300013307 Bacteria 2991
188 Ga0157375_10000074 3300013308 Bacteria 103033
189 Ga0157375_10007563 3300013308 Bacteria 9499
190 Ga0157375_10054672 3300013308 Bacteria 3933
191 Ga0157375_10110155 3300013308 Bacteria 2850
192 Ga0157375_10321378 3300013308 Bacteria 1712
193 Ga0157375_10420141 3300013308 Bacteria 1503
194 Ga0163163_10000065 3300014325 Bacteria 115460
195 Ga0163163_10006651 3300014325 Bacteria 10128
196 Ga0163163_10049192 3300014325 Bacteria 4148
197 Ga0157380_10407819 3300014326 Bacteria 1292
198 Ga0157379_10061295 3300014968 Bacteria 3363
199 Ga0157376_10015771 3300014969 Bacteria 5718
200 Ga0157376_10487393 3300014969 Bacteria 1209
201 Ga0163161_10128052 3300017792 Bacteria 1913
202 Ga0213874_10002104 3300021377 Bacteria 4221
203 Ga0213876_10079982 3300021384 Unclassified 1727
204 Ga0213875_10007266 3300021388 Bacteria 5738
205 Ga0209050_1000151 3300025298 Bacteria 162058
206 Ga0207653_10000246 3300025885 Bacteria 35190
207 Ga0207645_10009398 3300025907 Bacteria 6763
208 Ga0207705_10141347 3300025909 Bacteria 1798
209 Ga0207684_10000382 3300025910 Bacteria 59711
210 Ga0207684_10000904 3300025910 Bacteria 33748
211 Ga0207684_10003603 3300025910 Bacteria 15075
212 Ga0207684_10062882 3300025910 Bacteria 3151
213 Ga0207654_10012386 3300025911 Bacteria 4371
214 Ga0207707_10002880 3300025912 Bacteria 15360
215 Ga0207707_10355694 3300025912 Bacteria 1261
216 Ga0207695_10037615 3300025913 Bacteria 5220
217 Ga0207671_10021103 3300025914 Bacteria 4947
218 Ga0207657_10061915 3300025919 Bacteria 3205
219 Ga0207649_10025709 3300025920 Bacteria 3435
220 Ga0207652_10037009 3300025921 Bacteria 4128
221 Ga0207646_10012709 3300025922 Bacteria 8080
222 Ga0207646_10013226 3300025922 Bacteria 7896
223 Ga0207646_10121452 3300025922 Bacteria 2347
224 Ga0207646_10309379 3300025922 Bacteria 1427
225 Ga0207646_10465570 3300025922 Bacteria 1140
226 Ga0207681_10003365 3300025923 Bacteria 10011
227 Ga0207681_10024781 3300025923 Bacteria 3852
228 Ga0207650_10039069 3300025925 Bacteria 3468
229 Ga0207650_10229657 3300025925 Bacteria 1496
230 Ga0207687_10106360 3300025927 Bacteria 2074
231 Ga0207644_10038016 3300025931 Bacteria 3388
232 Ga0207706_10049669 3300025933 Bacteria 3706
233 Ga0207670_10003590 3300025936 Bacteria 8227
234 Ga0207670_10111311 3300025936 Bacteria 1974
235 Ga0207665_10130139 3300025939 Bacteria 1785
236 Ga0207691_10016365 3300025940 Bacteria 7039
237 Ga0207711_10006003 3300025941 Bacteria 10266
238 Ga0207689_10005962 3300025942 Bacteria 10782
239 Ga0207689_10090448 3300025942 Bacteria 2515
240 Ga0207661_10001791 3300025944 Bacteria 14680
241 Ga0207661_10138237 3300025944 Bacteria 2094
242 Ga0207661_10298877 3300025944 Bacteria 1443
243 Ga0207679_10074397 3300025945 Bacteria 2574
244 Ga0207679_10151586 3300025945 Bacteria 1888
245 Ga0207679_10317882 3300025945 Bacteria 1347
246 Ga0207667_10050631 3300025949 Bacteria 4381
247 Ga0207667_10112089 3300025949 Bacteria 2813
248 Ga0207651_10027683 3300025960 Bacteria 3564
249 Ga0207651_10279833 3300025960 Bacteria 1378
250 Ga0207651_10324804 3300025960 Bacteria 1287
251 Ga0207712_10197016 3300025961 Bacteria 1594
252 Ga0207712_10404953 3300025961 Bacteria 1147
253 Ga0207658_10149225 3300025986 Bacteria 1902
254 Ga0207677_10244141 3300026023 Bacteria 1455
255 Ga0207703_10002060 3300026035 Bacteria 17719
256 Ga0207678_10086005 3300026067 Bacteria 2687
257 Ga0207708_10045814 3300026075 Bacteria 3333
258 Ga0207708_10327612 3300026075 Bacteria 1251
259 Ga0207702_10009661 3300026078 Bacteria 8099
260 Ga0207641_10113405 3300026088 Bacteria 2407
261 Ga0207641_10166076 3300026088 Bacteria 2010
262 Ga0207641_10420767 3300026088 Bacteria 1286
263 Ga0207648_10242687 3300026089 Bacteria 1604
264 Ga0207676_10009187 3300026095 Bacteria 7038
265 Ga0207676_10119849 3300026095 Bacteria 2217
266 Ga0207683_10236099 3300026121 Bacteria 1667
267 Ga0207428_10137021 3300027907 Bacteria 1871
268 Ga0268266_10001219 3300028379 Bacteria 31613
269 Ga0268264_10073464 3300028381 Bacteria 2903
270 Ga0268264_10198298 3300028381 Bacteria 1835
271 Ga0265337_1000525 3300028556 Bacteria 20349
272 Ga0265337_1001800 3300028556 Bacteria 10308
273 Ga0265337_1002683 3300028556 Bacteria 7994
274 Ga0265337_1003256 3300028556 Bacteria 7093
275 Ga0265337_1004826 3300028556 Bacteria 5514
276 Ga0265337_1006286 3300028556 Bacteria 4603
277 Ga0265337_1024369 3300028556 Bacteria 1852
278 Ga0265337_1024980 3300028556 Bacteria 1822
279 Ga0265326_10000050 3300028558 Bacteria 68195
280 Ga0265326_10000213 3300028558 Bacteria 28422
281 Ga0265326_10000774 3300028558 Bacteria 11867
282 Ga0265326_10018137 3300028558 Bacteria 2027
283 Ga0265319_1017232 3300028563 Bacteria 2750
284 Ga0265334_10000206 3300028573 Bacteria 34123
285 Ga0265334_10005894 3300028573 Bacteria 5329
286 Ga0265334_10033805 3300028573 Bacteria 2032
287 Ga0265334_10057623 3300028573 Bacteria 1472
288 Ga0265318_10008640 3300028577 Bacteria 4517
289 Ga0265322_10000083 3300028654 Bacteria 44679
290 Ga0265322_10000778 3300028654 Bacteria 11446
291 Ga0265322_10003243 3300028654 Bacteria 4934
292 Ga0265322_10007611 3300028654 Bacteria 3157
293 Ga0265336_10000020 3300028666 Bacteria 213480
294 Ga0265336_10001389 3300028666 Bacteria 11163
295 Ga0265336_10001669 3300028666 Bacteria 9814
296 Ga0265336_10002056 3300028666 Bacteria 8568
297 Ga0265336_10040319 3300028666 Bacteria 1429
298 Ga0265338_10000009 3300028800 Bacteria 448611
299 Ga0265338_10000093 3300028800 Bacteria 168444
300 Ga0265338_10000528 3300028800 Bacteria 67191
301 Ga0265338_10000574 3300028800 Bacteria 64844
302 Ga0265338_10000979 3300028800 Bacteria 48106
303 Ga0265338_10002671 3300028800 Bacteria 26214
304 Ga0265338_10002849 3300028800 Bacteria 25270
305 Ga0265338_10003712 3300028800 Bacteria 21241
306 Ga0265338_10008420 3300028800 Bacteria 12525
307 Ga0265338_10019970 3300028800 Bacteria 7073
308 Ga0265338_10028914 3300028800 Bacteria 5514
309 Ga0265338_10028915 3300028800 Bacteria 5514
310 Ga0265338_10065579 3300028800 Bacteria 3148
311 Ga0265338_10169970 3300028800 Bacteria 1673
312 Ga0265324_10000436 3300029957 Bacteria 29666
313 Ga0265324_10005190 3300029957 Bacteria 5679
314 Ga0265324_10011994 3300029957 Bacteria 3285
315 Ga0265324_10051249 3300029957 Bacteria 1418
316 Ga0265330_10007449 3300031235 Bacteria 5332
317 Ga0265332_10012174 3300031238 Bacteria 3817
318 Ga0265328_10022709 3300031239 Bacteria 2384
319 Ga0265328_10033447 3300031239 Bacteria 1906
320 Ga0265320_10003577 3300031240 Bacteria 10393
321 Ga0265320_10017221 3300031240 Bacteria 4019
322 Ga0265320_10020962 3300031240 Bacteria 3527
323 Ga0265325_10008281 3300031241 Bacteria 6141
324 Ga0265325_10011085 3300031241 Archaea 5187
325 Ga0265325_10012605 3300031241 Bacteria 4829
326 Ga0265325_10026800 3300031241 Bacteria 3119
327 Ga0265325_10063185 3300031241 Bacteria 1874
328 Ga0265329_10000403 3300031242 Bacteria 22578
329 Ga0265329_10002542 3300031242 Bacteria 8235
330 Ga0265340_10011006 3300031247 Bacteria 4824
331 Ga0265339_10004563 3300031249 Bacteria 9429
332 Ga0265339_10005202 3300031249 Bacteria 8705
333 Ga0265339_10009113 3300031249 Bacteria 6269
334 Ga0265339_10009193 3300031249 Bacteria 6235
335 Ga0265339_10073000 3300031249 Bacteria 1825
336 Ga0265339_10076969 3300031249 Bacteria 1768
337 Ga0265331_10023103 3300031250 Bacteria 3164
338 Ga0265327_10009958 3300031251 Bacteria 6770
339 Ga0265316_10000518 3300031344 Bacteria 43510
340 Ga0265316_10045392 3300031344 Bacteria 3489
341 Ga0265316_10060811 3300031344 Bacteria 2935
342 Ga0265316_10132973 3300031344 Bacteria 1873
343 Ga0307513_10198369 3300031456 Bacteria 1851
344 Ga0307513_10281041 3300031456 Bacteria 1442
345 Ga0307408_100022361 3300031548 Bacteria 4296
346 Ga0307408_100036540 3300031548 Bacteria 3454
347 Ga0265313_10001093 3300031595 Bacteria 26113
348 Ga0265313_10097413 3300031595 Bacteria 1310
349 Ga0265314_10000210 3300031711 Bacteria 86377
350 Ga0265314_10006767 3300031711 Bacteria 10058
351 Ga0265314_10023230 3300031711 Bacteria 4733
352 Ga0265342_10005282 3300031712 Bacteria 9898
353 Ga0316578_10010146 3300031728 Bacteria 4876
354 Ga0307405_10065260 3300031731 Bacteria 2317
355 Ga0316577_10027094 3300031733 Bacteria 3195
356 Ga0316577_10164249 3300031733 Bacteria 1253
357 Ga0307413_10114167 3300031824 Bacteria 1815
358 Ga0307410_10031849 3300031852 Bacteria 3388
359 Ga0307416_100228525 3300032002 Bacteria 1791
360 Ga0307416_100232082 3300032002 Bacteria 1780
361 Ga0307414_10010562 3300032004 Bacteria 5367
362 Ga0307411_10115320 3300032005 Bacteria 1932
363 Ga0373943_0119757 3300035170 Bacteria 1398
364 Ga0316574_0025872 3300035398 Bacteria 3526
365 Ga0316582_0009206 3300036647 Bacteria 5348
366 Ga0316584_0020888 3300036712 Bacteria 4754
367 Ga0316584_0036566 3300036712 Bacteria 3645
368 Ga0373925_0043614 3300037068 Bacteria 3330
369 Ga0373925_0324221 3300037068 Bacteria 1247
370 Ga0436364_1227686 3300037853 Bacteria 6080
371 Ga0436364_1427966 3300037853 Bacteria 1313
372 Ga0436365_0085279 3300039437 Bacteria 2171
373 Ga0436365_0279620 3300039437 Bacteria 6001
374 Ga0436365_1284809 3300039437 Bacteria 5198
375 Ga0436365_1486090 3300039437 Bacteria 4026
376 Ga0436365_1760044 3300039437 Bacteria 5312
377 Ga0436363_0594532 3300039450 Bacteria 10991
378 Ga0436363_0915897 3300039450 Bacteria 9583
379 Ga0439434_0003574 3300042435 Bacteria 4541
380 Ga0451577_0006654 3300042876 Bacteria 11474
381 Ga0451577_0039462 3300042876 Bacteria 4243
382 Ga0451577_0139632 3300042876 Bacteria 2177
383 Ga0451577_0318614 3300042876 Bacteria 1410
384 Ga0453683_0000218 3300044673 Bacteria 76321
385 Ga0466963_0160132 3300044694 Bacteria 1566
386 Ga0453684_0000010 3300044712 Bacteria 1133422
387 Ga0453684_0000255 3300044712 Bacteria 229708
388 Ga0453684_0004079 3300044712 Bacteria 31722
389 Ga0453684_0004653 3300044712 Bacteria 28510
390 Ga0453684_0004840 3300044712 Bacteria 27638
391 Ga0453684_0012916 3300044712 Bacteria 13680
392 Ga0453684_0042964 3300044712 Bacteria 6083
393 Ga0453684_0050400 3300044712 Bacteria 5477
394 Ga0453684_0274505 3300044712 Bacteria 1925
395 Ga0453684_0350560 3300044712 Bacteria 1665
396 Ga0453684_0363629 3300044712 Bacteria 1628
397 Ga0453684_0467829 3300044712 Bacteria 1401
398 Ga0453684_0472477 3300044712 Bacteria 1392
399 Ga0451576_0030898 3300045051 Bacteria 5715
400 Ga0451576_0072064 3300045051 Unclassified 3596
401 Ga0451576_0151719 3300045051 Bacteria 2417
402 Ga0451576_0182365 3300045051 Bacteria 2192
403 Ga0451576_0329146 3300045051 Bacteria 1599
404 Ga0451576_0440236 3300045051 Bacteria 1368
405 Ga0466967_0039835 3300045976 Bacteria 4042
406 Ga0466967_0046670 3300045976 Bacteria 3773
407 Ga0466967_0070789 3300045976 Bacteria 3120
408 Ga0466967_0503199 3300045976 Bacteria 1189
409 Ga0495592_0000052 3300046454 Bacteria 109203
410 Ga0495580_0019109 3300046472 Bacteria 5094
411 Ga0495662_0061788 3300046476 Bacteria 1810
412 Ga0495664_0079672 3300046477 Bacteria 1963
413 Ga0495618_0004336 3300046514 Bacteria 8728
414 Ga0495628_0000601 3300046516 Bacteria 33068
415 Ga0495630_0000024 3300046517 Bacteria 155139
416 Ga0495666_0065389 3300046526 Bacteria 1735
417 Ga0495652_0132055 3300046529 Bacteria 1975
418 Ga0495665_0114704 3300046531 Bacteria 1412
419 Ga0495640_0038996 3300046533 Bacteria 3337
420 Ga0495586_0000006 3300046535 Bacteria 168866
421 Ga0495586_0003544 3300046535 Bacteria 8365
422 Ga0495586_0018895 3300046535 Unclassified 3668
423 Ga0495645_0029162 3300046543 Bacteria 4012
424 Ga0495633_0050414 3300046558 Bacteria 1963
425 Ga0495646_0132721 3300046680 Bacteria 1401
426 Ga0495658_0010511 3300046683 Bacteria 4631
427 Ga0495658_0100924 3300046683 Bacteria 1722
428 Ga0495581_0077048 3300047315 Bacteria 1929
429 Ga0495636_0018516 3300047318 Bacteria 2795
430 Ga0495674_0000441 3300047319 Bacteria 37316
431 Ga0496104_0068153 3300048907 Bacteria 3381
432 Ga0496105_0088707 3300048908 Bacteria 2555
433 Ga0496107_0009183 3300048910 Bacteria 6855
434 Ga0496108_0108733 3300048911 Bacteria 2368
435 Ga0496109_0050166 3300048912 Bacteria 3801
436 Ga0496110_0054363 3300048913 Bacteria 3522
437 Ga0496112_0053459 3300048915 Bacteria 3967
438 Ga0496112_0133932 3300048915 Bacteria 2449
439 Ga0496112_0216697 3300048915 Bacteria 1871
440 Ga0496114_0007100 3300048917 Bacteria 8835
441 Ga0496114_0009460 3300048917 Bacteria 7736
442 Ga0496124_0022670 3300048927 Bacteria 5750
443 Ga0501038_0017740 3300049574 Bacteria 6433
444 Ga0501040_0137868 3300049576 Bacteria 1718
445 Ga0501042_0228869 3300049578 Bacteria 1341
446 Ga0501047_0000682 3300049581 Bacteria 35393
447 Ga0501067_0010705 3300049583 Bacteria 5073
448 Ga0501068_0000004 3300049584 Bacteria 81627
449 Ga0501069_0024733 3300049585 Bacteria 3277
450 Ga0501069_0188696 3300049585 Bacteria 1192
451 Ga0501070_0019188 3300049586 Bacteria 5734
452 Ga0501070_0054167 3300049586 Bacteria 3326
453 Ga0501072_0000002 3300049588 Bacteria 319523
454 Ga0501073_0000440 3300049589 Bacteria 28688
455 Ga0501074_0004803 3300049590 Bacteria 9689
456 Ga0501074_0029024 3300049590 Bacteria 4007
457 Ga0501076_0085622 3300049592 Bacteria 2533
458 Ga0501077_0001070 3300049593 Bacteria 16498
459 Ga0501080_0045621 3300049742 Bacteria 4080
460 Ga0501080_0181797 3300049742 Bacteria 1934
461 Ga0501081_0074241 3300049743 Bacteria 2373
462 Ga0501081_0115749 3300049743 Bacteria 1906
463 Ga0501083_0044952 3300049744 Bacteria 2989
464 Ga0501083_0054699 3300049744 Bacteria 2678
465 Ga0501035_0122866 3300049822 Bacteria 2268
466 nmdc:mga0k408_199_c1 3300050493 Bacteria 31769
467 nmdc:mga0k408_297_c1 3300050493 Bacteria 26903
468 nmdc:mga06z11_4303_c1 3300050494 Bacteria 5596
469 nmdc:mga05p37_122244_c1 3300050507 Bacteria 3197
470 nmdc:mga05p37_151478_c1 3300050507 Bacteria 2836
471 nmdc:mga05p37_16577_c1 3300050507 Bacteria 8876
472 nmdc:mga05p37_201739_c1 3300050507 Bacteria 2408
473 nmdc:mga05p37_2071_c1 3300050507 Bacteria 15533
474 nmdc:mga05p37_26675_c1 3300050507 Bacteria 7026
475 nmdc:mga05p37_27395_c1 3300050507 Bacteria 6937
476 nmdc:mga05p37_296933_c1 3300050507 Bacteria 1921
477 nmdc:mga05p37_32376_c1 3300050507 Bacteria 6393
478 nmdc:mga05p37_450955_c1 3300050507 Bacteria 1489
479 nmdc:mga05p37_4917_c1 3300050507 Bacteria 15652
480 nmdc:mga09592_10754_c1 3300050508 Bacteria 7440
481 nmdc:mga09592_5260_c1 3300050508 Bacteria 10515
482 nmdc:mga0qj67_293035_c1 3300050509 Bacteria 1319
483 nmdc:mga0qj67_43182_c1 3300050509 Bacteria 3550
484 nmdc:mga0qj67_4862_c1 3300050509 Bacteria 9769
485 nmdc:mga06r32_104074_c1 3300050510 Bacteria 2788
486 nmdc:mga06r32_14050_c1 3300050510 Bacteria 7261
487 nmdc:mga06r32_301924_c1 3300050510 Bacteria 1587
488 nmdc:mga08y16_53586_c1 3300050511 Bacteria 4217
489 nmdc:mga0n895_216995_c1 3300050512 Bacteria 1942
490 nmdc:mga0n895_243032_c1 3300050512 Bacteria 1827
491 nmdc:mga0n895_28553_c1 3300050512 Bacteria 5308
492 nmdc:mga0n895_340426_c1 3300050512 Bacteria 1519
493 nmdc:mga0n895_4426_c1 3300050512 Bacteria 11543
494 nmdc:mga0rr50_62141_c1 3300050513 Bacteria 2816
495 nmdc:mga08x19_20297_c1 3300050514 Bacteria 4091
496 nmdc:mga08x19_2350_c1 3300050514 Bacteria 11481
497 nmdc:mga0a205_15920_c1 3300050515 Bacteria 7035
498 nmdc:mga0a205_2226_c1 3300050515 Bacteria 16238
499 nmdc:mga0a205_410932_c1 3300050515 Bacteria 1216
500 nmdc:mga0a205_41095_c1 3300050515 Bacteria 4453
501 nmdc:mga0a205_75431_c1 3300050515 Bacteria 3258
502 Ga0501084_0000024 3300054114 Bacteria 137282
503 Ga0590075_017341 3300059424 Bacteria 1774
504 Ga0501082_0000035 3300060353 Bacteria 96746
505 Ga0530510_0268603 3300061734 Bacteria 1273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009553 Ga0105249_10379771 Ga0105249_103797712 308
2 3300013308 Ga0157375_10321378 Ga0157375_103213782 309
3 3300009551 Ga0105238_10378186 Ga0105238_103781861 313
4 3300013105 Ga0157369_10115088 Ga0157369_101150882 313
5 3300013308 Ga0157375_10054672 Ga0157375_100546723 313
6 3300048907 Ga0496104_0068153 Ga0496104_0068153_1138_2169 313
7 3300048908 Ga0496105_0088707 Ga0496105_0088707_594_1625 313
8 3300048912 Ga0496109_0050166 Ga0496109_0050166_488_1588 313
9 3300048917 Ga0496114_0007100 Ga0496114_0007100_6736_7767 313
10 3300048917 Ga0496114_0009460 Ga0496114_0009460_33_1076 313
11 3300037068 Ga0373925_0043614 Ga0373925_0043614_1751_2830 322
12 3300031733 Ga0316577_10164249 Ga0316577_101642491 324
13 3300048927 Ga0496124_0022670 Ga0496124_0022670_838_1845 324
14 3300045051 Ga0451576_0072064 Ga0451576_0072064_324_1361 325
15 3300059424 Ga0590075_017341 Ga0590075_017341_221_1261 325
16 3300005329 Ga0070683_100017063 Ga0070683_1000170633 326
17 3300005329 Ga0070683_100110947 Ga0070683_1001109472 326
18 3300005535 Ga0070684_100034584 Ga0070684_1000345843 326
19 3300005548 Ga0070665_100000996 Ga0070665_10000099634 326
20 3300009147 Ga0114129_10196701 Ga0114129_101967012 326
21 3300014969 Ga0157376_10487393 Ga0157376_104873932 326
22 3300025912 Ga0207707_10355694 Ga0207707_103556942 326
23 3300025944 Ga0207661_10001791 Ga0207661_1000179115 326
24 3300025944 Ga0207661_10138237 Ga0207661_101382372 326
25 3300028379 Ga0268266_10001219 Ga0268266_1000121928 326
26 3300039437 Ga0436365_0085279 Ga0436365_0085279_678_1769 326
27 3300044694 Ga0466963_0160132 Ga0466963_0160132_476_1507 326
28 3300044712 Ga0453684_0350560 Ga0453684_0350560_424_1467 326
29 3300045976 Ga0466967_0039835 Ga0466967_0039835_1309_2340 326
30 3300045976 Ga0466967_0046670 Ga0466967_0046670_837_1868 326
31 3300045976 Ga0466967_0070789 Ga0466967_0070789_1222_2340 326
32 3300045976 Ga0466967_0503199 Ga0466967_0503199_26_1057 326
33 3300046683 Ga0495658_0100924 Ga0495658_0100924_639_1670 326
34 3300048913 Ga0496110_0054363 Ga0496110_0054363_1117_2223 326
35 3300049585 Ga0501069_0024733 Ga0501069_0024733_1185_2216 326
36 3300049586 Ga0501070_0019188 Ga0501070_0019188_3531_4562 326
37 3300049590 Ga0501074_0029024 Ga0501074_0029024_1309_2340 326
38 3300050494 nmdc:mga06z11_4303_c1 nmdc:mga06z11_4303_c1_3935_4999 327
39 3300021384 Ga0213876_10079982 Ga0213876_100799822 328
40 3300039437 Ga0436365_1284809 Ga0436365_1284809_3844_4872 328
41 3300005445 Ga0070708_100015563 Ga0070708_1000155635 329
42 3300005471 Ga0070698_100028632 Ga0070698_1000286323 329
43 3300005518 Ga0070699_100002679 Ga0070699_1000026797 329
44 3300006844 Ga0075428_100115379 Ga0075428_1001153793 329
45 3300005985 Ga0081539_10000492 Ga0081539_1000049228 330
46 3300039437 Ga0436365_1486090 Ga0436365_1486090_2447_3502 330
47 3300044712 Ga0453684_0000010 Ga0453684_0000010_416830_417906 330
48 3300005843 Ga0068860_100432613 Ga0068860_1004326132 331
49 3300009545 Ga0105237_10005589 Ga0105237_1000558911 331
50 3300025914 Ga0207671_10021103 Ga0207671_100211034 331
51 3300035170 Ga0373943_0119757 Ga0373943_0119757_40_1047 331
52 3300046558 Ga0495633_0050414 Ga0495633_0050414_631_1695 331
53 3300049578 Ga0501042_0228869 Ga0501042_0228869_68_1075 331
54 3300049743 Ga0501081_0074241 Ga0501081_0074241_616_1629 331
55 3300049744 Ga0501083_0054699 Ga0501083_0054699_479_1477 331
56 3300061734 Ga0530510_0268603 Ga0530510_0268603_37_1044 331
57 3300005563 Ga0068855_100074130 Ga0068855_1000741303 332
58 3300005614 Ga0068856_100000160 Ga0068856_10000016026 332
59 3300006880 Ga0075429_100236294 Ga0075429_1002362941 332
60 3300013307 Ga0157372_10122265 Ga0157372_101222652 332
61 3300025949 Ga0207667_10050631 Ga0207667_100506312 332
62 3300026075 Ga0207708_10327612 Ga0207708_103276121 332
63 3300026078 Ga0207702_10009661 Ga0207702_100096613 332
64 3300028556 Ga0265337_1003256 Ga0265337_10032569 332
65 3300049576 Ga0501040_0137868 Ga0501040_0137868_690_1700 332
66 3300005295 Ga0065707_10099918 Ga0065707_100999182 333
67 3300005330 Ga0070690_100047234 Ga0070690_1000472342 333
68 3300005340 Ga0070689_100067906 Ga0070689_1000679062 333
69 3300005340 Ga0070689_100092978 Ga0070689_1000929781 333
70 3300005340 Ga0070689_100094348 Ga0070689_1000943482 333
71 3300005340 Ga0070689_100097858 Ga0070689_1000978582 333
72 3300005365 Ga0070688_100062435 Ga0070688_1000624352 333
73 3300005365 Ga0070688_100105428 Ga0070688_1001054282 333
74 3300005466 Ga0070685_10079067 Ga0070685_100790672 333
75 3300005544 Ga0070686_100008320 Ga0070686_1000083203 333
76 3300005544 Ga0070686_100054890 Ga0070686_1000548901 333
77 3300005549 Ga0070704_100116684 Ga0070704_1001166841 333
78 3300005615 Ga0070702_100040565 Ga0070702_1000405653 333
79 3300005616 Ga0068852_100219087 Ga0068852_1002190872 333
80 3300005841 Ga0068863_100204507 Ga0068863_1002045072 333
81 3300005841 Ga0068863_100297749 Ga0068863_1002977491 333
82 3300005842 Ga0068858_100029386 Ga0068858_1000293863 333
83 3300005842 Ga0068858_100447221 Ga0068858_1004472211 333
84 3300006237 Ga0097621_100016162 Ga0097621_1000161625 333
85 3300006237 Ga0097621_100269004 Ga0097621_1002690042 333
86 3300006358 Ga0068871_100072069 Ga0068871_1000720692 333
87 3300006844 Ga0075428_100002910 Ga0075428_1000029107 333
88 3300006844 Ga0075428_100026856 Ga0075428_1000268565 333
89 3300006844 Ga0075428_100069430 Ga0075428_1000694303 333
90 3300006844 Ga0075428_100684796 Ga0075428_1006847961 333
91 3300006846 Ga0075430_100003362 Ga0075430_1000033625 333
92 3300006846 Ga0075430_100066163 Ga0075430_1000661632 333
93 3300006847 Ga0075431_100013003 Ga0075431_1000130036 333
94 3300006847 Ga0075431_100072920 Ga0075431_1000729202 333
95 3300006847 Ga0075431_100207492 Ga0075431_1002074922 333
96 3300006880 Ga0075429_100000249 Ga0075429_1000002492 333
97 3300007076 Ga0075435_100028881 Ga0075435_1000288813 333
98 3300009093 Ga0105240_10048964 Ga0105240_100489642 333
99 3300009094 Ga0111539_10101081 Ga0111539_101010812 333
100 3300009094 Ga0111539_10180905 Ga0111539_101809052 333
101 3300009098 Ga0105245_10016138 Ga0105245_100161386 333
102 3300009147 Ga0114129_10006478 Ga0114129_100064789 333
103 3300009147 Ga0114129_10131976 Ga0114129_101319762 333
104 3300009147 Ga0114129_10176184 Ga0114129_101761842 333
105 3300013308 Ga0157375_10000074 Ga0157375_1000007437 333
106 3300014325 Ga0163163_10000065 Ga0163163_10000065100 333
107 3300014326 Ga0157380_10407819 Ga0157380_104078192 333
108 3300025913 Ga0207695_10037615 Ga0207695_100376151 333
109 3300025927 Ga0207687_10106360 Ga0207687_101063602 333
110 3300025936 Ga0207670_10003590 Ga0207670_100035906 333
111 3300025936 Ga0207670_10111311 Ga0207670_101113111 333
112 3300025944 Ga0207661_10298877 Ga0207661_102988772 333
113 3300026023 Ga0207677_10244141 Ga0207677_102441412 333
114 3300026035 Ga0207703_10002060 Ga0207703_100020604 333
115 3300026075 Ga0207708_10045814 Ga0207708_100458144 333
116 3300026088 Ga0207641_10420767 Ga0207641_104207671 333
117 3300026089 Ga0207648_10242687 Ga0207648_102426872 333
118 3300028556 Ga0265337_1001800 Ga0265337_10018003 333
119 3300028556 Ga0265337_1006286 Ga0265337_10062862 333
120 3300028556 Ga0265337_1024980 Ga0265337_10249802 333
121 3300028558 Ga0265326_10018137 Ga0265326_100181373 333
122 3300028563 Ga0265319_1017232 Ga0265319_10172322 333
123 3300028654 Ga0265322_10000083 Ga0265322_1000008339 333
124 3300028800 Ga0265338_10000009 Ga0265338_10000009292 333
125 3300028800 Ga0265338_10000574 Ga0265338_1000057437 333
126 3300028800 Ga0265338_10002671 Ga0265338_1000267113 333
127 3300028800 Ga0265338_10002849 Ga0265338_1000284923 333
128 3300028800 Ga0265338_10003712 Ga0265338_1000371213 333
129 3300028800 Ga0265338_10065579 Ga0265338_100655792 333
130 3300028800 Ga0265338_10169970 Ga0265338_101699701 333
131 3300029957 Ga0265324_10000436 Ga0265324_100004364 333
132 3300029957 Ga0265324_10011994 Ga0265324_100119943 333
133 3300029957 Ga0265324_10051249 Ga0265324_100512491 333
134 3300031238 Ga0265332_10012174 Ga0265332_100121745 333
135 3300031239 Ga0265328_10022709 Ga0265328_100227091 333
136 3300031240 Ga0265320_10003577 Ga0265320_100035773 333
137 3300031241 Ga0265325_10008281 Ga0265325_100082816 333
138 3300031241 Ga0265325_10012605 Ga0265325_100126054 333
139 3300031241 Ga0265325_10026800 Ga0265325_100268002 333
140 3300031242 Ga0265329_10002542 Ga0265329_100025423 333
141 3300031249 Ga0265339_10009113 Ga0265339_100091134 333
142 3300031249 Ga0265339_10009193 Ga0265339_100091937 333
143 3300031249 Ga0265339_10073000 Ga0265339_100730001 333
144 3300031249 Ga0265339_10076969 Ga0265339_100769691 333
145 3300031251 Ga0265327_10009958 Ga0265327_100099582 333
146 3300031344 Ga0265316_10045392 Ga0265316_100453923 333
147 3300031344 Ga0265316_10132973 Ga0265316_101329732 333
148 3300031548 Ga0307408_100022361 Ga0307408_1000223613 333
149 3300031595 Ga0265313_10001093 Ga0265313_1000109312 333
150 3300031711 Ga0265314_10000210 Ga0265314_1000021041 333
151 3300031711 Ga0265314_10006767 Ga0265314_100067673 333
152 3300031728 Ga0316578_10010146 Ga0316578_100101463 333
153 3300031733 Ga0316577_10027094 Ga0316577_100270942 333
154 3300032002 Ga0307416_100228525 Ga0307416_1002285252 333
155 3300036647 Ga0316582_0009206 Ga0316582_0009206_4026_5096 333
156 3300036712 Ga0316584_0020888 Ga0316584_0020888_2982_4049 333
157 3300036712 Ga0316584_0036566 Ga0316584_0036566_573_1640 333
158 3300042876 Ga0451577_0006654 Ga0451577_0006654_597_1610 333
159 3300042876 Ga0451577_0039462 Ga0451577_0039462_862_1875 333
160 3300042876 Ga0451577_0139632 Ga0451577_0139632_912_1931 333
161 3300042876 Ga0451577_0318614 Ga0451577_0318614_84_1166 333
162 3300044712 Ga0453684_0000255 Ga0453684_0000255_188845_189855 333
163 3300044712 Ga0453684_0004079 Ga0453684_0004079_7810_8880 333
164 3300044712 Ga0453684_0004653 Ga0453684_0004653_22039_23133 333
165 3300044712 Ga0453684_0012916 Ga0453684_0012916_7738_8844 333
166 3300044712 Ga0453684_0042964 Ga0453684_0042964_2878_3930 333
167 3300044712 Ga0453684_0050400 Ga0453684_0050400_966_1979 333
168 3300044712 Ga0453684_0274505 Ga0453684_0274505_52_1122 333
169 3300044712 Ga0453684_0363629 Ga0453684_0363629_134_1222 333
170 3300044712 Ga0453684_0467829 Ga0453684_0467829_23_1033 333
171 3300045051 Ga0451576_0030898 Ga0451576_0030898_3303_4316 333
172 3300045051 Ga0451576_0151719 Ga0451576_0151719_697_1710 333
173 3300045051 Ga0451576_0329146 Ga0451576_0329146_26_1036 333
174 3300045051 Ga0451576_0440236 Ga0451576_0440236_106_1110 333
175 3300046454 Ga0495592_0000052 Ga0495592_0000052_33143_34156 333
176 3300046476 Ga0495662_0061788 Ga0495662_0061788_134_1147 333
177 3300046477 Ga0495664_0079672 Ga0495664_0079672_38_1051 333
178 3300046514 Ga0495618_0004336 Ga0495618_0004336_3077_4090 333
179 3300046516 Ga0495628_0000601 Ga0495628_0000601_21923_22936 333
180 3300046517 Ga0495630_0000024 Ga0495630_0000024_57245_58258 333
181 3300046526 Ga0495666_0065389 Ga0495666_0065389_58_1071 333
182 3300046529 Ga0495652_0132055 Ga0495652_0132055_933_1946 333
183 3300046531 Ga0495665_0114704 Ga0495665_0114704_200_1213 333
184 3300046533 Ga0495640_0038996 Ga0495640_0038996_1124_2137 333
185 3300046535 Ga0495586_0000006 Ga0495586_0000006_96825_97838 333
186 3300046535 Ga0495586_0003544 Ga0495586_0003544_1757_2770 333
187 3300046535 Ga0495586_0018895 Ga0495586_0018895_1834_2865 333
188 3300046543 Ga0495645_0029162 Ga0495645_0029162_519_1532 333
189 3300046680 Ga0495646_0132721 Ga0495646_0132721_280_1293 333
190 3300046683 Ga0495658_0010511 Ga0495658_0010511_2370_3383 333
191 3300047315 Ga0495581_0077048 Ga0495581_0077048_198_1211 333
192 3300047319 Ga0495674_0000441 Ga0495674_0000441_36048_37061 333
193 3300049742 Ga0501080_0045621 Ga0501080_0045621_250_1263 333
194 3300049822 Ga0501035_0122866 Ga0501035_0122866_299_1312 333
195 3300050507 nmdc:mga05p37_122244_c1 nmdc:mga05p37_122244_c1_735_1781 333
196 3300050507 nmdc:mga05p37_151478_c1 nmdc:mga05p37_151478_c1_1515_2522 333
197 3300050507 nmdc:mga05p37_26675_c1 nmdc:mga05p37_26675_c1_3816_4820 333
198 3300050508 nmdc:mga09592_10754_c1 nmdc:mga09592_10754_c1_4484_5530 333
199 3300050508 nmdc:mga09592_5260_c1 nmdc:mga09592_5260_c1_3191_4198 333
200 3300050509 nmdc:mga0qj67_43182_c1 nmdc:mga0qj67_43182_c1_314_1318 333
201 3300050509 nmdc:mga0qj67_4862_c1 nmdc:mga0qj67_4862_c1_8377_9384 333
202 3300050510 nmdc:mga06r32_104074_c1 nmdc:mga06r32_104074_c1_1241_2248 333
203 3300050510 nmdc:mga06r32_14050_c1 nmdc:mga06r32_14050_c1_552_1598 333
204 3300050510 nmdc:mga06r32_301924_c1 nmdc:mga06r32_301924_c1_224_1228 333
205 3300050513 nmdc:mga0rr50_62141_c1 nmdc:mga0rr50_62141_c1_801_1814 333
206 3300050515 nmdc:mga0a205_75431_c1 nmdc:mga0a205_75431_c1_2056_3069 333
207 3300005367 Ga0070667_100121922 Ga0070667_1001219222 334
208 3300005445 Ga0070708_100014498 Ga0070708_1000144985 334
209 3300005458 Ga0070681_10204887 Ga0070681_102048872 334
210 3300005467 Ga0070706_100002727 Ga0070706_1000027279 334
211 3300005468 Ga0070707_100015744 Ga0070707_1000157445 334
212 3300005471 Ga0070698_100007126 Ga0070698_1000071266 334
213 3300005518 Ga0070699_100260438 Ga0070699_1002604382 334
214 3300005539 Ga0068853_100042949 Ga0068853_1000429492 334
215 3300005544 Ga0070686_100045408 Ga0070686_1000454082 334
216 3300005546 Ga0070696_100064970 Ga0070696_1000649702 334
217 3300005843 Ga0068860_100055395 Ga0068860_1000553952 334
218 3300006175 Ga0070712_100285770 Ga0070712_1002857701 334
219 3300006195 Ga0075366_10016465 Ga0075366_100164653 334
220 3300009147 Ga0114129_10018774 Ga0114129_100187742 334
221 3300025885 Ga0207653_10000246 Ga0207653_1000024619 334
222 3300025910 Ga0207684_10000904 Ga0207684_100009048 334
223 3300025922 Ga0207646_10012709 Ga0207646_100127096 334
224 3300025986 Ga0207658_10149225 Ga0207658_101492252 334
225 3300028381 Ga0268264_10073464 Ga0268264_100734642 334
226 3300044712 Ga0453684_0472477 Ga0453684_0472477_284_1357 334
227 3300045051 Ga0451576_0182365 Ga0451576_0182365_203_1219 334
228 3300048910 Ga0496107_0009183 Ga0496107_0009183_1587_2609 334
229 3300048911 Ga0496108_0108733 Ga0496108_0108733_1237_2247 334
230 3300050493 nmdc:mga0k408_199_c1 nmdc:mga0k408_199_c1_7317_8321 334
231 3300050493 nmdc:mga0k408_297_c1 nmdc:mga0k408_297_c1_24548_25552 334
232 3300050507 nmdc:mga05p37_32376_c1 nmdc:mga05p37_32376_c1_692_1711 334
233 3300050509 nmdc:mga0qj67_293035_c1 nmdc:mga0qj67_293035_c1_268_1302 334
234 3300005334 Ga0068869_100034057 Ga0068869_1000340572 335
235 3300005445 Ga0070708_100146062 Ga0070708_1001460622 335
236 3300005467 Ga0070706_100399356 Ga0070706_1003993561 335
237 3300005471 Ga0070698_100278631 Ga0070698_1002786311 335
238 3300005518 Ga0070699_100132859 Ga0070699_1001328591 335
239 3300005844 Ga0068862_100156575 Ga0068862_1001565752 335
240 3300006028 Ga0070717_10405594 Ga0070717_104055941 335
241 3300014968 Ga0157379_10061295 Ga0157379_100612952 335
242 3300025922 Ga0207646_10309379 Ga0207646_103093791 335
243 3300025942 Ga0207689_10090448 Ga0207689_100904482 335
244 3300028381 Ga0268264_10198298 Ga0268264_101982982 335
245 3300028556 Ga0265337_1002683 Ga0265337_10026833 335
246 3300028556 Ga0265337_1004826 Ga0265337_10048266 335
247 3300028556 Ga0265337_1024369 Ga0265337_10243692 335
248 3300028558 Ga0265326_10000213 Ga0265326_100002134 335
249 3300028558 Ga0265326_10000774 Ga0265326_1000077411 335
250 3300028573 Ga0265334_10000206 Ga0265334_1000020627 335
251 3300028573 Ga0265334_10033805 Ga0265334_100338052 335
252 3300028577 Ga0265318_10008640 Ga0265318_100086403 335
253 3300028654 Ga0265322_10000778 Ga0265322_100007783 335
254 3300028654 Ga0265322_10007611 Ga0265322_100076113 335
255 3300028666 Ga0265336_10001389 Ga0265336_100013892 335
256 3300028666 Ga0265336_10002056 Ga0265336_100020562 335
257 3300028666 Ga0265336_10040319 Ga0265336_100403192 335
258 3300028800 Ga0265338_10000979 Ga0265338_1000097919 335
259 3300028800 Ga0265338_10008420 Ga0265338_100084209 335
260 3300028800 Ga0265338_10019970 Ga0265338_100199702 335
261 3300028800 Ga0265338_10028914 Ga0265338_100289142 335
262 3300028800 Ga0265338_10028915 Ga0265338_100289156 335
263 3300031235 Ga0265330_10007449 Ga0265330_100074495 335
264 3300031239 Ga0265328_10033447 Ga0265328_100334472 335
265 3300031240 Ga0265320_10017221 Ga0265320_100172212 335
266 3300031241 Ga0265325_10011085 Ga0265325_100110855 335
267 3300031241 Ga0265325_10063185 Ga0265325_100631852 335
268 3300031242 Ga0265329_10000403 Ga0265329_100004031 335
269 3300031247 Ga0265340_10011006 Ga0265340_100110061 335
270 3300031249 Ga0265339_10004563 Ga0265339_100045633 335
271 3300031250 Ga0265331_10023103 Ga0265331_100231033 335
272 3300031344 Ga0265316_10000518 Ga0265316_1000051837 335
273 3300031344 Ga0265316_10060811 Ga0265316_100608111 335
274 3300031595 Ga0265313_10097413 Ga0265313_100974132 335
275 3300031711 Ga0265314_10023230 Ga0265314_100232303 335
276 3300031712 Ga0265342_10005282 Ga0265342_100052828 335
277 3300035398 Ga0316574_0025872 Ga0316574_0025872_1424_2431 335
278 3300044673 Ga0453683_0000218 Ga0453683_0000218_6195_7256 335
279 3300044712 Ga0453684_0004840 Ga0453684_0004840_19396_20418 335
280 3300048915 Ga0496112_0053459 Ga0496112_0053459_404_1435 335
281 3300049574 Ga0501038_0017740 Ga0501038_0017740_3172_4197 335
282 3300049581 Ga0501047_0000682 Ga0501047_0000682_4346_5371 335
283 3300049583 Ga0501067_0010705 Ga0501067_0010705_637_1662 335
284 3300049584 Ga0501068_0000004 Ga0501068_0000004_71316_72341 335
285 3300049585 Ga0501069_0188696 Ga0501069_0188696_71_1096 335
286 3300049586 Ga0501070_0054167 Ga0501070_0054167_1091_2116 335
287 3300049588 Ga0501072_0000002 Ga0501072_0000002_135244_136269 335
288 3300049589 Ga0501073_0000440 Ga0501073_0000440_24464_25489 335
289 3300049590 Ga0501074_0004803 Ga0501074_0004803_3362_4387 335
290 3300049592 Ga0501076_0085622 Ga0501076_0085622_105_1130 335
291 3300049593 Ga0501077_0001070 Ga0501077_0001070_12502_13527 335
292 3300049742 Ga0501080_0181797 Ga0501080_0181797_773_1798 335
293 3300049744 Ga0501083_0044952 Ga0501083_0044952_1174_2199 335
294 3300054114 Ga0501084_0000024 Ga0501084_0000024_122477_123502 335
295 3300060353 Ga0501082_0000035 Ga0501082_0000035_70778_71803 335
296 3300005290 Ga0065712_10073890 Ga0065712_100738902 336
297 3300005337 Ga0070682_100000123 Ga0070682_10000012346 336
298 3300005467 Ga0070706_100059192 Ga0070706_1000591923 336
299 3300005468 Ga0070707_100030686 Ga0070707_1000306863 336
300 3300005536 Ga0070697_100002369 Ga0070697_1000023692 336
301 3300005536 Ga0070697_100042664 Ga0070697_1000426644 336
302 3300005536 Ga0070697_100067241 Ga0070697_1000672412 336
303 3300005548 Ga0070665_100155972 Ga0070665_1001559723 336
304 3300005983 Ga0081540_1001119 Ga0081540_100111921 336
305 3300005985 Ga0081539_10003410 Ga0081539_100034105 336
306 3300021388 Ga0213875_10007266 Ga0213875_100072664 336
307 3300025298 Ga0209050_1000151 Ga0209050_1000151110 336
308 3300025910 Ga0207684_10062882 Ga0207684_100628823 336
309 3300025922 Ga0207646_10013226 Ga0207646_100132262 336
310 3300025960 Ga0207651_10027683 Ga0207651_100276831 336
311 3300028556 Ga0265337_1000525 Ga0265337_10005257 336
312 3300028558 Ga0265326_10000050 Ga0265326_1000005037 336
313 3300028573 Ga0265334_10005894 Ga0265334_100058945 336
314 3300028573 Ga0265334_10057623 Ga0265334_100576232 336
315 3300028654 Ga0265322_10003243 Ga0265322_100032432 336
316 3300028666 Ga0265336_10000020 Ga0265336_10000020172 336
317 3300028666 Ga0265336_10001669 Ga0265336_100016695 336
318 3300028800 Ga0265338_10000093 Ga0265338_1000009383 336
319 3300028800 Ga0265338_10000528 Ga0265338_100005289 336
320 3300029957 Ga0265324_10005190 Ga0265324_100051903 336
321 3300031240 Ga0265320_10020962 Ga0265320_100209622 336
322 3300031731 Ga0307405_10065260 Ga0307405_100652602 336
323 3300031852 Ga0307410_10031849 Ga0307410_100318492 336
324 3300032004 Ga0307414_10010562 Ga0307414_100105622 336
325 3300032005 Ga0307411_10115320 Ga0307411_101153202 336
326 3300037853 Ga0436364_1227686 Ga0436364_1227686_1048_2067 336
327 3300037853 Ga0436364_1427966 Ga0436364_1427966_10_1029 336
328 3300039437 Ga0436365_1760044 Ga0436365_1760044_878_1897 336
329 3300005293 Ga0065715_10188707 Ga0065715_101887071 337
330 3300005467 Ga0070706_100000784 Ga0070706_1000007846 337
331 3300005536 Ga0070697_100003496 Ga0070697_1000034968 337
332 3300005546 Ga0070696_100132162 Ga0070696_1001321622 337
333 3300006846 Ga0075430_100034660 Ga0075430_1000346603 337
334 3300006852 Ga0075433_10030338 Ga0075433_100303385 337
335 3300006871 Ga0075434_100001928 Ga0075434_10000192814 337
336 3300009094 Ga0111539_10033023 Ga0111539_100330234 337
337 3300025910 Ga0207684_10000382 Ga0207684_1000038211 337
338 3300027907 Ga0207428_10137021 Ga0207428_101370211 337
339 3300031548 Ga0307408_100036540 Ga0307408_1000365403 337
340 3300031824 Ga0307413_10114167 Ga0307413_101141672 337
341 3300032002 Ga0307416_100232082 Ga0307416_1002320822 337
342 3300048915 Ga0496112_0216697 Ga0496112_0216697_521_1567 337
343 3300050511 nmdc:mga08y16_53586_c1 nmdc:mga08y16_53586_c1_2718_3758 337
344 3300050512 nmdc:mga0n895_28553_c1 nmdc:mga0n895_28553_c1_3567_4607 337
345 3300050515 nmdc:mga0a205_2226_c1 nmdc:mga0a205_2226_c1_11706_12746 337
346 3300005289 Ga0065704_10096841 Ga0065704_100968413 338
347 3300005295 Ga0065707_10088234 Ga0065707_100882344 338
348 3300005445 Ga0070708_100015055 Ga0070708_1000150554 338
349 3300005546 Ga0070696_100049425 Ga0070696_1000494253 338
350 3300005547 Ga0070693_100002195 Ga0070693_1000021958 338
351 3300005564 Ga0070664_100085741 Ga0070664_1000857413 338
352 3300006844 Ga0075428_100033167 Ga0075428_1000331674 338
353 3300006847 Ga0075431_100168185 Ga0075431_1001681852 338
354 3300006852 Ga0075433_10251471 Ga0075433_102514712 338
355 3300009147 Ga0114129_10031645 Ga0114129_100316451 338
356 3300009147 Ga0114129_10039007 Ga0114129_100390075 338
357 3300009174 Ga0105241_10024978 Ga0105241_100249782 338
358 3300025911 Ga0207654_10012386 Ga0207654_100123865 338
359 3300025945 Ga0207679_10074397 Ga0207679_100743972 338
360 3300031249 Ga0265339_10005202 Ga0265339_100052023 338
361 3300031456 Ga0307513_10281041 Ga0307513_102810412 338
362 3300050507 nmdc:mga05p37_27395_c1 nmdc:mga05p37_27395_c1_3845_4864 338
363 3300050507 nmdc:mga05p37_296933_c1 nmdc:mga05p37_296933_c1_568_1650 338
364 3300005471 Ga0070698_100093499 Ga0070698_1000934993 339
365 3300005536 Ga0070697_100220413 Ga0070697_1002204131 339
366 3300005937 Ga0081455_10002146 Ga0081455_100021465 339
367 3300006028 Ga0070717_10054713 Ga0070717_100547133 339
368 3300006173 Ga0070716_100064172 Ga0070716_1000641723 339
369 3300009147 Ga0114129_10007007 Ga0114129_1000700712 339
370 3300025939 Ga0207665_10130139 Ga0207665_101301392 339
371 3300050507 nmdc:mga05p37_2071_c1 nmdc:mga05p37_2071_c1_560_1585 339
372 3300050515 nmdc:mga0a205_410932_c1 nmdc:mga0a205_410932_c1_31_1056 340
373 3300017792 Ga0163161_10128052 Ga0163161_101280522 341
374 3300005467 Ga0070706_100001479 Ga0070706_1000014794 342
375 3300005549 Ga0070704_100031837 Ga0070704_1000318373 342
376 3300007076 Ga0075435_100165949 Ga0075435_1001659492 342
377 3300009147 Ga0114129_10022653 Ga0114129_100226538 342
378 3300009147 Ga0114129_10363683 Ga0114129_103636832 342
379 3300009553 Ga0105249_10148162 Ga0105249_101481621 342
380 3300013297 Ga0157378_10049442 Ga0157378_100494422 342
381 3300025910 Ga0207684_10003603 Ga0207684_1000360312 342
382 3300025922 Ga0207646_10465570 Ga0207646_104655701 342
383 3300025961 Ga0207712_10404953 Ga0207712_104049531 342
384 3300050507 nmdc:mga05p37_450955_c1 nmdc:mga05p37_450955_c1_128_1168 342
385 3300050507 nmdc:mga05p37_4917_c1 nmdc:mga05p37_4917_c1_1082_2122 342
386 3300005295 Ga0065707_10083441 Ga0065707_100834418 343
387 3300005340 Ga0070689_100037996 Ga0070689_1000379963 343
388 3300005353 Ga0070669_100000544 Ga0070669_10000054419 343
389 3300005440 Ga0070705_100058587 Ga0070705_1000585872 343
390 3300005440 Ga0070705_100064908 Ga0070705_1000649082 343
391 3300005518 Ga0070699_100417437 Ga0070699_1004174371 343
392 3300005536 Ga0070697_100000406 Ga0070697_10000040626 343
393 3300005549 Ga0070704_100018229 Ga0070704_1000182293 343
394 3300006852 Ga0075433_10005536 Ga0075433_100055363 343
395 3300006871 Ga0075434_100002547 Ga0075434_1000025478 343
396 3300006914 Ga0075436_100007039 Ga0075436_1000070395 343
397 3300009148 Ga0105243_10044780 Ga0105243_100447802 343
398 3300009176 Ga0105242_10028751 Ga0105242_100287512 343
399 3300025923 Ga0207681_10003365 Ga0207681_100033657 343
400 3300025925 Ga0207650_10039069 Ga0207650_100390691 343
401 3300042435 Ga0439434_0003574 Ga0439434_0003574_321_1352 343
402 3300047318 Ga0495636_0018516 Ga0495636_0018516_1319_2350 343
403 3300050507 nmdc:mga05p37_201739_c1 nmdc:mga05p37_201739_c1_729_1772 343
404 3300050512 nmdc:mga0n895_4426_c1 nmdc:mga0n895_4426_c1_6923_7957 343
405 3300050514 nmdc:mga08x19_2350_c1 nmdc:mga08x19_2350_c1_308_1342 343
406 3300050515 nmdc:mga0a205_15920_c1 nmdc:mga0a205_15920_c1_3014_4048 343
407 3300013308 Ga0157375_10110155 Ga0157375_101101551 344
408 3300031456 Ga0307513_10198369 Ga0307513_101983692 344
409 3300039437 Ga0436365_0279620 Ga0436365_0279620_3073_4110 344
410 3300039450 Ga0436363_0594532 Ga0436363_0594532_6528_7565 344
411 3300049743 Ga0501081_0115749 Ga0501081_0115749_352_1398 344
412 3300005445 Ga0070708_100007541 Ga0070708_1000075413 345
413 3300005458 Ga0070681_10002938 Ga0070681_100029384 345
414 3300005467 Ga0070706_100074824 Ga0070706_1000748243 345
415 3300005468 Ga0070707_100016067 Ga0070707_1000160676 345
416 3300005471 Ga0070698_100003590 Ga0070698_1000035903 345
417 3300005518 Ga0070699_100000667 Ga0070699_1000006678 345
418 3300005536 Ga0070697_100008918 Ga0070697_1000089185 345
419 3300025912 Ga0207707_10002880 Ga0207707_1000288012 345
420 3300025921 Ga0207652_10037009 Ga0207652_100370092 345
421 3300025922 Ga0207646_10121452 Ga0207646_101214522 345
422 3300005293 Ga0065715_10109939 Ga0065715_101099392 346
423 3300005295 Ga0065707_10083075 Ga0065707_1008307510 346
424 3300005334 Ga0068869_100008875 Ga0068869_1000088752 346
425 3300005334 Ga0068869_100021295 Ga0068869_1000212953 346
426 3300005355 Ga0070671_100053815 Ga0070671_1000538153 346
427 3300005367 Ga0070667_100236161 Ga0070667_1002361612 346
428 3300005456 Ga0070678_100032388 Ga0070678_1000323882 346
429 3300005457 Ga0070662_100166995 Ga0070662_1001669952 346
430 3300005459 Ga0068867_100080922 Ga0068867_1000809222 346
431 3300005467 Ga0070706_100234858 Ga0070706_1002348582 346
432 3300005471 Ga0070698_100015564 Ga0070698_1000155642 346
433 3300005530 Ga0070679_100108148 Ga0070679_1001081482 346
434 3300005543 Ga0070672_100110246 Ga0070672_1001102461 346
435 3300005546 Ga0070696_100153080 Ga0070696_1001530801 346
436 3300005564 Ga0070664_100015607 Ga0070664_1000156074 346
437 3300005564 Ga0070664_100016708 Ga0070664_1000167082 346
438 3300005564 Ga0070664_100177059 Ga0070664_1001770592 346
439 3300005617 Ga0068859_100066493 Ga0068859_1000664931 346
440 3300005618 Ga0068864_100003095 Ga0068864_1000030952 346
441 3300005718 Ga0068866_10051104 Ga0068866_100511042 346
442 3300005841 Ga0068863_100170342 Ga0068863_1001703422 346
443 3300005842 Ga0068858_100036628 Ga0068858_1000366282 346
444 3300006237 Ga0097621_100092273 Ga0097621_1000922732 346
445 3300006358 Ga0068871_100039617 Ga0068871_1000396171 346
446 3300006852 Ga0075433_10034647 Ga0075433_100346473 346
447 3300006871 Ga0075434_100156482 Ga0075434_1001564822 346
448 3300006931 Ga0097620_100066493 Ga0097620_1000664934 346
449 3300007076 Ga0075435_100132279 Ga0075435_1001322792 346
450 3300007076 Ga0075435_100278588 Ga0075435_1002785881 346
451 3300009174 Ga0105241_10043229 Ga0105241_100432293 346
452 3300009176 Ga0105242_10275446 Ga0105242_102754462 346
453 3300009177 Ga0105248_10004250 Ga0105248_100042503 346
454 3300009545 Ga0105237_10110544 Ga0105237_101105442 346
455 3300009553 Ga0105249_10058027 Ga0105249_100580273 346
456 3300009553 Ga0105249_10359233 Ga0105249_103592331 346
457 3300010375 Ga0105239_10065462 Ga0105239_100654623 346
458 3300010375 Ga0105239_10091534 Ga0105239_100915343 346
459 3300013297 Ga0157378_10014624 Ga0157378_100146244 346
460 3300013306 Ga0163162_10001497 Ga0163162_1000149712 346
461 3300013306 Ga0163162_10025381 Ga0163162_100253814 346
462 3300013308 Ga0157375_10007563 Ga0157375_100075638 346
463 3300013308 Ga0157375_10420141 Ga0157375_104201412 346
464 3300014325 Ga0163163_10006651 Ga0163163_100066516 346
465 3300014325 Ga0163163_10049192 Ga0163163_100491923 346
466 3300014969 Ga0157376_10015771 Ga0157376_100157713 346
467 3300021377 Ga0213874_10002104 Ga0213874_100021041 346
468 3300025907 Ga0207645_10009398 Ga0207645_100093981 346
469 3300025909 Ga0207705_10141347 Ga0207705_101413472 346
470 3300025919 Ga0207657_10061915 Ga0207657_100619152 346
471 3300025920 Ga0207649_10025709 Ga0207649_100257092 346
472 3300025923 Ga0207681_10024781 Ga0207681_100247812 346
473 3300025925 Ga0207650_10229657 Ga0207650_102296571 346
474 3300025931 Ga0207644_10038016 Ga0207644_100380162 346
475 3300025933 Ga0207706_10049669 Ga0207706_100496692 346
476 3300025940 Ga0207691_10016365 Ga0207691_100163656 346
477 3300025941 Ga0207711_10006003 Ga0207711_100060032 346
478 3300025942 Ga0207689_10005962 Ga0207689_1000596210 346
479 3300025945 Ga0207679_10151586 Ga0207679_101515862 346
480 3300025945 Ga0207679_10317882 Ga0207679_103178822 346
481 3300025949 Ga0207667_10112089 Ga0207667_101120892 346
482 3300025960 Ga0207651_10279833 Ga0207651_102798331 346
483 3300025960 Ga0207651_10324804 Ga0207651_103248041 346
484 3300025961 Ga0207712_10197016 Ga0207712_101970162 346
485 3300026067 Ga0207678_10086005 Ga0207678_100860052 346
486 3300026088 Ga0207641_10113405 Ga0207641_101134052 346
487 3300026088 Ga0207641_10166076 Ga0207641_101660762 346
488 3300026095 Ga0207676_10009187 Ga0207676_100091873 346
489 3300026121 Ga0207683_10236099 Ga0207683_102360992 346
490 3300037068 Ga0373925_0324221 Ga0373925_0324221_53_1180 346
491 3300039450 Ga0436363_0915897 Ga0436363_0915897_6766_7809 346
492 3300046472 Ga0495580_0019109 Ga0495580_0019109_1453_2523 346
493 3300048915 Ga0496112_0133932 Ga0496112_0133932_926_1975 346
494 3300050512 nmdc:mga0n895_216995_c1 nmdc:mga0n895_216995_c1_486_1565 346
495 3300050512 nmdc:mga0n895_243032_c1 nmdc:mga0n895_243032_c1_388_1428 346
496 3300050512 nmdc:mga0n895_340426_c1 nmdc:mga0n895_340426_c1_251_1309 346
497 3300050515 nmdc:mga0a205_41095_c1 nmdc:mga0a205_41095_c1_1681_2724 346
498 3300005289 Ga0065704_10074099 Ga0065704_100740992 347
499 3300005471 Ga0070698_100020782 Ga0070698_1000207827 347
500 3300005618 Ga0068864_100253820 Ga0068864_1002538202 347
501 3300006914 Ga0075436_100025523 Ga0075436_1000255232 347
502 3300009147 Ga0114129_10026555 Ga0114129_100265552 347
503 3300026095 Ga0207676_10119849 Ga0207676_101198492 347
504 3300050507 nmdc:mga05p37_16577_c1 nmdc:mga05p37_16577_c1_7229_8344 347
505 3300050514 nmdc:mga08x19_20297_c1 nmdc:mga08x19_20297_c1_2593_3666 347

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

277

0.98

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

34

344

0.98

PF04321

RmlD_sub_bind

RmlD substrate binding domain

31

236

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n7h-assembly1.cif.gz_A-2 crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp 0.9752 1 328
1rpn-assembly3.cif.gz_C crystal structure of gdp-d-mannose 4,6-dehydratase in complexes with gdp and nadph 0.972 1 326
5uzh-assembly1.cif.gz_A crystal structure of a gdp-mannose dehydratase from naegleria fowleri 0.9718 1 325
1n7h-assembly1.cif.gz_B-2 crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp 0.9716 1 328
5in5-assembly1.cif.gz_B crystal structure of gdp-mannose 4,6 dehydratase in complex with natural inhibitor gdp-fucose 0.9714 2 328
ID Description Score Start End Superfamily
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9907 2 266 3.40.50.720
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.976 2 266 3.40.50.720
af_F1QPT3_45_368_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 25 320 3.40.50.720
af_Q4D941_50_182_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9525 190 303 3.90.25.10
af_Q4CM81_7_150_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9484 1 147 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A146LA67-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) 0.9983 124 269 GO:0008446
GO:0042351
AF-A0A3C0G369-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.997 204 298 GO:0008446
GO:0042351
AF-A0A2V5T8D5-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9958 208 328 GO:0008446
GO:0042351
AF-A0A2G9YHF7-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.993 97 324 GO:0008446
GO:0042351
AF-A0A382CEB6-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.9923 60 226 GO:0008446
GO:0042351

Feature Viewer

pLDDT pTM Quality
90.84 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map