F456292

General Info

Members Datasets Scaffolds Average Seq Length
505 298 1010 190

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10030302|JGI24739J22299_100303022
Length 183
Sequence MSIAIHPSVDQGVKQGSANFAGGTLVCKCQEKPVKVSVGTQSAHNHVCGCTKCWKPDGALFAMIAVAPRDKVKVTDNEDKATIQRHACTGCGVHMFGRIENKGHPFHGLDFIHTELSPESGWSAPEFAAFVSSIIESGADPNNMDAVRARLRELGLPPYDCLSPPLMDFIATKLAQASGVLKA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
116 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
200 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
206 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
279 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
280 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
285 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
292 2643221733 Bosea sp. Root381 Isolate Unclassified
293 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
294 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
295 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
296 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
297 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
298 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.25
Metatranscriptomes 3.37
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0.4
Rhizoplane 3.56
Rhizosphere 91.29
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10030302 3300001989 Bacteria 1876
2 JGI24735J21928_10002105 3300002067 Bacteria 7013
3 rootH2_10066537 3300003320 Bacteria 4309
4 Ga0007410J51695_1034821 3300003574 Bacteria 1103
5 Ga0007409J51694_1026705 3300003575 Bacteria 812
6 Ga0055533_1000362 3300003756 Bacteria 19155
7 Ga0058863_11343778 3300004799 Bacteria 1268
8 Ga0058861_11829721 3300004800 Bacteria 1134
9 Ga0058862_12507519 3300004803 Bacteria 1361
10 Ga0058862_12613569 3300004803 Bacteria 831
11 Ga0065707_10177008 3300005295 Bacteria 1444
12 Ga0070658_10053988 3300005327 Bacteria 3262
13 Ga0070658_10564442 3300005327 Bacteria 985
14 Ga0070676_10187618 3300005328 Bacteria 1348
15 Ga0070676_10637873 3300005328 Bacteria 772
16 Ga0070690_100000447 3300005330 Bacteria 20750
17 Ga0070690_100040298 3300005330 Bacteria 2954
18 Ga0070690_100192771 3300005330 Bacteria 1414
19 Ga0070670_100002180 3300005331 Bacteria 16091
20 Ga0070670_100018619 3300005331 Bacteria 5951
21 Ga0068869_100001940 3300005334 Bacteria 12408
22 Ga0070666_10072346 3300005335 Bacteria 2347
23 Ga0070666_10300867 3300005335 Bacteria 1142
24 Ga0070680_100093419 3300005336 Bacteria 2492
25 Ga0070682_100232065 3300005337 Bacteria 1320
26 Ga0070682_100579245 3300005337 Bacteria 883
27 Ga0068868_100065943 3300005338 Bacteria 2877
28 Ga0068868_100139217 3300005338 Bacteria 1991
29 Ga0070689_100001788 3300005340 Bacteria 13810
30 Ga0070691_10113952 3300005341 Bacteria 1355
31 Ga0070687_100001347 3300005343 Bacteria 8616
32 Ga0070661_100113113 3300005344 Bacteria 2028
33 Ga0070661_100269432 3300005344 Bacteria 1318
34 Ga0070661_100364201 3300005344 Bacteria 1137
35 Ga0070692_10140790 3300005345 Bacteria 1365
36 Ga0070669_100139717 3300005353 Bacteria 1866
37 Ga0070675_100002389 3300005354 Bacteria 13982
38 Ga0070675_100081456 3300005354 Bacteria 2699
39 Ga0070675_100627276 3300005354 Bacteria 976
40 Ga0070671_100008654 3300005355 Bacteria 8164
41 Ga0070671_100062072 3300005355 Bacteria 3112
42 Ga0070674_100156493 3300005356 Bacteria 1725
43 Ga0070674_100357949 3300005356 Bacteria 1181
44 Ga0070673_100008457 3300005364 Bacteria 6844
45 Ga0070673_100182799 3300005364 Bacteria 1796
46 Ga0070688_100093525 3300005365 Bacteria 1969
47 Ga0070659_100066271 3300005366 Bacteria 2861
48 Ga0070667_100017751 3300005367 Bacteria 5898
49 Ga0070667_100042933 3300005367 Bacteria 3794
50 Ga0070667_100072913 3300005367 Bacteria 2927
51 Ga0070667_100238213 3300005367 Bacteria 1624
52 Ga0070667_100302004 3300005367 Bacteria 1442
53 Ga0070667_100376558 3300005367 Bacteria 1289
54 Ga0070710_10312601 3300005437 Bacteria 1029
55 Ga0070710_10582028 3300005437 Bacteria 777
56 Ga0070701_10480060 3300005438 Bacteria 803
57 Ga0070705_100092990 3300005440 Bacteria 1884
58 Ga0070700_100475562 3300005441 Bacteria 956
59 Ga0070694_100035702 3300005444 Bacteria 3289
60 Ga0070663_100022116 3300005455 Bacteria 4245
61 Ga0070663_100103843 3300005455 Bacteria 2125
62 Ga0070663_100293501 3300005455 Bacteria 1299
63 Ga0070678_100013182 3300005456 Bacteria 5172
64 Ga0070678_100179449 3300005456 Bacteria 1732
65 Ga0070662_100030662 3300005457 Bacteria 3766
66 Ga0070681_10025808 3300005458 Bacteria 5908
67 Ga0070681_10329324 3300005458 Bacteria 1437
68 Ga0068867_100003630 3300005459 Bacteria 10856
69 Ga0070685_10001947 3300005466 Bacteria 10729
70 Ga0070706_100012754 3300005467 Bacteria 7775
71 Ga0070707_100063242 3300005468 Bacteria 3552
72 Ga0070679_100204753 3300005530 Bacteria 1938
73 Ga0070679_100288158 3300005530 Bacteria 1594
74 Ga0070684_100005357 3300005535 Bacteria 9831
75 Ga0070697_100266219 3300005536 Bacteria 1468
76 Ga0068853_100132233 3300005539 Bacteria 2235
77 Ga0068853_100147962 3300005539 Bacteria 2112
78 Ga0070672_100118555 3300005543 Bacteria 2164
79 Ga0070686_100003983 3300005544 Bacteria 8125
80 Ga0070695_100071844 3300005545 Bacteria 2267
81 Ga0070696_100058287 3300005546 Bacteria 2696
82 Ga0070665_100005306 3300005548 Bacteria 13313
83 Ga0070665_100010439 3300005548 Bacteria 9397
84 Ga0070665_100193274 3300005548 Bacteria 2036
85 Ga0070665_100238842 3300005548 Bacteria 1818
86 Ga0070704_100569630 3300005549 Bacteria 992
87 Ga0068855_100191916 3300005563 Bacteria 2303
88 Ga0068855_100717485 3300005563 Bacteria 1069
89 Ga0070664_100001499 3300005564 Bacteria 18603
90 Ga0070664_100004295 3300005564 Bacteria 11458
91 Ga0068857_100044854 3300005577 Bacteria 3922
92 Ga0068857_100097504 3300005577 Bacteria 2636
93 Ga0068854_100109158 3300005578 Bacteria 2085
94 Ga0068856_100594481 3300005614 Bacteria 1128
95 Ga0070702_100003933 3300005615 Bacteria 6736
96 Ga0070702_100224984 3300005615 Bacteria 1257
97 Ga0068852_100578245 3300005616 Bacteria 1126
98 Ga0068859_100000036 3300005617 Bacteria 169326
99 Ga0068859_100006081 3300005617 Bacteria 12257
100 Ga0068864_100001893 3300005618 Bacteria 17177
101 Ga0068864_100006666 3300005618 Bacteria 9455
102 Ga0068866_10146764 3300005718 Bacteria 1361
103 Ga0068861_100020759 3300005719 Bacteria 4710
104 Ga0068851_10020422 3300005834 Bacteria 3208
105 Ga0068863_100006951 3300005841 Bacteria 11096
106 Ga0068863_100038059 3300005841 Bacteria 4577
107 Ga0068863_100135681 3300005841 Bacteria 2351
108 Ga0068858_100109203 3300005842 Bacteria 2582
109 Ga0068860_100016186 3300005843 Bacteria 7275
110 Ga0068860_100018225 3300005843 Bacteria 6833
111 Ga0068860_100331857 3300005843 Bacteria 1494
112 Ga0068862_100006690 3300005844 Bacteria 9563
113 Ga0068862_100008132 3300005844 Bacteria 8674
114 Ga0068862_100032997 3300005844 Bacteria 4374
115 Ga0081538_10043496 3300005981 Bacteria 2818
116 Ga0081539_10030721 3300005985 Bacteria 3328
117 Ga0075362_10414349 3300006177 Bacteria 681
118 Ga0075366_10437095 3300006195 Bacteria 807
119 Ga0097621_100118826 3300006237 Bacteria 2240
120 Ga0097621_100593623 3300006237 Bacteria 1012
121 Ga0068871_100039277 3300006358 Bacteria 3786
122 Ga0068871_100413114 3300006358 Bacteria 1204
123 Ga0075428_100016219 3300006844 Bacteria 8236
124 Ga0075428_100080648 3300006844 Bacteria 3551
125 Ga0075428_100124750 3300006844 Bacteria 2803
126 Ga0075430_100002265 3300006846 Bacteria 15936
127 Ga0075430_100002676 3300006846 Bacteria 14872
128 Ga0075430_100309142 3300006846 Bacteria 1307
129 Ga0075431_100000356 3300006847 Bacteria 36283
130 Ga0075431_100002051 3300006847 Bacteria 19253
131 Ga0075431_100195701 3300006847 Bacteria 2070
132 Ga0075431_100402539 3300006847 Bacteria 1370
133 Ga0075434_100008910 3300006871 Bacteria 9341
134 Ga0075434_100409741 3300006871 Bacteria 1377
135 Ga0075434_100594669 3300006871 Bacteria 1125
136 Ga0075429_100000124 3300006880 Bacteria 45454
137 Ga0068865_100070864 3300006881 Bacteria 2471
138 Ga0068865_100085793 3300006881 Bacteria 2272
139 Ga0075436_100037673 3300006914 Bacteria 3339
140 Ga0075436_100113447 3300006914 Bacteria 1892
141 Ga0097620_100000036 3300006931 Bacteria 169326
142 Ga0097620_100006081 3300006931 Bacteria 12257
143 Ga0075435_100010830 3300007076 Bacteria 6679
144 Ga0075435_100066212 3300007076 Bacteria 2939
145 Ga0105240_10024745 3300009093 Bacteria 7908
146 Ga0105240_10064344 3300009093 Bacteria 4557
147 Ga0105240_10372876 3300009093 Bacteria 1613
148 Ga0111539_10009053 3300009094 Bacteria 12601
149 Ga0111539_10039322 3300009094 Bacteria 5703
150 Ga0111539_10777636 3300009094 Bacteria 1114
151 Ga0111539_11067421 3300009094 Bacteria 939
152 Ga0105245_10240483 3300009098 Bacteria 1755
153 Ga0105247_10111059 3300009101 Bacteria 1765
154 Ga0114129_10000468 3300009147 Bacteria 48434
155 Ga0105243_10163652 3300009148 Bacteria 1920
156 Ga0105241_10375959 3300009174 Bacteria 1240
157 Ga0105241_10676505 3300009174 Bacteria 940
158 Ga0105242_10590242 3300009176 Bacteria 1071
159 Ga0105248_10015152 3300009177 Bacteria 8495
160 Ga0105237_10091828 3300009545 Bacteria 3026
161 Ga0105237_10174565 3300009545 Bacteria 2149
162 Ga0105237_10336312 3300009545 Bacteria 1514
163 Ga0105238_10302603 3300009551 Bacteria 1583
164 Ga0105249_10031344 3300009553 Bacteria 4808
165 Ga0105249_10162979 3300009553 Bacteria 2156
166 Ga0105249_10872114 3300009553 Bacteria 966
167 Ga0105239_10090966 3300010375 Bacteria 3367
168 Ga0105239_10099446 3300010375 Bacteria 3216
169 Ga0105239_11119384 3300010375 Bacteria 907
170 Ga0105246_10156332 3300011119 Bacteria 1732
171 Ga0157371_10089089 3300013102 Bacteria 2185
172 Ga0157370_10589256 3300013104 Bacteria 1018
173 Ga0157369_10898041 3300013105 Bacteria 909
174 Ga0157369_11094982 3300013105 Bacteria 814
175 Ga0157374_10319619 3300013296 Bacteria 1538
176 Ga0163162_10011035 3300013306 Bacteria 8800
177 Ga0163162_10294604 3300013306 Bacteria 1754
178 Ga0163162_11421067 3300013306 Bacteria 789
179 Ga0157372_10142700 3300013307 Bacteria 2761
180 Ga0157372_10390767 3300013307 Bacteria 1621
181 Ga0157375_10471951 3300013308 Bacteria 1420
182 Ga0163163_10002382 3300014325 Bacteria 15910
183 Ga0163163_10166480 3300014325 Bacteria 2251
184 Ga0163163_10430251 3300014325 Bacteria 1379
185 Ga0157377_10393483 3300014745 Bacteria 942
186 Ga0157379_10026338 3300014968 Bacteria 5177
187 Ga0157379_10170956 3300014968 Bacteria 1962
188 Ga0157379_10219796 3300014968 Bacteria 1721
189 Ga0183368_1002 3300015687 Bacteria 1865598
190 Ga0163161_10184046 3300017792 Bacteria 1603
191 Ga0163161_10242976 3300017792 Bacteria 1401
192 Ga0197907_11139088 3300020069 Bacteria 858
193 Ga0206356_10274075 3300020070 Bacteria 799
194 Ga0206355_1400847 3300020076 Bacteria 670
195 Ga0206355_1430557 3300020076 Bacteria 1160
196 Ga0206352_10954024 3300020078 Bacteria 733
197 Ga0206350_10348830 3300020080 Bacteria 1485
198 Ga0224712_10005891 3300022467 Bacteria 3454
199 Ga0224712_10297984 3300022467 Bacteria 754
200 Ga0209674_100014 3300025226 Bacteria 704989
201 Ga0207697_10056046 3300025315 Bacteria 1635
202 Ga0207692_10483219 3300025898 Bacteria 784
203 Ga0207688_10183011 3300025901 Bacteria 1250
204 Ga0207680_10040993 3300025903 Bacteria 2699
205 Ga0207680_10312138 3300025903 Bacteria 1098
206 Ga0207680_10440647 3300025903 Bacteria 924
207 Ga0207647_10000602 3300025904 Bacteria 28003
208 Ga0207647_10466045 3300025904 Bacteria 707
209 Ga0207645_10003857 3300025907 Bacteria 11220
210 Ga0207645_10190659 3300025907 Bacteria 1347
211 Ga0207643_10090853 3300025908 Bacteria 1780
212 Ga0207705_10219454 3300025909 Bacteria 1444
213 Ga0207684_10212304 3300025910 Bacteria 1669
214 Ga0207654_10376055 3300025911 Bacteria 983
215 Ga0207671_10256280 3300025914 Bacteria 1376
216 Ga0207671_10361090 3300025914 Bacteria 1153
217 Ga0207693_10045817 3300025915 Bacteria 3436
218 Ga0207660_10207751 3300025917 Bacteria 1532
219 Ga0207662_10003779 3300025918 Bacteria 7859
220 Ga0207657_10132547 3300025919 Bacteria 2041
221 Ga0207649_10009276 3300025920 Bacteria 5381
222 Ga0207649_10078913 3300025920 Bacteria 2125
223 Ga0207649_10113211 3300025920 Bacteria 1817
224 Ga0207649_10129284 3300025920 Bacteria 1713
225 Ga0207649_10278993 3300025920 Bacteria 1214
226 Ga0207652_10048398 3300025921 Bacteria 3634
227 Ga0207652_10091765 3300025921 Bacteria 2671
228 Ga0207646_10431929 3300025922 Bacteria 1188
229 Ga0207681_10050229 3300025923 Bacteria 2821
230 Ga0207694_10079339 3300025924 Bacteria 2574
231 Ga0207694_10711546 3300025924 Bacteria 847
232 Ga0207650_10003252 3300025925 Bacteria 11193
233 Ga0207650_10131834 3300025925 Bacteria 1956
234 Ga0207659_10003909 3300025926 Bacteria 8985
235 Ga0207659_10491358 3300025926 Bacteria 1038
236 Ga0207644_10012925 3300025931 Bacteria 5552
237 Ga0207644_10580717 3300025931 Bacteria 929
238 Ga0207690_10100735 3300025932 Bacteria 2062
239 Ga0207706_10086056 3300025933 Bacteria 2763
240 Ga0207706_10116872 3300025933 Bacteria 2346
241 Ga0207686_10403008 3300025934 Bacteria 1042
242 Ga0207670_10018745 3300025936 Bacteria 4214
243 Ga0207669_10270973 3300025937 Bacteria 1275
244 Ga0207704_10033030 3300025938 Bacteria 2937
245 Ga0207704_10462606 3300025938 Bacteria 1015
246 Ga0207691_10027107 3300025940 Bacteria 5376
247 Ga0207691_10317597 3300025940 Bacteria 1336
248 Ga0207711_10017130 3300025941 Bacteria 6018
249 Ga0207689_10016437 3300025942 Bacteria 6264
250 Ga0207689_10041544 3300025942 Bacteria 3806
251 Ga0207679_10012080 3300025945 Bacteria 5617
252 Ga0207679_10019717 3300025945 Bacteria 4538
253 Ga0207667_10502753 3300025949 Bacteria 1229
254 Ga0207667_10538270 3300025949 Bacteria 1182
255 Ga0207667_11029975 3300025949 Bacteria 809
256 Ga0207651_10005232 3300025960 Bacteria 6632
257 Ga0207651_10393983 3300025960 Bacteria 1176
258 Ga0207712_10019413 3300025961 Bacteria 4438
259 Ga0207668_11175237 3300025972 Bacteria 689
260 Ga0207658_10024709 3300025986 Bacteria 4204
261 Ga0207658_10039925 3300025986 Bacteria 3389
262 Ga0207658_10072378 3300025986 Bacteria 2613
263 Ga0207658_10147331 3300025986 Bacteria 1914
264 Ga0207677_10206733 3300026023 Bacteria 1564
265 Ga0207677_10259254 3300026023 Bacteria 1416
266 Ga0207703_10023876 3300026035 Bacteria 4809
267 Ga0207703_10170062 3300026035 Bacteria 1916
268 Ga0207639_10167396 3300026041 Bacteria 1858
269 Ga0207678_10010944 3300026067 Bacteria 7971
270 Ga0207678_10234463 3300026067 Bacteria 1571
271 Ga0207708_10015042 3300026075 Bacteria 5799
272 Ga0207708_10026603 3300026075 Bacteria 4381
273 Ga0207641_10010775 3300026088 Bacteria 7495
274 Ga0207641_10039726 3300026088 Bacteria 3936
275 Ga0207648_10010315 3300026089 Bacteria 8868
276 Ga0207676_10002491 3300026095 Bacteria 13109
277 Ga0207674_10098777 3300026116 Bacteria 2902
278 Ga0207674_10106605 3300026116 Bacteria 2780
279 Ga0207674_10114260 3300026116 Bacteria 2672
280 Ga0207675_100002172 3300026118 Bacteria 19499
281 Ga0207675_100301359 3300026118 Bacteria 1561
282 Ga0207675_100513925 3300026118 Bacteria 1193
283 Ga0207675_101230539 3300026118 Bacteria 769
284 Ga0207683_10007149 3300026121 Bacteria 9571
285 Ga0207683_10016631 3300026121 Bacteria 6259
286 Ga0207698_10888071 3300026142 Bacteria 898
287 Ga0268266_10000101 3300028379 Bacteria 180443
288 Ga0268266_10018507 3300028379 Bacteria 5935
289 Ga0268266_10025833 3300028379 Bacteria 4997
290 Ga0268266_10043552 3300028379 Bacteria 3837
291 Ga0268266_10115292 3300028379 Bacteria 2385
292 Ga0268265_10000054 3300028380 Bacteria 165504
293 Ga0268265_10014424 3300028380 Bacteria 5383
294 Ga0268264_10024857 3300028381 Bacteria 4894
295 Ga0268264_10063501 3300028381 Bacteria 3104
296 Ga0268264_10202645 3300028381 Bacteria 1816
297 Ga0268264_10390040 3300028381 Bacteria 1336
298 Ga0307515_10126993 3300028794 Bacteria 2840
299 Ga0265338_10003864 3300028800 Bacteria 20767
300 Ga0265338_10325863 3300028800 Bacteria 1111
301 Ga0307509_10000003 3300031507 Bacteria 577578
302 Ga0307408_100005662 3300031548 Bacteria 8326
303 Ga0316576_10117623 3300031727 Bacteria 1995
304 Ga0307406_10082075 3300031901 Bacteria 2146
305 Ga0307407_10259274 3300031903 Bacteria 1195
306 Ga0307407_10401257 3300031903 Bacteria 984
307 Ga0307412_10293314 3300031911 Bacteria 1282
308 Ga0307409_100034176 3300031995 Bacteria 3709
309 Ga0307416_100391154 3300032002 Bacteria 1424
310 Ga0307414_10506666 3300032004 Bacteria 1069
311 Ga0307411_10682263 3300032005 Bacteria 893
312 Ga0373926_0086282 3300035083 Bacteria 1165
313 Ga0373923_0190584 3300035111 Bacteria 945
314 Ga0316574_0260136 3300035398 Bacteria 1108
315 Ga0373931_0080328 3300035691 Bacteria 1798
316 Ga0373935_0096182 3300035692 Bacteria 1946
317 Ga0373947_0025052 3300035725 Bacteria 3478
318 Ga0373925_0058434 3300037068 Bacteria 2892
319 Ga0373925_0097795 3300037068 Bacteria 2251
320 Ga0395900_0162456 3300037418 Bacteria 2277
321 Ga0395898_0137899 3300037466 Bacteria 2335
322 Ga0395905_0120285 3300037471 Bacteria 2468
323 Ga0395901_0019351 3300038443 Bacteria 6959
324 Ga0436360_1358852 3300039438 Bacteria 775
325 Ga0436361_0749226 3300039447 Bacteria 2897
326 Ga0436363_1449090 3300039450 Bacteria 1636
327 Ga0451791_0034725 3300041451 Bacteria 2360
328 Ga0451791_0576437 3300041451 Bacteria 1211
329 Ga0451797_0011511 3300041453 Bacteria 2281
330 Ga0451807_2414545 3300041486 Bacteria 1206
331 Ga0451843_0492202 3300041509 Bacteria 2088
332 Ga0451853_1654159 3300041512 Bacteria 1231
333 Ga0439448_0126696 3300042005 Bacteria 878
334 Ga0439455_0043308 3300042012 Bacteria 1158
335 Ga0450923_019110 3300042125 Bacteria 1317
336 Ga0439458_0100768 3300042157 Bacteria 750
337 Ga0450908_001882 3300042184 Bacteria 4107
338 Ga0451576_0015523 3300045051 Bacteria 8431
339 Ga0495638_0000060 3300046460 Bacteria 190580
340 Ga0495638_0001194 3300046460 Bacteria 24875
341 Ga0495650_0000213 3300046471 Bacteria 123910
342 Ga0495582_0304881 3300046473 Bacteria 916
343 Ga0495605_0009743 3300046474 Bacteria 5399
344 Ga0495596_0000185 3300046500 Bacteria 43439
345 Ga0495607_0091016 3300046501 Bacteria 1653
346 Ga0495648_0000810 3300046524 Bacteria 33109
347 Ga0495648_0254108 3300046524 Bacteria 847
348 Ga0495652_0295418 3300046529 Unclassified 1180
349 Ga0495609_0002143 3300046538 Bacteria 12418
350 Ga0495649_0078753 3300046694 Bacteria 1763
351 Ga0495589_0099976 3300046794 Bacteria 1404
352 Ga0495672_0000322 3300047320 Bacteria 63657
353 Ga0495683_0016864 3300047323 Bacteria 3791
354 Ga0495684_0305765 3300047471 Bacteria 1141
355 Ga0495626_0092765 3300048091 Bacteria 1326
356 Ga0496102_0080138 3300048905 Bacteria 3008
357 Ga0496106_0027293 3300048909 Bacteria 4252
358 Ga0496107_0181116 3300048910 Bacteria 1565
359 Ga0496107_0394232 3300048910 Bacteria 1030
360 Ga0496108_0062186 3300048911 Bacteria 3144
361 Ga0496109_0016390 3300048912 Bacteria 6478
362 Ga0496110_0005377 3300048913 Bacteria 10034
363 Ga0496111_0150158 3300048914 Bacteria 1728
364 Ga0496112_0047913 3300048915 Bacteria 4192
365 Ga0496113_0042096 3300048916 Bacteria 3373
366 Ga0496113_0428469 3300048916 Bacteria 1063
367 Ga0496114_0063684 3300048917 Bacteria 3087
368 Ga0496115_0000379 3300048918 Bacteria 36717
369 Ga0496115_0287364 3300048918 Bacteria 1349
370 Ga0496126_0106141 3300048929 Bacteria 2452
371 Ga0501031_0030170 3300049568 Bacteria 3536
372 Ga0501031_0349218 3300049568 Bacteria 957
373 Ga0501032_0010790 3300049569 Bacteria 6579
374 Ga0501032_0197239 3300049569 Bacteria 1314
375 Ga0501033_0028564 3300049570 Bacteria 4190
376 Ga0501033_0088003 3300049570 Bacteria 2272
377 Ga0501033_0504393 3300049570 Bacteria 837
378 Ga0501033_0717175 3300049570 Bacteria 680
379 Ga0501034_0204991 3300049571 Bacteria 1928
380 Ga0501034_0460162 3300049571 Bacteria 1189
381 Ga0501036_0040331 3300049572 Bacteria 3948
382 Ga0501036_0143338 3300049572 Bacteria 2015
383 Ga0501036_0480733 3300049572 Bacteria 1034
384 Ga0501037_0221379 3300049573 Bacteria 1331
385 Ga0501037_0452802 3300049573 Bacteria 875
386 Ga0501039_0050608 3300049575 Bacteria 3214
387 Ga0501039_0819763 3300049575 Bacteria 726
388 Ga0501040_0244139 3300049576 Bacteria 1281
389 Ga0501040_0291328 3300049576 Bacteria 1166
390 Ga0501040_0655347 3300049576 Bacteria 759
391 Ga0501042_0096352 3300049578 Bacteria 2125
392 Ga0501042_0150047 3300049578 Bacteria 1680
393 Ga0501042_0206132 3300049578 Bacteria 1418
394 Ga0501042_0569985 3300049578 Bacteria 823
395 Ga0501043_0101219 3300049579 Bacteria 2264
396 Ga0501043_0321094 3300049579 Bacteria 1180
397 Ga0501043_0584586 3300049579 Bacteria 826
398 Ga0501046_0014557 3300049580 Bacteria 6630
399 Ga0501046_0057653 3300049580 Bacteria 3046
400 Ga0501046_0256829 3300049580 Bacteria 1285
401 Ga0501046_0297035 3300049580 Bacteria 1180
402 Ga0501047_0014449 3300049581 Bacteria 7509
403 Ga0501047_0069831 3300049581 Bacteria 3382
404 Ga0501047_0124171 3300049581 Bacteria 2462
405 Ga0501047_0209973 3300049581 Bacteria 1805
406 Ga0501048_0398730 3300049582 Bacteria 983
407 Ga0501048_0435305 3300049582 Bacteria 939
408 Ga0501068_0011729 3300049584 Bacteria 4956
409 Ga0501068_0037756 3300049584 Bacteria 2891
410 Ga0501069_0040256 3300049585 Bacteria 2583
411 Ga0501069_0043020 3300049585 Bacteria 2499
412 Ga0501070_0028783 3300049586 Bacteria 4658
413 Ga0501070_0103011 3300049586 Bacteria 2360
414 Ga0501070_0385225 3300049586 Bacteria 1135
415 Ga0501071_0094377 3300049587 Bacteria 2200
416 Ga0501071_0153301 3300049587 Bacteria 1719
417 Ga0501071_0211025 3300049587 Bacteria 1460
418 Ga0501072_0114498 3300049588 Bacteria 2147
419 Ga0501072_0148886 3300049588 Bacteria 1866
420 Ga0501072_0297243 3300049588 Bacteria 1283
421 Ga0501073_0007681 3300049589 Bacteria 8003
422 Ga0501073_0069085 3300049589 Bacteria 2462
423 Ga0501073_0075834 3300049589 Bacteria 2340
424 Ga0501073_0203345 3300049589 Bacteria 1369
425 Ga0501074_0148491 3300049590 Bacteria 1676
426 Ga0501074_0293784 3300049590 Bacteria 1154
427 Ga0501075_0436818 3300049591 Bacteria 998
428 Ga0501076_0040912 3300049592 Bacteria 3644
429 Ga0501076_0152711 3300049592 Bacteria 1878
430 Ga0501077_0375171 3300049593 Bacteria 908
431 Ga0501079_0081652 3300049741 Bacteria 2500
432 Ga0501079_0093035 3300049741 Bacteria 2336
433 Ga0501079_0118225 3300049741 Bacteria 2060
434 Ga0501079_0268004 3300049741 Bacteria 1335
435 Ga0501079_0389702 3300049741 Bacteria 1092
436 Ga0501080_0042853 3300049742 Bacteria 4213
437 Ga0501080_0146999 3300049742 Bacteria 2179
438 Ga0501080_0171882 3300049742 Bacteria 1998
439 Ga0501080_0218571 3300049742 Bacteria 1744
440 Ga0501080_0380102 3300049742 Bacteria 1273
441 Ga0501081_0036567 3300049743 Bacteria 3348
442 Ga0501081_0184360 3300049743 Bacteria 1510
443 Ga0501083_0030984 3300049744 Bacteria 3671
444 Ga0501083_0136909 3300049744 Bacteria 1604
445 Ga0501083_0675531 3300049744 Bacteria 672
446 Ga0501279_043371 3300049775 Bacteria 696
447 Ga0501035_0076891 3300049822 Bacteria 2951
448 Ga0501035_0237680 3300049822 Bacteria 1550
449 Ga0501035_0297155 3300049822 Bacteria 1361
450 Ga0501044_0099644 3300049823 Bacteria 2924
451 Ga0501044_0186361 3300049823 Bacteria 2039
452 Ga0501044_0497694 3300049823 Bacteria 1120
453 Ga0501045_0153157 3300049824 Bacteria 1715
454 nmdc:mga05p37_694_c1 3300050507 Bacteria 37343
455 nmdc:mga09592_16698_c1 3300050508 Bacteria 6008
456 nmdc:mga09592_317099_c1 3300050508 Bacteria 1351
457 nmdc:mga0qj67_13731_c1 3300050509 Bacteria 6112
458 nmdc:mga0qj67_228_c1 3300050509 Bacteria 38249
459 nmdc:mga0qj67_620303_c1 3300050509 Bacteria 864
460 nmdc:mga0qj67_903568_c1 3300050509 Bacteria 696
461 nmdc:mga06r32_1145_c1 3300050510 Bacteria 23824
462 nmdc:mga06r32_230287_c1 3300050510 Bacteria 1841
463 nmdc:mga06r32_270624_c1 3300050510 Bacteria 1686
464 nmdc:mga06r32_31_c1 3300050510 Bacteria 84127
465 nmdc:mga08y16_27836_c1 3300050511 Bacteria 5957
466 nmdc:mga08y16_92007_c1 3300050511 Bacteria 3160
467 nmdc:mga0n895_22317_c1 3300050512 Bacteria 5934
468 nmdc:mga0n895_251533_c1 3300050512 Bacteria 1793
469 nmdc:mga0n895_31696_c1 3300050512 Bacteria 5064
470 nmdc:mga0n895_347018_c1 3300050512 Bacteria 1503
471 nmdc:mga0n895_848142_c1 3300050512 Bacteria 902
472 nmdc:mga0rr50_100591_c1 3300050513 Bacteria 2271
473 nmdc:mga08x19_11071_c1 3300050514 Bacteria 5429
474 nmdc:mga08x19_727811_c1 3300050514 Bacteria 704
475 nmdc:mga0a205_201344_c1 3300050515 Bacteria 1881
476 nmdc:mga0a205_315479_c1 3300050515 Bacteria 1435
477 Ga0500643_092921 3300053087 Bacteria 822
478 Ga0500583_0039914 3300053092 Bacteria 2124
479 Ga0500591_040507 3300053115 Bacteria 2219
480 Ga0500595_017628 3300053119 Bacteria 2631
481 Ga0500559_0085482 3300053136 Bacteria 1439
482 Ga0500603_117458 3300053150 Bacteria 804
483 Ga0500616_0135880 3300053153 Bacteria 1155
484 Ga0500639_082951 3300053163 Bacteria 1612
485 Ga0500636_0130847 3300053177 Bacteria 1398
486 Ga0501084_0210374 3300054114 Bacteria 1641
487 Ga0501084_0447959 3300054114 Bacteria 1091
488 Ga0501084_0522350 3300054114 Bacteria 1003
489 Ga0587088_024543 3300059508 Bacteria 1034
490 Ga0587117_014793 3300059627 Bacteria 1018
491 Ga0587062_065705 3300059639 Bacteria 646
492 Ga0501082_0000491 3300060353 Bacteria 34911
493 Ga0501082_0095414 3300060353 Bacteria 2570
494 Ga0501082_0387201 3300060353 Bacteria 1220
495 Ga0501082_0406956 3300060353 Bacteria 1187
496 Ga0530510_0126117 3300061734 Bacteria 1882
497 Ga0530510_0144052 3300061734 Bacteria 1757
498 Ga0530510_1097260 3300061734 Bacteria 610
499 2644728892 2643221733 Bacteria 5690728
500 2738944360 2738541317 Bacteria 5340176
501 2883356104 2883354860 Bacteria 5865246
502 2894236426 2894232714 Bacteria 8834183
503 2897809353 2897803580 Bacteria 7000062
504 2913308979 2913308742 Bacteria 5350706
505 2957485269 2957484790 Bacteria 6703082
506 JGI24739J22299_10030302
507 JGI24735J21928_10002105
508 rootH2_10066537
509 Ga0007410J51695_1034821
510 Ga0007409J51694_1026705
511 Ga0055533_1000362
512 Ga0058863_11343778
513 Ga0058861_11829721
514 Ga0058862_12507519
515 Ga0058862_12613569
516 Ga0065707_10177008
517 Ga0070658_10053988
518 Ga0070658_10564442
519 Ga0070676_10187618
520 Ga0070676_10637873
521 Ga0070690_100000447
522 Ga0070690_100040298
523 Ga0070690_100192771
524 Ga0070670_100002180
525 Ga0070670_100018619
526 Ga0068869_100001940
527 Ga0070666_10072346
528 Ga0070666_10300867
529 Ga0070680_100093419
530 Ga0070682_100232065
531 Ga0070682_100579245
532 Ga0068868_100065943
533 Ga0068868_100139217
534 Ga0070689_100001788
535 Ga0070691_10113952
536 Ga0070687_100001347
537 Ga0070661_100113113
538 Ga0070661_100269432
539 Ga0070661_100364201
540 Ga0070692_10140790
541 Ga0070669_100139717
542 Ga0070675_100002389
543 Ga0070675_100081456
544 Ga0070675_100627276
545 Ga0070671_100008654
546 Ga0070671_100062072
547 Ga0070674_100156493
548 Ga0070674_100357949
549 Ga0070673_100008457
550 Ga0070673_100182799
551 Ga0070688_100093525
552 Ga0070659_100066271
553 Ga0070667_100017751
554 Ga0070667_100042933
555 Ga0070667_100072913
556 Ga0070667_100238213
557 Ga0070667_100302004
558 Ga0070667_100376558
559 Ga0070710_10312601
560 Ga0070710_10582028
561 Ga0070701_10480060
562 Ga0070705_100092990
563 Ga0070700_100475562
564 Ga0070694_100035702
565 Ga0070663_100022116
566 Ga0070663_100103843
567 Ga0070663_100293501
568 Ga0070678_100013182
569 Ga0070678_100179449
570 Ga0070662_100030662
571 Ga0070681_10025808
572 Ga0070681_10329324
573 Ga0068867_100003630
574 Ga0070685_10001947
575 Ga0070706_100012754
576 Ga0070707_100063242
577 Ga0070679_100204753
578 Ga0070679_100288158
579 Ga0070684_100005357
580 Ga0070697_100266219
581 Ga0068853_100132233
582 Ga0068853_100147962
583 Ga0070672_100118555
584 Ga0070686_100003983
585 Ga0070695_100071844
586 Ga0070696_100058287
587 Ga0070665_100005306
588 Ga0070665_100010439
589 Ga0070665_100193274
590 Ga0070665_100238842
591 Ga0070704_100569630
592 Ga0068855_100191916
593 Ga0068855_100717485
594 Ga0070664_100001499
595 Ga0070664_100004295
596 Ga0068857_100044854
597 Ga0068857_100097504
598 Ga0068854_100109158
599 Ga0068856_100594481
600 Ga0070702_100003933
601 Ga0070702_100224984
602 Ga0068852_100578245
603 Ga0068859_100000036
604 Ga0068859_100006081
605 Ga0068864_100001893
606 Ga0068864_100006666
607 Ga0068866_10146764
608 Ga0068861_100020759
609 Ga0068851_10020422
610 Ga0068863_100006951
611 Ga0068863_100038059
612 Ga0068863_100135681
613 Ga0068858_100109203
614 Ga0068860_100016186
615 Ga0068860_100018225
616 Ga0068860_100331857
617 Ga0068862_100006690
618 Ga0068862_100008132
619 Ga0068862_100032997
620 Ga0081538_10043496
621 Ga0081539_10030721
622 Ga0075362_10414349
623 Ga0075366_10437095
624 Ga0097621_100118826
625 Ga0097621_100593623
626 Ga0068871_100039277
627 Ga0068871_100413114
628 Ga0075428_100016219
629 Ga0075428_100080648
630 Ga0075428_100124750
631 Ga0075430_100002265
632 Ga0075430_100002676
633 Ga0075430_100309142
634 Ga0075431_100000356
635 Ga0075431_100002051
636 Ga0075431_100195701
637 Ga0075431_100402539
638 Ga0075434_100008910
639 Ga0075434_100409741
640 Ga0075434_100594669
641 Ga0075429_100000124
642 Ga0068865_100070864
643 Ga0068865_100085793
644 Ga0075436_100037673
645 Ga0075436_100113447
646 Ga0097620_100000036
647 Ga0097620_100006081
648 Ga0075435_100010830
649 Ga0075435_100066212
650 Ga0105240_10024745
651 Ga0105240_10064344
652 Ga0105240_10372876
653 Ga0111539_10009053
654 Ga0111539_10039322
655 Ga0111539_10777636
656 Ga0111539_11067421
657 Ga0105245_10240483
658 Ga0105247_10111059
659 Ga0114129_10000468
660 Ga0105243_10163652
661 Ga0105241_10375959
662 Ga0105241_10676505
663 Ga0105242_10590242
664 Ga0105248_10015152
665 Ga0105237_10091828
666 Ga0105237_10174565
667 Ga0105237_10336312
668 Ga0105238_10302603
669 Ga0105249_10031344
670 Ga0105249_10162979
671 Ga0105249_10872114
672 Ga0105239_10090966
673 Ga0105239_10099446
674 Ga0105239_11119384
675 Ga0105246_10156332
676 Ga0157371_10089089
677 Ga0157370_10589256
678 Ga0157369_10898041
679 Ga0157369_11094982
680 Ga0157374_10319619
681 Ga0163162_10011035
682 Ga0163162_10294604
683 Ga0163162_11421067
684 Ga0157372_10142700
685 Ga0157372_10390767
686 Ga0157375_10471951
687 Ga0163163_10002382
688 Ga0163163_10166480
689 Ga0163163_10430251
690 Ga0157377_10393483
691 Ga0157379_10026338
692 Ga0157379_10170956
693 Ga0157379_10219796
694 Ga0183368_1002
695 Ga0163161_10184046
696 Ga0163161_10242976
697 Ga0197907_11139088
698 Ga0206356_10274075
699 Ga0206355_1400847
700 Ga0206355_1430557
701 Ga0206352_10954024
702 Ga0206350_10348830
703 Ga0224712_10005891
704 Ga0224712_10297984
705 Ga0209674_100014
706 Ga0207697_10056046
707 Ga0207692_10483219
708 Ga0207688_10183011
709 Ga0207680_10040993
710 Ga0207680_10312138
711 Ga0207680_10440647
712 Ga0207647_10000602
713 Ga0207647_10466045
714 Ga0207645_10003857
715 Ga0207645_10190659
716 Ga0207643_10090853
717 Ga0207705_10219454
718 Ga0207684_10212304
719 Ga0207654_10376055
720 Ga0207671_10256280
721 Ga0207671_10361090
722 Ga0207693_10045817
723 Ga0207660_10207751
724 Ga0207662_10003779
725 Ga0207657_10132547
726 Ga0207649_10009276
727 Ga0207649_10078913
728 Ga0207649_10113211
729 Ga0207649_10129284
730 Ga0207649_10278993
731 Ga0207652_10048398
732 Ga0207652_10091765
733 Ga0207646_10431929
734 Ga0207681_10050229
735 Ga0207694_10079339
736 Ga0207694_10711546
737 Ga0207650_10003252
738 Ga0207650_10131834
739 Ga0207659_10003909
740 Ga0207659_10491358
741 Ga0207644_10012925
742 Ga0207644_10580717
743 Ga0207690_10100735
744 Ga0207706_10086056
745 Ga0207706_10116872
746 Ga0207686_10403008
747 Ga0207670_10018745
748 Ga0207669_10270973
749 Ga0207704_10033030
750 Ga0207704_10462606
751 Ga0207691_10027107
752 Ga0207691_10317597
753 Ga0207711_10017130
754 Ga0207689_10016437
755 Ga0207689_10041544
756 Ga0207679_10012080
757 Ga0207679_10019717
758 Ga0207667_10502753
759 Ga0207667_10538270
760 Ga0207667_11029975
761 Ga0207651_10005232
762 Ga0207651_10393983
763 Ga0207712_10019413
764 Ga0207668_11175237
765 Ga0207658_10024709
766 Ga0207658_10039925
767 Ga0207658_10072378
768 Ga0207658_10147331
769 Ga0207677_10206733
770 Ga0207677_10259254
771 Ga0207703_10023876
772 Ga0207703_10170062
773 Ga0207639_10167396
774 Ga0207678_10010944
775 Ga0207678_10234463
776 Ga0207708_10015042
777 Ga0207708_10026603
778 Ga0207641_10010775
779 Ga0207641_10039726
780 Ga0207648_10010315
781 Ga0207676_10002491
782 Ga0207674_10098777
783 Ga0207674_10106605
784 Ga0207674_10114260
785 Ga0207675_100002172
786 Ga0207675_100301359
787 Ga0207675_100513925
788 Ga0207675_101230539
789 Ga0207683_10007149
790 Ga0207683_10016631
791 Ga0207698_10888071
792 Ga0268266_10000101
793 Ga0268266_10018507
794 Ga0268266_10025833
795 Ga0268266_10043552
796 Ga0268266_10115292
797 Ga0268265_10000054
798 Ga0268265_10014424
799 Ga0268264_10024857
800 Ga0268264_10063501
801 Ga0268264_10202645
802 Ga0268264_10390040
803 Ga0307515_10126993
804 Ga0265338_10003864
805 Ga0265338_10325863
806 Ga0307509_10000003
807 Ga0307408_100005662
808 Ga0316576_10117623
809 Ga0307406_10082075
810 Ga0307407_10259274
811 Ga0307407_10401257
812 Ga0307412_10293314
813 Ga0307409_100034176
814 Ga0307416_100391154
815 Ga0307414_10506666
816 Ga0307411_10682263
817 Ga0373926_0086282
818 Ga0373923_0190584
819 Ga0316574_0260136
820 Ga0373931_0080328
821 Ga0373935_0096182
822 Ga0373947_0025052
823 Ga0373925_0058434
824 Ga0373925_0097795
825 Ga0395900_0162456
826 Ga0395898_0137899
827 Ga0395905_0120285
828 Ga0395901_0019351
829 Ga0436360_1358852
830 Ga0436361_0749226
831 Ga0436363_1449090
832 Ga0451791_0034725
833 Ga0451791_0576437
834 Ga0451797_0011511
835 Ga0451807_2414545
836 Ga0451843_0492202
837 Ga0451853_1654159
838 Ga0439448_0126696
839 Ga0439455_0043308
840 Ga0450923_019110
841 Ga0439458_0100768
842 Ga0450908_001882
843 Ga0451576_0015523
844 Ga0495638_0000060
845 Ga0495638_0001194
846 Ga0495650_0000213
847 Ga0495582_0304881
848 Ga0495605_0009743
849 Ga0495596_0000185
850 Ga0495607_0091016
851 Ga0495648_0000810
852 Ga0495648_0254108
853 Ga0495652_0295418
854 Ga0495609_0002143
855 Ga0495649_0078753
856 Ga0495589_0099976
857 Ga0495672_0000322
858 Ga0495683_0016864
859 Ga0495684_0305765
860 Ga0495626_0092765
861 Ga0496102_0080138
862 Ga0496106_0027293
863 Ga0496107_0181116
864 Ga0496107_0394232
865 Ga0496108_0062186
866 Ga0496109_0016390
867 Ga0496110_0005377
868 Ga0496111_0150158
869 Ga0496112_0047913
870 Ga0496113_0042096
871 Ga0496113_0428469
872 Ga0496114_0063684
873 Ga0496115_0000379
874 Ga0496115_0287364
875 Ga0496126_0106141
876 Ga0501031_0030170
877 Ga0501031_0349218
878 Ga0501032_0010790
879 Ga0501032_0197239
880 Ga0501033_0028564
881 Ga0501033_0088003
882 Ga0501033_0504393
883 Ga0501033_0717175
884 Ga0501034_0204991
885 Ga0501034_0460162
886 Ga0501036_0040331
887 Ga0501036_0143338
888 Ga0501036_0480733
889 Ga0501037_0221379
890 Ga0501037_0452802
891 Ga0501039_0050608
892 Ga0501039_0819763
893 Ga0501040_0244139
894 Ga0501040_0291328
895 Ga0501040_0655347
896 Ga0501042_0096352
897 Ga0501042_0150047
898 Ga0501042_0206132
899 Ga0501042_0569985
900 Ga0501043_0101219
901 Ga0501043_0321094
902 Ga0501043_0584586
903 Ga0501046_0014557
904 Ga0501046_0057653
905 Ga0501046_0256829
906 Ga0501046_0297035
907 Ga0501047_0014449
908 Ga0501047_0069831
909 Ga0501047_0124171
910 Ga0501047_0209973
911 Ga0501048_0398730
912 Ga0501048_0435305
913 Ga0501068_0011729
914 Ga0501068_0037756
915 Ga0501069_0040256
916 Ga0501069_0043020
917 Ga0501070_0028783
918 Ga0501070_0103011
919 Ga0501070_0385225
920 Ga0501071_0094377
921 Ga0501071_0153301
922 Ga0501071_0211025
923 Ga0501072_0114498
924 Ga0501072_0148886
925 Ga0501072_0297243
926 Ga0501073_0007681
927 Ga0501073_0069085
928 Ga0501073_0075834
929 Ga0501073_0203345
930 Ga0501074_0148491
931 Ga0501074_0293784
932 Ga0501075_0436818
933 Ga0501076_0040912
934 Ga0501076_0152711
935 Ga0501077_0375171
936 Ga0501079_0081652
937 Ga0501079_0093035
938 Ga0501079_0118225
939 Ga0501079_0268004
940 Ga0501079_0389702
941 Ga0501080_0042853
942 Ga0501080_0146999
943 Ga0501080_0171882
944 Ga0501080_0218571
945 Ga0501080_0380102
946 Ga0501081_0036567
947 Ga0501081_0184360
948 Ga0501083_0030984
949 Ga0501083_0136909
950 Ga0501083_0675531
951 Ga0501279_043371
952 Ga0501035_0076891
953 Ga0501035_0237680
954 Ga0501035_0297155
955 Ga0501044_0099644
956 Ga0501044_0186361
957 Ga0501044_0497694
958 Ga0501045_0153157
959 nmdc:mga05p37_694_c1
960 nmdc:mga09592_16698_c1
961 nmdc:mga09592_317099_c1
962 nmdc:mga0qj67_13731_c1
963 nmdc:mga0qj67_228_c1
964 nmdc:mga0qj67_620303_c1
965 nmdc:mga0qj67_903568_c1
966 nmdc:mga06r32_1145_c1
967 nmdc:mga06r32_230287_c1
968 nmdc:mga06r32_270624_c1
969 nmdc:mga06r32_31_c1
970 nmdc:mga08y16_27836_c1
971 nmdc:mga08y16_92007_c1
972 nmdc:mga0n895_22317_c1
973 nmdc:mga0n895_251533_c1
974 nmdc:mga0n895_31696_c1
975 nmdc:mga0n895_347018_c1
976 nmdc:mga0n895_848142_c1
977 nmdc:mga0rr50_100591_c1
978 nmdc:mga08x19_11071_c1
979 nmdc:mga08x19_727811_c1
980 nmdc:mga0a205_201344_c1
981 nmdc:mga0a205_315479_c1
982 Ga0500643_092921
983 Ga0500583_0039914
984 Ga0500591_040507
985 Ga0500595_017628
986 Ga0500559_0085482
987 Ga0500603_117458
988 Ga0500616_0135880
989 Ga0500639_082951
990 Ga0500636_0130847
991 Ga0501084_0210374
992 Ga0501084_0447959
993 Ga0501084_0522350
994 Ga0587088_024543
995 Ga0587117_014793
996 Ga0587062_065705
997 Ga0501082_0000491
998 Ga0501082_0095414
999 Ga0501082_0387201
1000 Ga0501082_0406956
1001 Ga0530510_0126117
1002 Ga0530510_0144052
1003 Ga0530510_1097260
1004 2644728892
1005 2738944360
1006 2883356104
1007 2894236426
1008 2897809353
1009 2913308979
1010 2957485269

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.8553 3 183
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.8417 3 183
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.8158 22 131
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.655 24 159
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.6442 24 159
ID Description Score Start End Superfamily
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8408 3 183 3.90.1590.10
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8274 3 183 3.90.1590.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7268 22 129 3.90.1590.10
3t7jB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.7121 145 163 3.40.50.10190
af_Q4CR06_409_636_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6549 125 158 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A536WJH1-F1-model_v4 Aldehyde-activating protein 0.9792 1 70 GO:0016846
GO:0046872
AF-A0A2A3D2Q7-F1-model_v4 S-(hydroxymethyl)glutathione synthase (EC 4.4.1.22) 0.9668 1 156 GO:0008270
GO:0046294
GO:0051907
AF-A0A523PIR7-F1-model_v4 S-(hydroxymethyl)glutathione synthase (EC 4.4.1.22) 0.9667 4 156 GO:0008270
GO:0046294
GO:0051907
AF-A0A0F8XLH0-F1-model_v4 CENP-V/GFA domain-containing protein 0.956 1 134 GO:0008270
GO:0046294
GO:0051907
AF-A0A1H3FHQ2-F1-model_v4 S-(Hydroxymethyl)glutathione synthase 0.9552 3 121 GO:0016846
GO:0046872

Map