F456097

General Info

Members Datasets Scaffolds Average Seq Length
503 239 1001 411

Family's Representative Sequence

Representative Sequence 3300049741|Ga0501079_0207530|Ga0501079_0207530_174_1478
Length 434
Sequence MPEPIAEQWRRPSFRDLGERRVVVTGMGAVTPIGNDVSTFWDCLVAGRSGIDRIASFDPSRLTCQIAGEVKGFEPDTVMPKKEVRRNDRYVHFAWAAAAEAMRDAGLELPITDELEANRTGVIIGSGIGGINTMIRDIIEAHDYGVERIGPFLVTSMIPDMGAGYVAIYANARGPNYAAVSACSSANHAIGESLGLLRRGDADVMIAGGAEAGIGEIPVGAFAAMRALSTKRNHEPQKACRPFDAQRDGFVMAEGAGILVLEALDHALARNAPIHAELVGYAATDDASHITLPAPGGRGAVGSMSLALSDAGLTTDDIDYINAHGTSTEPNDKGETAAIKTVFGERAYRVPVSSTKSMTGHLLGAGGGVEAIACVRAIETGVIPPTINYEFPDPECDLDYVPNQARSATVNRAMSNSFGFGGHNATLIFQRYEP

Samples

Sample ID Description Type Environment
1 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
131 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
132 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
151 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
152 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
238 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
239 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.8
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 0
Rhizoplane 7.16
Rhizosphere 88.27
Stem 0
Stem Tuber 0
Unclassified 3.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501079_0207530 3300049741 Bacteria 1530
2 rootH1_10034942 3300003316 Bacteria 2210
3 rootH1_10034942 3300003323 Bacteria 1543
4 Ga0070658_10009916 3300005327 Bacteria 7654
5 Ga0070676_10090885 3300005328 Bacteria 1870
6 Ga0070683_100000272 3300005329 Bacteria 35458
7 Ga0070690_100117373 3300005330 Bacteria 1782
8 Ga0068869_100000577 3300005334 Bacteria 20570
9 Ga0068869_100204218 3300005334 Bacteria 1559
10 Ga0070682_100024980 3300005337 Bacteria 3562
11 Ga0070691_10000263 3300005341 Bacteria 18269
12 Ga0070691_10029813 3300005341 Unclassified 2554
13 Ga0070691_10045563 3300005341 Bacteria 2081
14 Ga0070687_100010018 3300005343 Bacteria 4080
15 Ga0070692_10029495 3300005345 Bacteria 2734
16 Ga0070688_100061927 3300005365 Bacteria 2367
17 Ga0070714_100008339 3300005435 Bacteria 8084
18 Ga0070714_100219719 3300005435 Bacteria 1746
19 Ga0070713_100052558 3300005436 Bacteria 3374
20 Ga0070713_100203746 3300005436 Bacteria 1788
21 Ga0070700_100074926 3300005441 Bacteria 2170
22 Ga0070700_100175709 3300005441 Bacteria 1486
23 Ga0070694_100000615 3300005444 Bacteria 19645
24 Ga0070708_100008184 3300005445 Bacteria 8388
25 Ga0070708_100013352 3300005445 Bacteria 6722
26 Ga0070708_100014254 3300005445 Bacteria 6533
27 Ga0070708_100040375 3300005445 Bacteria 4086
28 Ga0070708_100042634 3300005445 Bacteria 3985
29 Ga0070708_100042873 3300005445 Unclassified 3974
30 Ga0070708_100167260 3300005445 Bacteria 2051
31 Ga0070708_100173236 3300005445 Unclassified 2016
32 Ga0070708_100237815 3300005445 Bacteria 1710
33 Ga0070708_100310900 3300005445 Bacteria 1484
34 Ga0070663_100102141 3300005455 Bacteria 2141
35 Ga0070678_100002842 3300005456 Bacteria 9579
36 Ga0070706_100003103 3300005467 Bacteria 16464
37 Ga0070706_100005416 3300005467 Bacteria 12154
38 Ga0070706_100020923 3300005467 Bacteria 6023
39 Ga0070706_100040954 3300005467 Bacteria 4277
40 Ga0070706_100057406 3300005467 Bacteria 3592
41 Ga0070706_100072778 3300005467 Bacteria 3180
42 Ga0070706_100103470 3300005467 Bacteria 2647
43 Ga0070706_100139597 3300005467 Bacteria 2262
44 Ga0070707_100005148 3300005468 Bacteria 12250
45 Ga0070707_100009476 3300005468 Bacteria 9041
46 Ga0070707_100012356 3300005468 Bacteria 7973
47 Ga0070707_100020992 3300005468 Bacteria 6166
48 Ga0070707_100033518 3300005468 Bacteria 4898
49 Ga0070707_100046844 3300005468 Bacteria 4138
50 Ga0070707_100065786 3300005468 Bacteria 3483
51 Ga0070707_100079322 3300005468 Unclassified 3168
52 Ga0070707_100141171 3300005468 Unclassified 2344
53 Ga0070698_100000439 3300005471 Bacteria 44124
54 Ga0070698_100027103 3300005471 Bacteria 5959
55 Ga0070698_100028822 3300005471 Bacteria 5762
56 Ga0070698_100119959 3300005471 Bacteria 2590
57 Ga0070698_100138118 3300005471 Bacteria 2390
58 Ga0070698_100153435 3300005471 Bacteria 2249
59 Ga0070698_100238934 3300005471 Bacteria 1750
60 Ga0070698_100251799 3300005471 Bacteria 1699
61 Ga0070699_100026231 3300005518 Bacteria 5026
62 Ga0070699_100036883 3300005518 Bacteria 4229
63 Ga0070699_100065817 3300005518 Bacteria 3145
64 Ga0070684_100000133 3300005535 Bacteria 49355
65 Ga0070684_100155171 3300005535 Bacteria 2076
66 Ga0070697_100009001 3300005536 Bacteria 7800
67 Ga0070697_100042390 3300005536 Bacteria 3683
68 Ga0070697_100061637 3300005536 Bacteria 3059
69 Ga0070697_100116931 3300005536 Unclassified 2227
70 Ga0070697_100168567 3300005536 Bacteria 1852
71 Ga0070686_100042915 3300005544 Bacteria 2835
72 Ga0070686_100070440 3300005544 Bacteria 2287
73 Ga0070695_100010313 3300005545 Bacteria 5576
74 Ga0070695_100012047 3300005545 Bacteria 5183
75 Ga0070695_100012953 3300005545 Bacteria 5007
76 Ga0070695_100092957 3300005545 Bacteria 2018
77 Ga0070695_100166816 3300005545 Bacteria 1550
78 Ga0070696_100013620 3300005546 Bacteria 5458
79 Ga0070696_100038658 3300005546 Bacteria 3294
80 Ga0070696_100042890 3300005546 Bacteria 3128
81 Ga0068855_100036735 3300005563 Bacteria 5828
82 Ga0070664_100020529 3300005564 Bacteria 5441
83 Ga0070664_100064227 3300005564 Bacteria 3130
84 Ga0068857_100000089 3300005577 Bacteria 52738
85 Ga0068857_100012892 3300005577 Bacteria 7283
86 Ga0068854_100134083 3300005578 Bacteria 1894
87 Ga0068856_100001425 3300005614 Bacteria 25070
88 Ga0068856_100203750 3300005614 Bacteria 1993
89 Ga0068859_100000359 3300005617 Bacteria 45467
90 Ga0068864_100146883 3300005618 Bacteria 2133
91 Ga0068861_100051883 3300005719 Bacteria 3116
92 Ga0068861_100060882 3300005719 Bacteria 2895
93 Ga0068862_100018172 3300005844 Bacteria 5853
94 Ga0081455_10000196 3300005937 Bacteria 76949
95 Ga0081455_10006281 3300005937 Bacteria 12776
96 Ga0081455_10029766 3300005937 Bacteria 4973
97 Ga0081538_10017498 3300005981 Bacteria 5437
98 Ga0081540_1000056 3300005983 Bacteria 122552
99 Ga0081540_1002874 3300005983 Bacteria 13918
100 Ga0081539_10031746 3300005985 Bacteria 3250
101 Ga0070717_10009106 3300006028 Bacteria 7456
102 Ga0075368_10001715 3300006042 Bacteria 7052
103 Ga0075368_10002797 3300006042 Bacteria 5760
104 Ga0075368_10009066 3300006042 Bacteria 3572
105 Ga0075363_100004991 3300006048 Bacteria 5871
106 Ga0075363_100012874 3300006048 Bacteria 4039
107 Ga0075364_10008364 3300006051 Bacteria 6181
108 Ga0070716_100016839 3300006173 Bacteria 3780
109 Ga0075367_10005857 3300006178 Bacteria 6158
110 Ga0075366_10036219 3300006195 Bacteria 2909
111 Ga0097621_100016750 3300006237 Bacteria 5551
112 Ga0097621_100288071 3300006237 Bacteria 1447
113 Ga0075428_100001903 3300006844 Bacteria 22395
114 Ga0075428_100003014 3300006844 Bacteria 18389
115 Ga0075428_100066490 3300006844 Bacteria 3947
116 Ga0075428_100261190 3300006844 Bacteria 1864
117 Ga0075430_100049873 3300006846 Bacteria 3532
118 Ga0075430_100158815 3300006846 Bacteria 1882
119 Ga0075430_100171043 3300006846 Bacteria 1807
120 Ga0075431_100002115 3300006847 Bacteria 18984
121 Ga0075431_100009941 3300006847 Bacteria 9555
122 Ga0075431_100053987 3300006847 Bacteria 4143
123 Ga0075431_100120163 3300006847 Bacteria 2711
124 Ga0075433_10041567 3300006852 Bacteria 3983
125 Ga0075433_10087191 3300006852 Bacteria 2756
126 Ga0075434_100002239 3300006871 Bacteria 16904
127 Ga0075434_100036917 3300006871 Bacteria 4835
128 Ga0075434_100107319 3300006871 Bacteria 2802
129 Ga0075429_100001749 3300006880 Bacteria 17988
130 Ga0075429_100005402 3300006880 Bacteria 10996
131 Ga0097620_100000359 3300006931 Bacteria 45467
132 Ga0075435_100046032 3300007076 Bacteria 3498
133 Ga0075435_100055258 3300007076 Bacteria 3206
134 Ga0075435_100092224 3300007076 Bacteria 2501
135 Ga0105240_10134055 3300009093 Bacteria 2967
136 Ga0111539_10130888 3300009094 Bacteria 2938
137 Ga0105245_10057045 3300009098 Bacteria 3512
138 Ga0105245_10076403 3300009098 Bacteria 3051
139 Ga0114129_10002553 3300009147 Bacteria 25293
140 Ga0114129_10006825 3300009147 Bacteria 16217
141 Ga0114129_10022962 3300009147 Bacteria 8850
142 Ga0114129_10035733 3300009147 Bacteria 7019
143 Ga0114129_10086255 3300009147 Bacteria 4354
144 Ga0114129_10141668 3300009147 Bacteria 3295
145 Ga0114129_10476721 3300009147 Bacteria 1633
146 Ga0114129_10482997 3300009147 Bacteria 1621
147 Ga0105243_10133888 3300009148 Bacteria 2106
148 Ga0105242_10275938 3300009176 Bacteria 1525
149 Ga0105239_10093862 3300010375 Bacteria 3314
150 Ga0157370_10022466 3300013104 Bacteria 6276
151 Ga0157370_10027015 3300013104 Bacteria 5661
152 Ga0157369_10000885 3300013105 Bacteria 38170
153 Ga0157378_10039501 3300013297 Bacteria 4186
154 Ga0157372_10205902 3300013307 Bacteria 2280
155 Ga0157375_10149356 3300013308 Bacteria 2471
156 Ga0163163_10060578 3300014325 Bacteria 3749
157 Ga0163163_10134462 3300014325 Bacteria 2513
158 Ga0157380_10068275 3300014326 Bacteria 2865
159 Ga0157379_10240377 3300014968 Bacteria 1643
160 Ga0157376_10035835 3300014969 Bacteria 4015
161 Ga0206356_11659393 3300020070 Bacteria 2184
162 Ga0206349_1874311 3300020075 Bacteria 2632
163 Ga0206350_11494152 3300020080 Bacteria 2093
164 Ga0224712_10002762 3300022467 Bacteria 4416
165 Ga0207699_10008547 3300025906 Bacteria 5062
166 Ga0207645_10088019 3300025907 Bacteria 1996
167 Ga0207705_10018482 3300025909 Bacteria 4984
168 Ga0207705_10101761 3300025909 Bacteria 2114
169 Ga0207684_10000094 3300025910 Bacteria 165810
170 Ga0207684_10007513 3300025910 Bacteria 9807
171 Ga0207684_10008255 3300025910 Bacteria 9271
172 Ga0207684_10014053 3300025910 Bacteria 6914
173 Ga0207684_10025814 3300025910 Bacteria 5007
174 Ga0207684_10031653 3300025910 Bacteria 4499
175 Ga0207684_10033547 3300025910 Bacteria 4365
176 Ga0207684_10055287 3300025910 Bacteria 3367
177 Ga0207684_10056339 3300025910 Bacteria 3334
178 Ga0207695_10035496 3300025913 Bacteria 5406
179 Ga0207693_10020258 3300025915 Bacteria 5290
180 Ga0207662_10018167 3300025918 Bacteria 3985
181 Ga0207662_10044709 3300025918 Bacteria 2615
182 Ga0207657_10014149 3300025919 Bacteria 7806
183 Ga0207652_10092166 3300025921 Bacteria 2665
184 Ga0207646_10000226 3300025922 Bacteria 77176
185 Ga0207646_10001112 3300025922 Bacteria 34320
186 Ga0207646_10002430 3300025922 Bacteria 21978
187 Ga0207646_10005370 3300025922 Bacteria 13491
188 Ga0207646_10008238 3300025922 Bacteria 10469
189 Ga0207646_10009997 3300025922 Bacteria 9320
190 Ga0207646_10014133 3300025922 Bacteria 7591
191 Ga0207646_10015008 3300025922 Bacteria 7332
192 Ga0207646_10015723 3300025922 Bacteria 7131
193 Ga0207646_10022019 3300025922 Bacteria 5880
194 Ga0207646_10029750 3300025922 Unclassified 4959
195 Ga0207646_10072332 3300025922 Bacteria 3080
196 Ga0207687_10214648 3300025927 Bacteria 1511
197 Ga0207700_10004547 3300025928 Bacteria 8197
198 Ga0207664_10003695 3300025929 Bacteria 10261
199 Ga0207664_10025835 3300025929 Bacteria 4430
200 Ga0207664_10169550 3300025929 Bacteria 1867
201 Ga0207709_10079696 3300025935 Bacteria 2106
202 Ga0207704_10143587 3300025938 Bacteria 1674
203 Ga0207665_10001602 3300025939 Bacteria 15249
204 Ga0207689_10007432 3300025942 Bacteria 9604
205 Ga0207689_10077616 3300025942 Bacteria 2730
206 Ga0207661_10000075 3300025944 Bacteria 68028
207 Ga0207679_10031068 3300025945 Bacteria 3736
208 Ga0207712_10231154 3300025961 Bacteria 1484
209 Ga0207678_10040531 3300026067 Bacteria 4039
210 Ga0207708_10094754 3300026075 Bacteria 2305
211 Ga0207702_10000358 3300026078 Bacteria 52196
212 Ga0207648_10085267 3300026089 Bacteria 2756
213 Ga0207648_10300753 3300026089 Bacteria 1439
214 Ga0207674_10000028 3300026116 Bacteria 149277
215 Ga0207675_100118032 3300026118 Bacteria 2508
216 Ga0207675_100239592 3300026118 Bacteria 1753
217 Ga0207683_10000452 3300026121 Bacteria 38068
218 Ga0209813_10000591 3300027866 Bacteria 8484
219 Ga0209813_10006241 3300027866 Bacteria 2938
220 Ga0209974_10004030 3300027876 Bacteria 5252
221 Ga0207428_10067201 3300027907 Bacteria 2822
222 Ga0268265_10003755 3300028380 Bacteria 10793
223 Ga0265319_1012568 3300028563 Bacteria 3418
224 Ga0265334_10006590 3300028573 Bacteria 4996
225 Ga0265318_10005815 3300028577 Bacteria 5750
226 Ga0265322_10019697 3300028654 Bacteria 1935
227 Ga0265338_10027132 3300028800 Bacteria 5753
228 Ga0265338_10153456 3300028800 Bacteria 1787
229 Ga0265324_10009089 3300029957 Bacteria 3899
230 Ga0265330_10000741 3300031235 Bacteria 20624
231 Ga0265330_10056607 3300031235 Bacteria 1711
232 Ga0265332_10016558 3300031238 Bacteria 3253
233 Ga0265320_10025430 3300031240 Bacteria 3111
234 Ga0265325_10002808 3300031241 Bacteria 11620
235 Ga0265325_10057112 3300031241 Bacteria 1991
236 Ga0265329_10017245 3300031242 Bacteria 2487
237 Ga0265340_10002375 3300031247 Bacteria 10712
238 Ga0265331_10013120 3300031250 Bacteria 4464
239 Ga0265316_10054944 3300031344 Bacteria 3116
240 Ga0265313_10026214 3300031595 Bacteria 3074
241 Ga0265342_10013646 3300031712 Bacteria 5436
242 Ga0316578_10028682 3300031728 Unclassified 3154
243 Ga0316577_10012858 3300031733 Unclassified 4568
244 Ga0316577_10015410 3300031733 Bacteria 4206
245 Ga0307410_10216151 3300031852 Bacteria 1472
246 Ga0307409_100114398 3300031995 Bacteria 2270
247 Ga0307411_10102710 3300032005 Bacteria 2026
248 Ga0316583_10024898 3300032133 Bacteria 2138
249 Ga0373938_0007986 3300034957 Unclassified 1879
250 Ga0373949_0018856 3300035090 Unclassified 1567
251 Ga0373951_0008412 3300035091 Bacteria 2332
252 Ga0373932_0003017 3300035112 Bacteria 4124
253 Ga0373939_0001365 3300035114 Bacteria 5910
254 Ga0373939_0020608 3300035114 Bacteria 1793
255 Ga0373954_0017113 3300035118 Bacteria 3252
256 Ga0373960_0002949 3300035121 Bacteria 3849
257 Ga0373960_0010741 3300035121 Unclassified 2243
258 Ga0373960_0019813 3300035121 Bacteria 1772
259 Ga0373955_0172224 3300035172 Bacteria 1282
260 Ga0373962_0003125 3300035242 Bacteria 3970
261 Ga0373962_0007734 3300035242 Bacteria 2636
262 Ga0373962_0024320 3300035242 Unclassified 1619
263 Ga0316574_0015172 3300035398 Bacteria 4469
264 Ga0316574_0038385 3300035398 Bacteria 2940
265 Ga0373931_0004091 3300035691 Bacteria 6616
266 Ga0373931_0166738 3300035691 Bacteria 1295
267 Ga0316582_0119543 3300036647 Bacteria 1762
268 Ga0316584_0003349 3300036712 Bacteria 10387
269 Ga0316584_0008887 3300036712 Bacteria 6946
270 Ga0316584_0079160 3300036712 Bacteria 2462
271 Ga0316584_0156175 3300036712 Bacteria 1696
272 Ga0395899_0043974 3300037312 Bacteria 3328
273 Ga0395900_0061117 3300037418 Bacteria 3875
274 Ga0395900_0168179 3300037418 Bacteria 2233
275 Ga0395900_0193574 3300037418 Bacteria 2061
276 Ga0395898_0003896 3300037466 Bacteria 16479
277 Ga0395898_0134734 3300037466 Bacteria 2365
278 Ga0395905_0050133 3300037471 Bacteria 3912
279 Ga0316581_0004218 3300037588 Bacteria 3649
280 Ga0395901_0086592 3300038443 Bacteria 3276
281 Ga0395901_0149808 3300038443 Bacteria 2452
282 Ga0395901_0243069 3300038443 Bacteria 1877
283 Ga0395901_0377533 3300038443 Bacteria 1459
284 Ga0400489_53443 3300039093 Bacteria 4536
285 Ga0439441_011606 3300042001 Bacteria 1497
286 Ga0450923_000337 3300042125 Bacteria 4838
287 Ga0466965_0011130 3300044683 Bacteria 4209
288 Ga0466966_0001968 3300044684 Bacteria 13313
289 Ga0466961_0067549 3300044693 Bacteria 2271
290 Ga0466963_0003241 3300044694 Bacteria 9269
291 Ga0466964_0009224 3300044706 Bacteria 3710
292 Ga0453684_0015212 3300044712 Bacteria 12205
293 Ga0453684_0021843 3300044712 Bacteria 9531
294 Ga0466968_0001117 3300044735 Bacteria 9507
295 Ga0466960_0004012 3300044901 Bacteria 5722
296 Ga0451576_0274479 3300045051 Unclassified 1762
297 Ga0466958_0008546 3300045836 Bacteria 5684
298 Ga0466967_0000125 3300045976 Bacteria 29126
299 Ga0466967_0011392 3300045976 Bacteria 6733
300 Ga0466967_0136025 3300045976 Bacteria 2285
301 Ga0495629_0042277 3300046459 Bacteria 3203
302 Ga0495651_0026677 3300046462 Bacteria 4499
303 Ga0495608_0155946 3300046511 Bacteria 1453
304 Ga0495587_0016840 3300046536 Unclassified 4546
305 Ga0495625_0134267 3300046660 Bacteria 1674
306 Ga0495599_0035540 3300046678 Unclassified 3128
307 Ga0495670_0071809 3300046691 Bacteria 1753
308 Ga0495581_0076486 3300047315 Bacteria 1937
309 Ga0495674_0050061 3300047319 Bacteria 3687
310 Ga0496101_0003924 3300048904 Bacteria 9296
311 Ga0496101_0083956 3300048904 Bacteria 2358
312 Ga0496102_0030583 3300048905 Bacteria 4820
313 Ga0496102_0298381 3300048905 Bacteria 1519
314 Ga0496102_0306342 3300048905 Bacteria 1497
315 Ga0496103_0103871 3300048906 Bacteria 1800
316 Ga0496104_0002115 3300048907 Bacteria 17246
317 Ga0496104_0002555 3300048907 Bacteria 15684
318 Ga0496104_0070127 3300048907 Bacteria 3332
319 Ga0496104_0426123 3300048907 Bacteria 1239
320 Ga0496105_0010897 3300048908 Bacteria 7161
321 Ga0496107_0038317 3300048910 Bacteria 3439
322 Ga0496107_0145266 3300048910 Unclassified 1754
323 Ga0496108_0164645 3300048911 Unclassified 1917
324 Ga0496109_0004628 3300048912 Bacteria 11488
325 Ga0496109_0093472 3300048912 Bacteria 2783
326 Ga0496110_0000108 3300048913 Bacteria 45034
327 Ga0496110_0001381 3300048913 Bacteria 17508
328 Ga0496110_0005319 3300048913 Bacteria 10080
329 Ga0496110_0019549 3300048913 Bacteria 5703
330 Ga0496110_0039773 3300048913 Bacteria 4096
331 Ga0496110_0288859 3300048913 Bacteria 1493
332 Ga0496111_0032817 3300048914 Bacteria 3702
333 Ga0496111_0096172 3300048914 Bacteria 2174
334 Ga0496112_0008647 3300048915 Bacteria 9129
335 Ga0496112_0086538 3300048915 Bacteria 3101
336 Ga0496113_0130016 3300048916 Unclassified 1975
337 Ga0496113_0133699 3300048916 Bacteria 1948
338 Ga0496113_0137170 3300048916 Bacteria 1923
339 Ga0496114_0006027 3300048917 Bacteria 9539
340 Ga0496114_0015545 3300048917 Bacteria 6118
341 Ga0496114_0060887 3300048917 Bacteria 3156
342 Ga0496115_0022938 3300048918 Bacteria 4840
343 Ga0496115_0041051 3300048918 Bacteria 3680
344 Ga0496115_0141163 3300048918 Bacteria 1987
345 Ga0496115_0249883 3300048918 Bacteria 1460
346 Ga0496124_0042775 3300048927 Bacteria 3898
347 Ga0501031_0002242 3300049568 Bacteria 12233
348 Ga0501031_0006172 3300049568 Bacteria 7824
349 Ga0501031_0025781 3300049568 Bacteria 3835
350 Ga0501031_0043417 3300049568 Bacteria 2934
351 Ga0501032_0153763 3300049569 Bacteria 1512
352 Ga0501033_0014438 3300049570 Bacteria 5998
353 Ga0501033_0143162 3300049570 Bacteria 1728
354 Ga0501034_0026948 3300049571 Bacteria 5847
355 Ga0501036_0005554 3300049572 Bacteria 10228
356 Ga0501036_0013480 3300049572 Bacteria 6794
357 Ga0501036_0071941 3300049572 Bacteria 2923
358 Ga0501037_0000848 3300049573 Bacteria 22775
359 Ga0501037_0033801 3300049573 Bacteria 3776
360 Ga0501038_0003742 3300049574 Bacteria 14166
361 Ga0501038_0029469 3300049574 Bacteria 4862
362 Ga0501038_0270099 3300049574 Bacteria 1341
363 Ga0501039_0006488 3300049575 Bacteria 8895
364 Ga0501039_0007446 3300049575 Bacteria 8354
365 Ga0501039_0014591 3300049575 Bacteria 6016
366 Ga0501039_0261311 3300049575 Bacteria 1361
367 Ga0501040_0001378 3300049576 Bacteria 15334
368 Ga0501040_0025268 3300049576 Bacteria 3993
369 Ga0501040_0172344 3300049576 Bacteria 1532
370 Ga0501041_0020752 3300049577 Bacteria 3930
371 Ga0501041_0021125 3300049577 Bacteria 3900
372 Ga0501041_0121622 3300049577 Bacteria 1623
373 Ga0501042_0003864 3300049578 Bacteria 9471
374 Ga0501042_0100317 3300049578 Bacteria 2082
375 Ga0501043_0110795 3300049579 Bacteria 2155
376 Ga0501046_0000023 3300049580 Bacteria 213965
377 Ga0501046_0002845 3300049580 Bacteria 16103
378 Ga0501046_0013738 3300049580 Bacteria 6846
379 Ga0501046_0024254 3300049580 Bacteria 4979
380 Ga0501046_0084219 3300049580 Bacteria 2453
381 Ga0501046_0097530 3300049580 Bacteria 2258
382 Ga0501047_0013719 3300049581 Bacteria 7693
383 Ga0501047_0223571 3300049581 Bacteria 1738
384 Ga0501048_0001937 3300049582 Bacteria 15713
385 Ga0501048_0007649 3300049582 Bacteria 8191
386 Ga0501048_0016040 3300049582 Bacteria 5524
387 Ga0501048_0070822 3300049582 Bacteria 2462
388 Ga0501067_0003672 3300049583 Bacteria 8458
389 Ga0501067_0006549 3300049583 Bacteria 6455
390 Ga0501067_0026248 3300049583 Bacteria 3227
391 Ga0501067_0045634 3300049583 Bacteria 2432
392 Ga0501068_0005848 3300049584 Bacteria 6748
393 Ga0501068_0025493 3300049584 Bacteria 3478
394 Ga0501068_0071744 3300049584 Bacteria 2114
395 Ga0501068_0119387 3300049584 Bacteria 1643
396 Ga0501069_0032195 3300049585 Bacteria 2885
397 Ga0501070_0009543 3300049586 Bacteria 8199
398 Ga0501070_0019036 3300049586 Bacteria 5758
399 Ga0501070_0045608 3300049586 Bacteria 3646
400 Ga0501070_0111342 3300049586 Bacteria 2263
401 Ga0501071_0003811 3300049587 Bacteria 9482
402 Ga0501071_0012543 3300049587 Bacteria 5751
403 Ga0501071_0012769 3300049587 Bacteria 5710
404 Ga0501072_0006147 3300049588 Bacteria 9153
405 Ga0501072_0012273 3300049588 Bacteria 6546
406 Ga0501072_0027721 3300049588 Bacteria 4418
407 Ga0501072_0131273 3300049588 Bacteria 1996
408 Ga0501072_0170952 3300049588 Bacteria 1734
409 Ga0501073_0051326 3300049589 Bacteria 2889
410 Ga0501073_0096794 3300049589 Bacteria 2050
411 Ga0501074_0013027 3300049590 Bacteria 6046
412 Ga0501074_0013301 3300049590 Bacteria 5983
413 Ga0501074_0122436 3300049590 Bacteria 1860
414 Ga0501074_0148502 3300049590 Bacteria 1676
415 Ga0501074_0153803 3300049590 Bacteria 1644
416 Ga0501075_0003381 3300049591 Bacteria 10677
417 Ga0501075_0009449 3300049591 Bacteria 6821
418 Ga0501075_0049380 3300049591 Bacteria 3162
419 Ga0501075_0060323 3300049591 Bacteria 2858
420 Ga0501075_0106034 3300049591 Bacteria 2136
421 Ga0501075_0243894 3300049591 Bacteria 1370
422 Ga0501076_0000792 3300049592 Bacteria 20438
423 Ga0501076_0004105 3300049592 Bacteria 10291
424 Ga0501076_0112789 3300049592 Bacteria 2199
425 Ga0501077_0010544 3300049593 Bacteria 5754
426 Ga0501077_0148458 3300049593 Bacteria 1487
427 Ga0501079_0008846 3300049741 Bacteria 7626
428 Ga0501079_0009858 3300049741 Bacteria 7248
429 Ga0501079_0030513 3300049741 Bacteria 4142
430 Ga0501079_0056972 3300049741 Bacteria 3015
431 Ga0501080_0002612 3300049742 Bacteria 15777
432 Ga0501080_0029181 3300049742 Bacteria 5135
433 Ga0501080_0032994 3300049742 Bacteria 4831
434 Ga0501080_0055489 3300049742 Bacteria 3690
435 Ga0501080_0233506 3300049742 Bacteria 1681
436 Ga0501081_0006668 3300049743 Bacteria 7507
437 Ga0501081_0009495 3300049743 Bacteria 6343
438 Ga0501081_0058109 3300049743 Bacteria 2676
439 Ga0501081_0090869 3300049743 Bacteria 2147
440 Ga0501083_0000692 3300049744 Bacteria 21968
441 Ga0501083_0001167 3300049744 Bacteria 17690
442 Ga0501083_0020381 3300049744 Bacteria 4613
443 Ga0501083_0056103 3300049744 Bacteria 2640
444 Ga0501035_0015329 3300049822 Bacteria 7074
445 Ga0501035_0088597 3300049822 Bacteria 2727
446 Ga0501035_0133823 3300049822 Bacteria 2160
447 Ga0501035_0151490 3300049822 Bacteria 2012
448 Ga0501044_0005759 3300049823 Bacteria 13712
449 Ga0501044_0197523 3300049823 Bacteria 1971
450 Ga0501045_0007006 3300049824 Bacteria 7818
451 Ga0501045_0038659 3300049824 Bacteria 3472
452 Ga0501045_0046634 3300049824 Bacteria 3156
453 Ga0501045_0112824 3300049824 Bacteria 2016
454 Ga0501045_0141575 3300049824 Bacteria 1788
455 nmdc:mga03n38_2502_c1 3300050490 Bacteria 5689
456 nmdc:mga00v17_240193_c1 3300050491 Bacteria 1174
457 nmdc:mga06z11_1812_c1 3300050494 Bacteria 8048
458 nmdc:mga06z11_6575_c1 3300050494 Bacteria 4744
459 nmdc:mga06z11_68089_c1 3300050494 Bacteria 1876
460 nmdc:mga04h51_613_c1 3300050495 Bacteria 8493
461 nmdc:mga04h51_7745_c1 3300050495 Bacteria 2847
462 nmdc:mga05p37_154186_c1 3300050507 Bacteria 2808
463 nmdc:mga05p37_159313_c1 3300050507 Bacteria 2757
464 nmdc:mga05p37_236989_c1 3300050507 Bacteria 2196
465 nmdc:mga05p37_38723_c1 3300050507 Bacteria 5849
466 nmdc:mga05p37_43790_c1 3300050507 Bacteria 5507
467 nmdc:mga05p37_6345_c1 3300050507 Bacteria 13929
468 nmdc:mga05p37_7053_c1 3300050507 Bacteria 13245
469 nmdc:mga05p37_8473_c1 3300050507 Bacteria 12155
470 nmdc:mga09592_6336_c1 3300050508 Bacteria 9643
471 nmdc:mga09592_77655_c1 3300050508 Bacteria 2825
472 nmdc:mga0qj67_11097_c1 3300050509 Bacteria 6747
473 nmdc:mga0qj67_130060_c1 3300050509 Bacteria 2039
474 nmdc:mga0qj67_157233_c1 3300050509 Bacteria 1845
475 nmdc:mga06r32_24778_c1 3300050510 Bacteria 5575
476 nmdc:mga06r32_6811_c1 3300050510 Bacteria 10272
477 nmdc:mga06r32_74156_c1 3300050510 Bacteria 3298
478 nmdc:mga08y16_29464_c1 3300050511 Bacteria 5783
479 nmdc:mga0n895_1633_c1 3300050512 Bacteria 16940
480 nmdc:mga0n895_6152_c1 3300050512 Bacteria 10142
481 nmdc:mga0rr50_23088_c1 3300050513 Bacteria 4282
482 Ga0495619_0066751 3300053085 Bacteria 2401
483 Ga0500568_0002527 3300053139 Bacteria 10693
484 Ga0500616_0015958 3300053153 Bacteria 4286
485 Ga0500637_0102906 3300053178 Bacteria 1656
486 Ga0501084_0002970 3300054114 Bacteria 13735
487 Ga0501084_0005254 3300054114 Bacteria 10596
488 Ga0501084_0034488 3300054114 Bacteria 4232
489 Ga0501084_0068651 3300054114 Bacteria 2967
490 Ga0501084_0178689 3300054114 Bacteria 1791
491 Ga0501082_0017909 3300060353 Bacteria 6102
492 Ga0501082_0063040 3300060353 Bacteria 3192
493 Ga0501082_0093363 3300060353 Bacteria 2600
494 Ga0501082_0239194 3300060353 Bacteria 1580
495 Ga0530510_0008092 3300061734 Bacteria 7330
496 Ga0530510_0009583 3300061734 Bacteria 6792
497 Ga0530510_0036392 3300061734 Bacteria 3548
498 Ga0530510_0091254 3300061734 Bacteria 2222
499 Ga0530510_0174308 3300061734 Bacteria 1594
500 8004023052 8004021418 Bacteria 4313954
501 8004028651 8004025490 Bacteria 4327753
502 Ga0501079_0207530
503 rootH1_10034942
504 Ga0070658_10009916
505 Ga0070676_10090885
506 Ga0070683_100000272
507 Ga0070690_100117373
508 Ga0068869_100000577
509 Ga0068869_100204218
510 Ga0070682_100024980
511 Ga0070691_10000263
512 Ga0070691_10029813
513 Ga0070691_10045563
514 Ga0070687_100010018
515 Ga0070692_10029495
516 Ga0070688_100061927
517 Ga0070714_100008339
518 Ga0070714_100219719
519 Ga0070713_100052558
520 Ga0070713_100203746
521 Ga0070700_100074926
522 Ga0070700_100175709
523 Ga0070694_100000615
524 Ga0070708_100008184
525 Ga0070708_100013352
526 Ga0070708_100014254
527 Ga0070708_100040375
528 Ga0070708_100042634
529 Ga0070708_100042873
530 Ga0070708_100167260
531 Ga0070708_100173236
532 Ga0070708_100237815
533 Ga0070708_100310900
534 Ga0070663_100102141
535 Ga0070678_100002842
536 Ga0070706_100003103
537 Ga0070706_100005416
538 Ga0070706_100020923
539 Ga0070706_100040954
540 Ga0070706_100057406
541 Ga0070706_100072778
542 Ga0070706_100103470
543 Ga0070706_100139597
544 Ga0070707_100005148
545 Ga0070707_100009476
546 Ga0070707_100012356
547 Ga0070707_100020992
548 Ga0070707_100033518
549 Ga0070707_100046844
550 Ga0070707_100065786
551 Ga0070707_100079322
552 Ga0070707_100141171
553 Ga0070698_100000439
554 Ga0070698_100027103
555 Ga0070698_100028822
556 Ga0070698_100119959
557 Ga0070698_100138118
558 Ga0070698_100153435
559 Ga0070698_100238934
560 Ga0070698_100251799
561 Ga0070699_100026231
562 Ga0070699_100036883
563 Ga0070699_100065817
564 Ga0070684_100000133
565 Ga0070684_100155171
566 Ga0070697_100009001
567 Ga0070697_100042390
568 Ga0070697_100061637
569 Ga0070697_100116931
570 Ga0070697_100168567
571 Ga0070686_100042915
572 Ga0070686_100070440
573 Ga0070695_100010313
574 Ga0070695_100012047
575 Ga0070695_100012953
576 Ga0070695_100092957
577 Ga0070695_100166816
578 Ga0070696_100013620
579 Ga0070696_100038658
580 Ga0070696_100042890
581 Ga0068855_100036735
582 Ga0070664_100020529
583 Ga0070664_100064227
584 Ga0068857_100000089
585 Ga0068857_100012892
586 Ga0068854_100134083
587 Ga0068856_100001425
588 Ga0068856_100203750
589 Ga0068859_100000359
590 Ga0068864_100146883
591 Ga0068861_100051883
592 Ga0068861_100060882
593 Ga0068862_100018172
594 Ga0081455_10000196
595 Ga0081455_10006281
596 Ga0081455_10029766
597 Ga0081538_10017498
598 Ga0081540_1000056
599 Ga0081540_1002874
600 Ga0081539_10031746
601 Ga0070717_10009106
602 Ga0075368_10001715
603 Ga0075368_10002797
604 Ga0075368_10009066
605 Ga0075363_100004991
606 Ga0075363_100012874
607 Ga0075364_10008364
608 Ga0070716_100016839
609 Ga0075367_10005857
610 Ga0075366_10036219
611 Ga0097621_100016750
612 Ga0097621_100288071
613 Ga0075428_100001903
614 Ga0075428_100003014
615 Ga0075428_100066490
616 Ga0075428_100261190
617 Ga0075430_100049873
618 Ga0075430_100158815
619 Ga0075430_100171043
620 Ga0075431_100002115
621 Ga0075431_100009941
622 Ga0075431_100053987
623 Ga0075431_100120163
624 Ga0075433_10041567
625 Ga0075433_10087191
626 Ga0075434_100002239
627 Ga0075434_100036917
628 Ga0075434_100107319
629 Ga0075429_100001749
630 Ga0075429_100005402
631 Ga0097620_100000359
632 Ga0075435_100046032
633 Ga0075435_100055258
634 Ga0075435_100092224
635 Ga0105240_10134055
636 Ga0111539_10130888
637 Ga0105245_10057045
638 Ga0105245_10076403
639 Ga0114129_10002553
640 Ga0114129_10006825
641 Ga0114129_10022962
642 Ga0114129_10035733
643 Ga0114129_10086255
644 Ga0114129_10141668
645 Ga0114129_10476721
646 Ga0114129_10482997
647 Ga0105243_10133888
648 Ga0105242_10275938
649 Ga0105239_10093862
650 Ga0157370_10022466
651 Ga0157370_10027015
652 Ga0157369_10000885
653 Ga0157378_10039501
654 Ga0157372_10205902
655 Ga0157375_10149356
656 Ga0163163_10060578
657 Ga0163163_10134462
658 Ga0157380_10068275
659 Ga0157379_10240377
660 Ga0157376_10035835
661 Ga0206356_11659393
662 Ga0206349_1874311
663 Ga0206350_11494152
664 Ga0224712_10002762
665 Ga0207699_10008547
666 Ga0207645_10088019
667 Ga0207705_10018482
668 Ga0207705_10101761
669 Ga0207684_10000094
670 Ga0207684_10007513
671 Ga0207684_10008255
672 Ga0207684_10014053
673 Ga0207684_10025814
674 Ga0207684_10031653
675 Ga0207684_10033547
676 Ga0207684_10055287
677 Ga0207684_10056339
678 Ga0207695_10035496
679 Ga0207693_10020258
680 Ga0207662_10018167
681 Ga0207662_10044709
682 Ga0207657_10014149
683 Ga0207652_10092166
684 Ga0207646_10000226
685 Ga0207646_10001112
686 Ga0207646_10002430
687 Ga0207646_10005370
688 Ga0207646_10008238
689 Ga0207646_10009997
690 Ga0207646_10014133
691 Ga0207646_10015008
692 Ga0207646_10015723
693 Ga0207646_10022019
694 Ga0207646_10029750
695 Ga0207646_10072332
696 Ga0207687_10214648
697 Ga0207700_10004547
698 Ga0207664_10003695
699 Ga0207664_10025835
700 Ga0207664_10169550
701 Ga0207709_10079696
702 Ga0207704_10143587
703 Ga0207665_10001602
704 Ga0207689_10007432
705 Ga0207689_10077616
706 Ga0207661_10000075
707 Ga0207679_10031068
708 Ga0207712_10231154
709 Ga0207678_10040531
710 Ga0207708_10094754
711 Ga0207702_10000358
712 Ga0207648_10085267
713 Ga0207648_10300753
714 Ga0207674_10000028
715 Ga0207675_100118032
716 Ga0207675_100239592
717 Ga0207683_10000452
718 Ga0209813_10000591
719 Ga0209813_10006241
720 Ga0209974_10004030
721 Ga0207428_10067201
722 Ga0268265_10003755
723 Ga0265319_1012568
724 Ga0265334_10006590
725 Ga0265318_10005815
726 Ga0265322_10019697
727 Ga0265338_10027132
728 Ga0265338_10153456
729 Ga0265324_10009089
730 Ga0265330_10000741
731 Ga0265330_10056607
732 Ga0265332_10016558
733 Ga0265320_10025430
734 Ga0265325_10002808
735 Ga0265325_10057112
736 Ga0265329_10017245
737 Ga0265340_10002375
738 Ga0265331_10013120
739 Ga0265316_10054944
740 Ga0265313_10026214
741 Ga0265342_10013646
742 Ga0316578_10028682
743 Ga0316577_10012858
744 Ga0316577_10015410
745 Ga0307410_10216151
746 Ga0307409_100114398
747 Ga0307411_10102710
748 Ga0316583_10024898
749 Ga0373938_0007986
750 Ga0373949_0018856
751 Ga0373951_0008412
752 Ga0373932_0003017
753 Ga0373939_0001365
754 Ga0373939_0020608
755 Ga0373954_0017113
756 Ga0373960_0002949
757 Ga0373960_0010741
758 Ga0373960_0019813
759 Ga0373955_0172224
760 Ga0373962_0003125
761 Ga0373962_0007734
762 Ga0373962_0024320
763 Ga0316574_0015172
764 Ga0316574_0038385
765 Ga0373931_0004091
766 Ga0373931_0166738
767 Ga0316582_0119543
768 Ga0316584_0003349
769 Ga0316584_0008887
770 Ga0316584_0079160
771 Ga0316584_0156175
772 Ga0395899_0043974
773 Ga0395900_0061117
774 Ga0395900_0168179
775 Ga0395900_0193574
776 Ga0395898_0003896
777 Ga0395898_0134734
778 Ga0395905_0050133
779 Ga0316581_0004218
780 Ga0395901_0086592
781 Ga0395901_0149808
782 Ga0395901_0243069
783 Ga0395901_0377533
784 Ga0400489_53443
785 Ga0439441_011606
786 Ga0450923_000337
787 Ga0466965_0011130
788 Ga0466966_0001968
789 Ga0466961_0067549
790 Ga0466963_0003241
791 Ga0466964_0009224
792 Ga0453684_0015212
793 Ga0453684_0021843
794 Ga0466968_0001117
795 Ga0466960_0004012
796 Ga0451576_0274479
797 Ga0466958_0008546
798 Ga0466967_0000125
799 Ga0466967_0011392
800 Ga0466967_0136025
801 Ga0495629_0042277
802 Ga0495651_0026677
803 Ga0495608_0155946
804 Ga0495587_0016840
805 Ga0495625_0134267
806 Ga0495599_0035540
807 Ga0495670_0071809
808 Ga0495581_0076486
809 Ga0495674_0050061
810 Ga0496101_0003924
811 Ga0496101_0083956
812 Ga0496102_0030583
813 Ga0496102_0298381
814 Ga0496102_0306342
815 Ga0496103_0103871
816 Ga0496104_0002115
817 Ga0496104_0002555
818 Ga0496104_0070127
819 Ga0496104_0426123
820 Ga0496105_0010897
821 Ga0496107_0038317
822 Ga0496107_0145266
823 Ga0496108_0164645
824 Ga0496109_0004628
825 Ga0496109_0093472
826 Ga0496110_0000108
827 Ga0496110_0001381
828 Ga0496110_0005319
829 Ga0496110_0019549
830 Ga0496110_0039773
831 Ga0496110_0288859
832 Ga0496111_0032817
833 Ga0496111_0096172
834 Ga0496112_0008647
835 Ga0496112_0086538
836 Ga0496113_0130016
837 Ga0496113_0133699
838 Ga0496113_0137170
839 Ga0496114_0006027
840 Ga0496114_0015545
841 Ga0496114_0060887
842 Ga0496115_0022938
843 Ga0496115_0041051
844 Ga0496115_0141163
845 Ga0496115_0249883
846 Ga0496124_0042775
847 Ga0501031_0002242
848 Ga0501031_0006172
849 Ga0501031_0025781
850 Ga0501031_0043417
851 Ga0501032_0153763
852 Ga0501033_0014438
853 Ga0501033_0143162
854 Ga0501034_0026948
855 Ga0501036_0005554
856 Ga0501036_0013480
857 Ga0501036_0071941
858 Ga0501037_0000848
859 Ga0501037_0033801
860 Ga0501038_0003742
861 Ga0501038_0029469
862 Ga0501038_0270099
863 Ga0501039_0006488
864 Ga0501039_0007446
865 Ga0501039_0014591
866 Ga0501039_0261311
867 Ga0501040_0001378
868 Ga0501040_0025268
869 Ga0501040_0172344
870 Ga0501041_0020752
871 Ga0501041_0021125
872 Ga0501041_0121622
873 Ga0501042_0003864
874 Ga0501042_0100317
875 Ga0501043_0110795
876 Ga0501046_0000023
877 Ga0501046_0002845
878 Ga0501046_0013738
879 Ga0501046_0024254
880 Ga0501046_0084219
881 Ga0501046_0097530
882 Ga0501047_0013719
883 Ga0501047_0223571
884 Ga0501048_0001937
885 Ga0501048_0007649
886 Ga0501048_0016040
887 Ga0501048_0070822
888 Ga0501067_0003672
889 Ga0501067_0006549
890 Ga0501067_0026248
891 Ga0501067_0045634
892 Ga0501068_0005848
893 Ga0501068_0025493
894 Ga0501068_0071744
895 Ga0501068_0119387
896 Ga0501069_0032195
897 Ga0501070_0009543
898 Ga0501070_0019036
899 Ga0501070_0045608
900 Ga0501070_0111342
901 Ga0501071_0003811
902 Ga0501071_0012543
903 Ga0501071_0012769
904 Ga0501072_0006147
905 Ga0501072_0012273
906 Ga0501072_0027721
907 Ga0501072_0131273
908 Ga0501072_0170952
909 Ga0501073_0051326
910 Ga0501073_0096794
911 Ga0501074_0013027
912 Ga0501074_0013301
913 Ga0501074_0122436
914 Ga0501074_0148502
915 Ga0501074_0153803
916 Ga0501075_0003381
917 Ga0501075_0009449
918 Ga0501075_0049380
919 Ga0501075_0060323
920 Ga0501075_0106034
921 Ga0501075_0243894
922 Ga0501076_0000792
923 Ga0501076_0004105
924 Ga0501076_0112789
925 Ga0501077_0010544
926 Ga0501077_0148458
927 Ga0501079_0008846
928 Ga0501079_0009858
929 Ga0501079_0030513
930 Ga0501079_0056972
931 Ga0501080_0002612
932 Ga0501080_0029181
933 Ga0501080_0032994
934 Ga0501080_0055489
935 Ga0501080_0233506
936 Ga0501081_0006668
937 Ga0501081_0009495
938 Ga0501081_0058109
939 Ga0501081_0090869
940 Ga0501083_0000692
941 Ga0501083_0001167
942 Ga0501083_0020381
943 Ga0501083_0056103
944 Ga0501035_0015329
945 Ga0501035_0088597
946 Ga0501035_0133823
947 Ga0501035_0151490
948 Ga0501044_0005759
949 Ga0501044_0197523
950 Ga0501045_0007006
951 Ga0501045_0038659
952 Ga0501045_0046634
953 Ga0501045_0112824
954 Ga0501045_0141575
955 nmdc:mga03n38_2502_c1
956 nmdc:mga00v17_240193_c1
957 nmdc:mga06z11_1812_c1
958 nmdc:mga06z11_6575_c1
959 nmdc:mga06z11_68089_c1
960 nmdc:mga04h51_613_c1
961 nmdc:mga04h51_7745_c1
962 nmdc:mga05p37_154186_c1
963 nmdc:mga05p37_159313_c1
964 nmdc:mga05p37_236989_c1
965 nmdc:mga05p37_38723_c1
966 nmdc:mga05p37_43790_c1
967 nmdc:mga05p37_6345_c1
968 nmdc:mga05p37_7053_c1
969 nmdc:mga05p37_8473_c1
970 nmdc:mga09592_6336_c1
971 nmdc:mga09592_77655_c1
972 nmdc:mga0qj67_11097_c1
973 nmdc:mga0qj67_130060_c1
974 nmdc:mga0qj67_157233_c1
975 nmdc:mga06r32_24778_c1
976 nmdc:mga06r32_6811_c1
977 nmdc:mga06r32_74156_c1
978 nmdc:mga08y16_29464_c1
979 nmdc:mga0n895_1633_c1
980 nmdc:mga0n895_6152_c1
981 nmdc:mga0rr50_23088_c1
982 Ga0495619_0066751
983 Ga0500568_0002527
984 Ga0500616_0015958
985 Ga0500637_0102906
986 Ga0501084_0002970
987 Ga0501084_0005254
988 Ga0501084_0034488
989 Ga0501084_0068651
990 Ga0501084_0178689
991 Ga0501082_0017909
992 Ga0501082_0063040
993 Ga0501082_0093363
994 Ga0501082_0239194
995 Ga0530510_0008092
996 Ga0530510_0009583
997 Ga0530510_0036392
998 Ga0530510_0091254
999 Ga0530510_0174308
1000 8004023052
1001 8004028651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02801

Ketoacyl-synt_C

Beta-ketoacyl synthase, C-terminal domain

275

390

0.97

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

19

267

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6olt-assembly1.cif.gz_A crosslinked crystal structure of type ii fatty acid synthase ketosynthase, fabf, and c12-crypto acyl carrier protein, acpp 0.9627 2 384
4r8e-assembly1.cif.gz_B crystal structure of beta-ketoacyl-acp synthase ii (fabf) from yersinia pestis 0.9612 1 383
2alm-assembly1.cif.gz_A-2 crystal structure analysis of a mutant beta-ketoacyl-[acyl carrier protein] synthase ii from streptococcus pneumoniae 0.96 1 384
2gqd-assembly1.cif.gz_B the crystal structure of b-ketoacyl-acp synthase ii (fabf) from staphylococcus aureus 0.9596 1 384
1j3n-assembly1.cif.gz_A crystal structure of 3-oxoacyl-(acyl-carrier protein) synthase ii from thermus thermophilus hb8 0.9594 1 384
ID Description Score Start End Superfamily
af_C6KT99_32_472_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9661 2 384 3.40.47.10
af_P0AAI5_1_413_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9625 2 384 3.40.47.10
af_C6KT99_32_472_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9612 2 384 3.40.47.10
af_I1K678_47_489_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.959 3 383 3.40.47.10
af_P0AAI5_1_413_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9576 2 384 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A238DIG9-F1-model_v4 deleted 0.9725 1 383
AF-A0A530L7T1-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.971 128 247 GO:0004315
GO:0005829
GO:0006633
AF-R1F3A0-F1-model_v4 Nodulation protein E (EC 2.3.1.41) (Host-specificity of nodulation protein B) 0.9701 77 384 GO:0004315
GO:0006633
AF-A0A3C0C8G7-F1-model_v4 Beta-ketoacyl-ACP synthase II (EC 2.3.1.179) 0.9683 47 384 GO:0004315
GO:0005829
GO:0006633
AF-A0A2V7KA74-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase II 0.9677 51 289 GO:0004315
GO:0005829
GO:0006633

Map