F455956

General Info

Members Datasets Scaffolds Average Seq Length
503 298 1006 128

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10301452|Ga0065704_103014521
Length 129
Sequence MKIVITSVLVDDQDKALAFYRDVLGFVLKHDIPMGGDARWLTLTSPGDADGVELLLEPDMHPAARPFKTALHADGVPATFFGVDDVQAEYERLSAAGVRFTRPPTHLGPVTIAVFDDTCGNLIQINQRH

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
72 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
144 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
145 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
150 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
171 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
172 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
173 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
174 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
177 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
178 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
179 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
180 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
181 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
247 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
248 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
271 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
274 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
281 2643221692 Nocardia sp. Root136 Isolate Unclassified
282 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
283 2721755523 Delftia sp. HK171 Isolate Unclassified
284 2765235841 Pseudomonas putida AA7 Isolate Unclassified
285 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
286 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
287 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
288 2851182111 Bosea sp. Tri-44 Isolate Nodule
289 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
290 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
291 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
292 8052494512 Pseudomonas putida LD6 Isolate Unclassified
293 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
294 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
295 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
296 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
297 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
298 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 0.4
Isolates 3.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.96
Nodule 1.19
Rhizoplane 6.56
Rhizosphere 82.31
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10301452 3300005289 Bacteria 884
2 2214583016 2209111006 Bacteria 525
3 rootH2_10054863 3300003320 Bacteria 2750
4 JGI25407J50210_10063991 3300003373 Bacteria 922
5 Ga0055536_1020453 3300003781 Bacteria 2043
6 Ga0065704_10228046 3300005289 Bacteria 1052
7 Ga0065704_10294170 3300005289 Bacteria 885
8 Ga0065707_10233332 3300005295 Bacteria 1181
9 Ga0070676_10057099 3300005328 Bacteria 2309
10 Ga0070683_100348320 3300005329 Bacteria 1411
11 Ga0068869_100895625 3300005334 Bacteria 768
12 Ga0070680_100952814 3300005336 Bacteria 741
13 Ga0070680_101073604 3300005336 Bacteria 696
14 Ga0070660_100780532 3300005339 Bacteria 803
15 Ga0070660_100823577 3300005339 Bacteria 781
16 Ga0070689_100536711 3300005340 Bacteria 1006
17 Ga0070687_100068632 3300005343 Bacteria 1896
18 Ga0070687_100713271 3300005343 Bacteria 702
19 Ga0070687_100720863 3300005343 Bacteria 699
20 Ga0070692_10039056 3300005345 Bacteria 2422
21 Ga0070669_100173803 3300005353 Bacteria 1681
22 Ga0070673_100426115 3300005364 Bacteria 1190
23 Ga0070659_100329359 3300005366 Bacteria 1278
24 Ga0070659_100583952 3300005366 Bacteria 959
25 Ga0070703_10195165 3300005406 Bacteria 791
26 Ga0070703_10475675 3300005406 Bacteria 558
27 Ga0070709_11083869 3300005434 Bacteria 640
28 Ga0070714_100599727 3300005435 Bacteria 1058
29 Ga0070713_100016351 3300005436 Bacteria 5579
30 Ga0070710_10043027 3300005437 Bacteria 2500
31 Ga0070711_100245353 3300005439 Bacteria 1402
32 Ga0070705_100390909 3300005440 Bacteria 1027
33 Ga0070705_100511376 3300005440 Bacteria 914
34 Ga0070700_100345879 3300005441 Bacteria 1101
35 Ga0070694_100066740 3300005444 Bacteria 2468
36 Ga0070694_100691657 3300005444 Bacteria 829
37 Ga0070708_100006168 3300005445 Bacteria 9533
38 Ga0070663_100646350 3300005455 Bacteria 894
39 Ga0070681_11615706 3300005458 Bacteria 574
40 Ga0068867_100660617 3300005459 Bacteria 918
41 Ga0070706_100009234 3300005467 Bacteria 9185
42 Ga0070707_100007699 3300005468 Bacteria 10003
43 Ga0070707_100345714 3300005468 Bacteria 1445
44 Ga0070698_100426537 3300005471 Bacteria 1261
45 Ga0070698_101117002 3300005471 Bacteria 737
46 Ga0070698_102181054 3300005471 Bacteria 507
47 Ga0070699_100031764 3300005518 Bacteria 4559
48 Ga0070684_100637344 3300005535 Bacteria 992
49 Ga0070697_101466202 3300005536 Bacteria 610
50 Ga0070686_100296970 3300005544 Bacteria 1197
51 Ga0070695_100118982 3300005545 Bacteria 1804
52 Ga0070695_100687509 3300005545 Bacteria 811
53 Ga0070696_100004950 3300005546 Bacteria 8892
54 Ga0070696_100751299 3300005546 Bacteria 799
55 Ga0070696_101016458 3300005546 Bacteria 693
56 Ga0070696_101630221 3300005546 Bacteria 555
57 Ga0070704_100081900 3300005549 Bacteria 2379
58 Ga0070704_100195854 3300005549 Bacteria 1627
59 Ga0070664_101210856 3300005564 Bacteria 712
60 Ga0068857_100726541 3300005577 Bacteria 945
61 Ga0068857_101055533 3300005577 Bacteria 783
62 Ga0068854_100447382 3300005578 Bacteria 1078
63 Ga0068856_100037893 3300005614 Bacteria 4731
64 Ga0068863_100267766 3300005841 Bacteria 1653
65 Ga0068860_100090865 3300005843 Bacteria 2909
66 Ga0068860_102304292 3300005843 Bacteria 559
67 Ga0068862_100172687 3300005844 Bacteria 1936
68 Ga0068862_100351801 3300005844 Bacteria 1367
69 Ga0068862_101175508 3300005844 Bacteria 765
70 Ga0081455_10043537 3300005937 Bacteria 3925
71 Ga0081455_10087341 3300005937 Bacteria 2537
72 Ga0081455_10348603 3300005937 Bacteria 1045
73 Ga0081538_10000121 3300005981 Bacteria 78856
74 Ga0081538_10002725 3300005981 Bacteria 16978
75 Ga0081538_10005620 3300005981 Bacteria 11247
76 Ga0081538_10025665 3300005981 Bacteria 4146
77 Ga0081538_10026748 3300005981 Bacteria 4024
78 Ga0081538_10101162 3300005981 Bacteria 1451
79 Ga0081540_1081442 3300005983 Bacteria 1456
80 Ga0081539_10298843 3300005985 Bacteria 693
81 Ga0070717_10367342 3300006028 Bacteria 1289
82 Ga0075365_10174244 3300006038 Bacteria 1502
83 Ga0075363_100299711 3300006048 Bacteria 933
84 Ga0075364_10269484 3300006051 Bacteria 1158
85 Ga0075364_11020398 3300006051 Bacteria 562
86 Ga0075432_10000089 3300006058 Bacteria 18821
87 Ga0075432_10074890 3300006058 Bacteria 1220
88 Ga0070712_100073156 3300006175 Bacteria 2458
89 Ga0075362_10111021 3300006177 Bacteria 1291
90 Ga0075362_10636417 3300006177 Bacteria 553
91 Ga0075367_10016087 3300006178 Bacteria 4079
92 Ga0075367_10286265 3300006178 Bacteria 1036
93 Ga0075369_10359570 3300006186 Bacteria 684
94 Ga0075427_10041532 3300006194 Bacteria 776
95 Ga0075366_10104617 3300006195 Bacteria 1701
96 Ga0075366_10664759 3300006195 Bacteria 647
97 Ga0075370_10054203 3300006353 Bacteria 2276
98 Ga0075428_100003140 3300006844 Bacteria 18043
99 Ga0075428_100020286 3300006844 Bacteria 7361
100 Ga0075428_100248912 3300006844 Bacteria 1916
101 Ga0075430_100070649 3300006846 Bacteria 2928
102 Ga0075430_100936262 3300006846 Bacteria 714
103 Ga0075431_100040254 3300006847 Bacteria 4816
104 Ga0075431_100104157 3300006847 Bacteria 2928
105 Ga0075431_100996980 3300006847 Bacteria 805
106 Ga0075433_10008941 3300006852 Bacteria 7999
107 Ga0075433_10564249 3300006852 Bacteria 1000
108 Ga0075433_10584959 3300006852 Bacteria 980
109 Ga0075433_11340479 3300006852 Bacteria 620
110 Ga0075434_100023203 3300006871 Bacteria 6045
111 Ga0075434_100052739 3300006871 Bacteria 4041
112 Ga0075434_101381977 3300006871 Bacteria 714
113 Ga0075434_101486634 3300006871 Bacteria 687
114 Ga0075434_101915757 3300006871 Bacteria 599
115 Ga0075429_100088040 3300006880 Bacteria 2706
116 Ga0075429_100088679 3300006880 Bacteria 2696
117 Ga0068865_100199960 3300006881 Bacteria 1551
118 Ga0099823_1000027 3300006944 Bacteria 69973
119 Ga0079104_1000167 3300006946 Bacteria 93750
120 Ga0075435_100007870 3300007076 Bacteria 7625
121 Ga0075435_100143677 3300007076 Bacteria 2003
122 Ga0105251_10000468 3300009011 Bacteria 38504
123 Ga0105251_10027826 3300009011 Bacteria 2860
124 Ga0105251_10088850 3300009011 Bacteria 1421
125 Ga0105244_10242081 3300009036 Bacteria 842
126 Ga0105250_10000700 3300009092 Bacteria 20825
127 Ga0105250_10141584 3300009092 Bacteria 997
128 Ga0111539_10077042 3300009094 Bacteria 3926
129 Ga0111539_11306653 3300009094 Bacteria 842
130 Ga0105245_10048422 3300009098 Bacteria 3802
131 Ga0105245_11406497 3300009098 Bacteria 748
132 Ga0114129_10006143 3300009147 Bacteria 17032
133 Ga0114129_11039810 3300009147 Bacteria 1029
134 Ga0105243_10037101 3300009148 Bacteria 3786
135 Ga0105243_10157710 3300009148 Bacteria 1953
136 Ga0105243_10273564 3300009148 Bacteria 1518
137 Ga0105243_10417466 3300009148 Bacteria 1250
138 Ga0105242_12265011 3300009176 Bacteria 589
139 Ga0105238_10162773 3300009551 Bacteria 2207
140 Ga0105238_11103726 3300009551 Bacteria 816
141 Ga0105238_12093470 3300009551 Bacteria 600
142 Ga0105249_10003751 3300009553 Bacteria 13116
143 Ga0105249_10389331 3300009553 Bacteria 1422
144 Ga0105239_10107994 3300010375 Bacteria 3083
145 Ga0105239_11637001 3300010375 Bacteria 745
146 Ga0105246_10018774 3300011119 Bacteria 4408
147 Ga0105246_10294949 3300011119 Bacteria 1306
148 Ga0157371_10000514 3300013102 Bacteria 46481
149 Ga0157370_10066534 3300013104 Bacteria 3408
150 Ga0157369_10157938 3300013105 Bacteria 2394
151 Ga0157378_10448923 3300013297 Bacteria 1279
152 Ga0163162_10107164 3300013306 Bacteria 2889
153 Ga0157372_10098403 3300013307 Bacteria 3337
154 Ga0157372_12460389 3300013307 Bacteria 598
155 Ga0157375_10748115 3300013308 Bacteria 1129
156 Ga0157375_11426246 3300013308 Bacteria 816
157 Ga0163163_10304217 3300014325 Bacteria 1647
158 Ga0163163_10630406 3300014325 Bacteria 1135
159 Ga0163163_11084987 3300014325 Bacteria 863
160 Ga0157380_11253122 3300014326 Bacteria 787
161 Ga0157380_12695558 3300014326 Bacteria 563
162 Ga0182008_10208763 3300014497 Bacteria 996
163 Ga0157377_11333776 3300014745 Bacteria 562
164 Ga0157379_10082724 3300014968 Bacteria 2877
165 Ga0157379_10682736 3300014968 Bacteria 963
166 Ga0157379_12378108 3300014968 Bacteria 528
167 Ga0157376_10534499 3300014969 Bacteria 1158
168 Ga0157376_11245488 3300014969 Bacteria 773
169 Ga0163161_10042241 3300017792 Bacteria 3279
170 Ga0163161_10109698 3300017792 Bacteria 2062
171 Ga0206354_11432042 3300020081 Bacteria 763
172 Ga0209676_1001013 3300025292 Bacteria 32853
173 Ga0209025_1000658 3300025294 Bacteria 59891
174 Ga0207696_1005414 3300025711 Bacteria 5300
175 Ga0207696_1023888 3300025711 Bacteria 1923
176 Ga0207655_1000027 3300025728 Bacteria 444552
177 Ga0207713_1023926 3300025735 Bacteria 2861
178 Ga0207713_1025179 3300025735 Bacteria 2754
179 Ga0207713_1082015 3300025735 Bacteria 1157
180 Ga0207692_10025414 3300025898 Bacteria 2766
181 Ga0207692_10283302 3300025898 Bacteria 1003
182 Ga0207688_10066506 3300025901 Bacteria 2039
183 Ga0207688_10570064 3300025901 Bacteria 712
184 Ga0207647_10087841 3300025904 Bacteria 1857
185 Ga0207699_10300038 3300025906 Bacteria 1121
186 Ga0207645_10095027 3300025907 Bacteria 1919
187 Ga0207705_10805637 3300025909 Bacteria 729
188 Ga0207684_10079395 3300025910 Bacteria 2792
189 Ga0207707_10991725 3300025912 Bacteria 690
190 Ga0207695_11186860 3300025913 Bacteria 643
191 Ga0207693_10131442 3300025915 Bacteria 1968
192 Ga0207693_10215397 3300025915 Bacteria 1509
193 Ga0207662_10003558 3300025918 Bacteria 8039
194 Ga0207657_10619774 3300025919 Bacteria 843
195 Ga0207646_10059402 3300025922 Bacteria 3415
196 Ga0207694_10956512 3300025924 Bacteria 724
197 Ga0207687_10437265 3300025927 Bacteria 1083
198 Ga0207700_10012135 3300025928 Bacteria 5541
199 Ga0207664_10244523 3300025929 Bacteria 1564
200 Ga0207664_10435198 3300025929 Bacteria 1169
201 Ga0207690_10391822 3300025932 Bacteria 1106
202 Ga0207706_10154921 3300025933 Bacteria 2015
203 Ga0207686_10273605 3300025934 Bacteria 1243
204 Ga0207709_10000143 3300025935 Bacteria 99457
205 Ga0207709_10110168 3300025935 Bacteria 1839
206 Ga0207709_10504287 3300025935 Bacteria 945
207 Ga0207709_11473931 3300025935 Bacteria 564
208 Ga0207670_10449861 3300025936 Bacteria 1038
209 Ga0207669_10223888 3300025937 Bacteria 1383
210 Ga0207704_10258062 3300025938 Bacteria 1312
211 Ga0207691_11393456 3300025940 Bacteria 576
212 Ga0207661_10284502 3300025944 Bacteria 1479
213 Ga0207679_10552418 3300025945 Bacteria 1033
214 Ga0207712_10356802 3300025961 Bacteria 1217
215 Ga0207703_11444346 3300026035 Bacteria 662
216 Ga0207678_10373714 3300026067 Bacteria 1232
217 Ga0207678_10905042 3300026067 Bacteria 780
218 Ga0207708_10339083 3300026075 Bacteria 1231
219 Ga0207708_11408987 3300026075 Bacteria 612
220 Ga0207702_10008136 3300026078 Bacteria 8872
221 Ga0207641_10285863 3300026088 Bacteria 1553
222 Ga0207648_10689570 3300026089 Bacteria 946
223 Ga0207648_10802231 3300026089 Bacteria 876
224 Ga0207674_10916812 3300026116 Bacteria 844
225 Ga0207674_11229441 3300026116 Bacteria 719
226 Ga0207675_100048115 3300026118 Bacteria 3980
227 Ga0207683_10578343 3300026121 Bacteria 1039
228 Ga0209281_1000017 3300027111 Bacteria 583251
229 Ga0209389_1000118 3300027296 Bacteria 70923
230 Ga0209970_1079311 3300027614 Bacteria 615
231 Ga0207428_10003928 3300027907 Bacteria 14254
232 Ga0207428_10711107 3300027907 Bacteria 718
233 Ga0268265_10552164 3300028380 Bacteria 1094
234 Ga0268265_10750267 3300028380 Bacteria 947
235 Ga0268264_10451465 3300028381 Bacteria 1245
236 Ga0268264_11725270 3300028381 Bacteria 637
237 Ga0268256_1008178 3300030500 Bacteria 3621
238 Ga0316180_1159483 3300030736 Bacteria 579
239 Ga0307513_10012516 3300031456 Bacteria 10462
240 Ga0307408_100058443 3300031548 Bacteria 2804
241 Ga0307408_100104884 3300031548 Bacteria 2160
242 Ga0307408_101987808 3300031548 Bacteria 559
243 Ga0307516_10054467 3300031730 Bacteria 3908
244 Ga0307405_10027408 3300031731 Bacteria 3303
245 Ga0307405_10060410 3300031731 Bacteria 2392
246 Ga0307405_11314010 3300031731 Bacteria 629
247 Ga0307413_10007334 3300031824 Bacteria 5113
248 Ga0307413_10014744 3300031824 Bacteria 3982
249 Ga0307413_10020121 3300031824 Bacteria 3542
250 Ga0307413_10471972 3300031824 Bacteria 1001
251 Ga0307413_10634896 3300031824 Bacteria 879
252 Ga0307413_10710483 3300031824 Bacteria 836
253 Ga0307413_10897369 3300031824 Bacteria 753
254 Ga0307410_10000111 3300031852 Bacteria 28496
255 Ga0307410_10005365 3300031852 Bacteria 6778
256 Ga0307410_10009576 3300031852 Bacteria 5442
257 Ga0307410_10213304 3300031852 Bacteria 1480
258 Ga0307410_10549136 3300031852 Bacteria 957
259 Ga0307406_10000655 3300031901 Bacteria 19636
260 Ga0307406_10006775 3300031901 Bacteria 6336
261 Ga0307406_10023429 3300031901 Bacteria 3673
262 Ga0307406_10421199 3300031901 Bacteria 1064
263 Ga0307406_11144875 3300031901 Bacteria 673
264 Ga0307406_11638065 3300031901 Bacteria 569
265 Ga0307407_10006736 3300031903 Bacteria 5141
266 Ga0307407_10018498 3300031903 Bacteria 3525
267 Ga0307407_10020192 3300031903 Bacteria 3408
268 Ga0307407_10058179 3300031903 Bacteria 2246
269 Ga0307407_10137679 3300031903 Bacteria 1571
270 Ga0307407_10212025 3300031903 Bacteria 1305
271 Ga0307407_10883695 3300031903 Bacteria 685
272 Ga0307412_10070269 3300031911 Bacteria 2386
273 Ga0307409_100008043 3300031995 Bacteria 6361
274 Ga0307409_100117796 3300031995 Bacteria 2242
275 Ga0307409_100194515 3300031995 Bacteria 1809
276 Ga0307409_100309017 3300031995 Bacteria 1474
277 Ga0307409_100567991 3300031995 Bacteria 1116
278 Ga0307409_100767056 3300031995 Bacteria 969
279 Ga0307409_100796862 3300031995 Bacteria 952
280 Ga0307409_101071587 3300031995 Bacteria 826
281 Ga0307409_101210925 3300031995 Bacteria 779
282 Ga0307409_101271296 3300031995 Bacteria 760
283 Ga0307416_100000114 3300032002 Bacteria 48291
284 Ga0307416_100005797 3300032002 Bacteria 7657
285 Ga0307416_100025133 3300032002 Bacteria 4361
286 Ga0307416_100132320 3300032002 Bacteria 2248
287 Ga0307416_100206172 3300032002 Bacteria 1870
288 Ga0307416_101531302 3300032002 Bacteria 772
289 Ga0307414_10017803 3300032004 Bacteria 4357
290 Ga0307414_10056240 3300032004 Bacteria 2759
291 Ga0307414_10132848 3300032004 Bacteria 1935
292 Ga0307414_10601114 3300032004 Bacteria 986
293 Ga0307414_10823356 3300032004 Bacteria 848
294 Ga0307414_12232324 3300032004 Bacteria 511
295 Ga0307411_10001422 3300032005 Bacteria 9755
296 Ga0307411_10059958 3300032005 Bacteria 2524
297 Ga0307411_10361511 3300032005 Bacteria 1187
298 Ga0307411_10632082 3300032005 Bacteria 924
299 Ga0307415_100000213 3300032126 Bacteria 25468
300 Ga0307415_100031065 3300032126 Bacteria 3436
301 Ga0307415_100404482 3300032126 Bacteria 1166
302 Ga0307415_100442425 3300032126 Bacteria 1121
303 Ga0307415_101396828 3300032126 Bacteria 666
304 Ga0373931_0141771 3300035691 Bacteria 1393
305 Ga0373931_0388780 3300035691 Bacteria 881
306 Ga0395900_0994598 3300037418 Bacteria 759
307 Ga0395905_0280389 3300037471 Bacteria 1553
308 Ga0395901_0563907 3300038443 Bacteria 1153
309 Ga0395901_1026800 3300038443 Bacteria 799
310 Ga0436365_0870307 3300039437 Bacteria 1308
311 Ga0451797_0635688 3300041453 Bacteria 6452
312 Ga0451837_1529135 3300041494 Unclassified 987
313 Ga0451841_0827512 3300041498 Bacteria 546
314 Ga0451847_0187550 3300041503 Bacteria 874
315 Ga0439443_043110 3300042003 Bacteria 774
316 Ga0439448_0043733 3300042005 Bacteria 1455
317 Ga0439432_006933 3300042006 Bacteria 4031
318 Ga0439450_006355 3300042008 Bacteria 2124
319 Ga0439463_151097 3300042016 Bacteria 602
320 Ga0450900_018739 3300042136 Bacteria 951
321 Ga0450902_001142 3300042137 Bacteria 3545
322 Ga0450905_001334 3300042142 Bacteria 3133
323 Ga0439446_0006337 3300042156 Bacteria 3081
324 Ga0439459_0058436 3300042438 Bacteria 865
325 Ga0439464_0195441 3300042439 Bacteria 644
326 Ga0450901_000189 3300042533 Bacteria 7288
327 Ga0466972_0005508 3300044658 Bacteria 6342
328 Ga0466972_0086203 3300044658 Bacteria 1493
329 Ga0466965_0121774 3300044683 Bacteria 1348
330 Ga0466961_0246665 3300044693 Bacteria 1097
331 Ga0466963_0470462 3300044694 Bacteria 887
332 Ga0466968_0001608 3300044735 Bacteria 8156
333 Ga0466970_0005091 3300044765 Bacteria 6497
334 Ga0466970_0364945 3300044765 Bacteria 820
335 Ga0466957_0002829 3300044842 Bacteria 9381
336 Ga0466960_0006118 3300044901 Bacteria 4814
337 Ga0466960_0019105 3300044901 Bacteria 3014
338 Ga0466960_0026204 3300044901 Bacteria 2646
339 Ga0466960_0453944 3300044901 Bacteria 745
340 Ga0466960_1051874 3300044901 Bacteria 502
341 Ga0466959_0009295 3300045049 Bacteria 6984
342 Ga0466959_0170591 3300045049 Bacteria 1526
343 Ga0466959_0752992 3300045049 Bacteria 652
344 Ga0466958_0617508 3300045836 Bacteria 705
345 Ga0466967_0272155 3300045976 Bacteria 1623
346 Ga0466967_0649039 3300045976 Bacteria 1043
347 Ga0495584_0327717 3300046491 Bacteria 778
348 Ga0495643_0000261 3300046522 Bacteria 77011
349 Ga0495663_0136383 3300046525 Bacteria 831
350 Ga0495667_0942470 3300046559 Bacteria 528
351 Ga0495656_0369889 3300046615 Bacteria 746
352 Ga0495656_0429445 3300046615 Bacteria 694
353 Ga0495624_0939434 3300046690 Bacteria 508
354 Ga0495671_0310374 3300046692 Bacteria 758
355 Ga0495672_0002554 3300047320 Bacteria 16589
356 Ga0495672_0167156 3300047320 Bacteria 1125
357 Ga0495680_1043503 3300047322 Bacteria 520
358 Ga0496100_0184885 3300048903 Bacteria 1509
359 Ga0496101_0511531 3300048904 Bacteria 949
360 Ga0496102_0007620 3300048905 Bacteria 9250
361 Ga0496102_0202943 3300048905 Bacteria 1869
362 Ga0496103_0164332 3300048906 Bacteria 1424
363 Ga0496104_0683720 3300048907 Bacteria 934
364 Ga0496104_1157746 3300048907 Bacteria 677
365 Ga0496105_0271992 3300048908 Bacteria 1368
366 Ga0496105_0584250 3300048908 Bacteria 869
367 Ga0496106_0018632 3300048909 Bacteria 5138
368 Ga0496106_0088920 3300048909 Bacteria 2382
369 Ga0496107_0012021 3300048910 Bacteria 6036
370 Ga0496107_0158840 3300048910 Bacteria 1675
371 Ga0496108_0079136 3300048911 Bacteria 2783
372 Ga0496108_0708689 3300048911 Bacteria 872
373 Ga0496109_0056623 3300048912 Bacteria 3577
374 Ga0496109_0805119 3300048912 Bacteria 877
375 Ga0496109_1113292 3300048912 Bacteria 727
376 Ga0496109_1477921 3300048912 Bacteria 615
377 Ga0496110_0058335 3300048913 Bacteria 3400
378 Ga0496110_0403705 3300048913 Bacteria 1246
379 Ga0496110_0562210 3300048913 Bacteria 1036
380 Ga0496110_0786435 3300048913 Bacteria 856
381 Ga0496111_0083195 3300048914 Bacteria 2339
382 Ga0496111_0191578 3300048914 Bacteria 1520
383 Ga0496112_0782089 3300048915 Bacteria 880
384 Ga0496113_0480710 3300048916 Bacteria 998
385 Ga0496114_0017911 3300048917 Bacteria 5724
386 Ga0496114_0090779 3300048917 Bacteria 2593
387 Ga0496114_0207523 3300048917 Bacteria 1717
388 Ga0496114_0308194 3300048917 Bacteria 1398
389 Ga0496115_0385793 3300048918 Bacteria 1139
390 Ga0496122_0044225 3300048925 Bacteria 3479
391 Ga0496125_0004691 3300048928 Bacteria 15574
392 Ga0496126_0013249 3300048929 Bacteria 8405
393 Ga0496126_0652954 3300048929 Bacteria 823
394 Ga0501311_047293 3300049527 Bacteria 666
395 Ga0501031_0096416 3300049568 Bacteria 1930
396 Ga0501034_0000267 3300049571 Bacteria 94455
397 Ga0501036_0137496 3300049572 Bacteria 2062
398 Ga0501036_0432029 3300049572 Bacteria 1098
399 Ga0501036_0660548 3300049572 Bacteria 865
400 Ga0501038_0013540 3300049574 Bacteria 7435
401 Ga0501038_0063822 3300049574 Bacteria 3143
402 Ga0501039_0679605 3300049575 Bacteria 805
403 Ga0501040_0503535 3300049576 Bacteria 873
404 Ga0501040_0893322 3300049576 Bacteria 644
405 Ga0501041_0008960 3300049577 Bacteria 5888
406 Ga0501042_0011975 3300049578 Bacteria 5862
407 Ga0501043_0044342 3300049579 Bacteria 3497
408 Ga0501046_0358434 3300049580 Bacteria 1058
409 Ga0501048_0181757 3300049582 Bacteria 1491
410 Ga0501067_0534010 3300049583 Bacteria 657
411 Ga0501068_0062306 3300049584 Bacteria 2268
412 Ga0501069_1034473 3300049585 Bacteria 502
413 Ga0501071_0054267 3300049587 Bacteria 2892
414 Ga0501071_0093657 3300049587 Bacteria 2209
415 Ga0501072_0216154 3300049588 Bacteria 1528
416 Ga0501072_0235677 3300049588 Bacteria 1458
417 Ga0501072_0480367 3300049588 Bacteria 983
418 Ga0501073_0038913 3300049589 Bacteria 3372
419 Ga0501074_0023244 3300049590 Bacteria 4509
420 Ga0501074_0224533 3300049590 Bacteria 1337
421 Ga0501074_1055130 3300049590 Bacteria 571
422 Ga0501074_1306865 3300049590 Bacteria 508
423 Ga0501075_0018755 3300049591 Bacteria 5013
424 Ga0501075_0320310 3300049591 Bacteria 1181
425 Ga0501075_0358695 3300049591 Bacteria 1111
426 Ga0501076_0095343 3300049592 Bacteria 2396
427 Ga0501076_0394052 3300049592 Bacteria 1138
428 Ga0501076_0885063 3300049592 Bacteria 736
429 Ga0501202_037851 3300049652 Bacteria 1032
430 Ga0501209_088898 3300049656 Bacteria 897
431 Ga0501228_005484 3300049666 Bacteria 1127
432 Ga0501079_0377681 3300049741 Bacteria 1111
433 Ga0501079_0382236 3300049741 Bacteria 1104
434 Ga0501080_0318531 3300049742 Bacteria 1408
435 Ga0501081_0122580 3300049743 Bacteria 1853
436 Ga0501083_0441502 3300049744 Bacteria 847
437 Ga0501273_078054 3300049770 Bacteria 547
438 Ga0501045_0002072 3300049824 Bacteria 13541
439 Ga0501045_0029581 3300049824 Bacteria 3961
440 nmdc:mga03683_239558_c1 3300050489 Bacteria 840
441 nmdc:mga03n38_286361_c1 3300050490 Bacteria 881
442 nmdc:mga00v17_3687_c1 3300050491 Bacteria 7912
443 nmdc:mga0yw44_424340_c1 3300050492 Bacteria 900
444 nmdc:mga0yw44_949644_c1 3300050492 Bacteria 583
445 nmdc:mga0yw44_980734_c1 3300050492 Bacteria 572
446 nmdc:mga0k408_501710_c1 3300050493 Bacteria 719
447 nmdc:mga0k408_654753_c1 3300050493 Bacteria 617
448 nmdc:mga06z11_274789_c1 3300050494 Bacteria 997
449 nmdc:mga06z11_461843_c1 3300050494 Bacteria 768
450 nmdc:mga04h51_106980_c1 3300050495 Unclassified 1026
451 nmdc:mga05p37_20250_c1 3300050507 Bacteria 8052
452 nmdc:mga09592_1544170_c1 3300050508 Bacteria 539
453 nmdc:mga09592_453755_c1 3300050508 Bacteria 1106
454 nmdc:mga0qj67_452750_c1 3300050509 Bacteria 1034
455 nmdc:mga06r32_113659_c2 3300050510 Bacteria 2261
456 nmdc:mga06r32_696769_c1 3300050510 Bacteria 982
457 nmdc:mga08y16_72357_c1 3300050511 Bacteria 3593
458 nmdc:mga0n895_113659_c1 3300050512 Bacteria 2725
459 nmdc:mga0n895_1193875_c1 3300050512 Bacteria 735
460 nmdc:mga0n895_16124_c1 3300050512 Bacteria 6846
461 nmdc:mga0rr50_234542_c1 3300050513 Bacteria 1519
462 nmdc:mga0rr50_272934_c1 3300050513 Bacteria 1410
463 nmdc:mga0a205_81949_c1 3300050515 Bacteria 3117
464 nmdc:mga0a205_937927_c1 3300050515 Bacteria 712
465 nmdc:mga0sz30_183902_c1 3300050516 Bacteria 928
466 nmdc:mga0sz30_568887_c1 3300050516 Bacteria 512
467 Ga0495655_0157386 3300053083 Bacteria 719
468 Ga0495619_0365387 3300053085 Bacteria 998
469 Ga0500652_148810 3300053131 Bacteria 972
470 Ga0500659_0012041 3300053135 Bacteria 4715
471 Ga0501084_0033950 3300054114 Bacteria 4266
472 Ga0501084_0352947 3300054114 Bacteria 1242
473 Ga0501084_0594043 3300054114 Bacteria 935
474 Ga0501084_1022397 3300054114 Bacteria 694
475 Ga0501084_1128630 3300054114 Bacteria 658
476 Ga0590075_008576 3300059424 Bacteria 2442
477 Ga0501082_0073360 3300060353 Bacteria 2948
478 Ga0501082_0393678 3300060353 Bacteria 1209
479 Ga0501082_0924353 3300060353 Bacteria 763
480 Ga0501082_1283387 3300060353 Bacteria 640
481 Ga0501082_1472674 3300060353 Bacteria 594
482 Ga0466962_0258091 3300061719 Bacteria 857
483 Ga0530510_0320749 3300061734 Bacteria 1161
484 Ga0530510_0351159 3300061734 Bacteria 1108
485 2555249478 2554235231 Bacteria 5215788
486 2644512903 2643221692 Bacteria 7282860
487 2687234616 2684623219 Bacteria 8442773
488 2722881637 2721755523 Bacteria 6430384
489 2765583625 2765235841 Bacteria 6137024
490 2807408707 2806310737 Bacteria 5751088
491 2807457037 2806310745 Bacteria 5742165
492 2839144286 2839138175 Bacteria 6549354
493 2851186738 2851182111 Bacteria 6047226
494 2881931310 2881927736 Bacteria 3993927
495 2928145098 2928142448 Bacteria 5288925
496 8001784771 8001781756 Bacteria 9586736
497 8052496753 8052494512 Bacteria 5765634
498 8054931542 8054929484 Bacteria 5599761
499 8056118914 8056115690 Bacteria 5527654
500 8056123726 8056120720 Bacteria 5758328
501 8056140359 8056137416 Bacteria 6147080
502 8056209531 8056207758 Bacteria 8639239
503 8057531220 8057529695 Bacteria 6306553
504 Ga0065704_10301452
505 2214583016
506 rootH2_10054863
507 JGI25407J50210_10063991
508 Ga0055536_1020453
509 Ga0065704_10228046
510 Ga0065704_10294170
511 Ga0065707_10233332
512 Ga0070676_10057099
513 Ga0070683_100348320
514 Ga0068869_100895625
515 Ga0070680_100952814
516 Ga0070680_101073604
517 Ga0070660_100780532
518 Ga0070660_100823577
519 Ga0070689_100536711
520 Ga0070687_100068632
521 Ga0070687_100713271
522 Ga0070687_100720863
523 Ga0070692_10039056
524 Ga0070669_100173803
525 Ga0070673_100426115
526 Ga0070659_100329359
527 Ga0070659_100583952
528 Ga0070703_10195165
529 Ga0070703_10475675
530 Ga0070709_11083869
531 Ga0070714_100599727
532 Ga0070713_100016351
533 Ga0070710_10043027
534 Ga0070711_100245353
535 Ga0070705_100390909
536 Ga0070705_100511376
537 Ga0070700_100345879
538 Ga0070694_100066740
539 Ga0070694_100691657
540 Ga0070708_100006168
541 Ga0070663_100646350
542 Ga0070681_11615706
543 Ga0068867_100660617
544 Ga0070706_100009234
545 Ga0070707_100007699
546 Ga0070707_100345714
547 Ga0070698_100426537
548 Ga0070698_101117002
549 Ga0070698_102181054
550 Ga0070699_100031764
551 Ga0070684_100637344
552 Ga0070697_101466202
553 Ga0070686_100296970
554 Ga0070695_100118982
555 Ga0070695_100687509
556 Ga0070696_100004950
557 Ga0070696_100751299
558 Ga0070696_101016458
559 Ga0070696_101630221
560 Ga0070704_100081900
561 Ga0070704_100195854
562 Ga0070664_101210856
563 Ga0068857_100726541
564 Ga0068857_101055533
565 Ga0068854_100447382
566 Ga0068856_100037893
567 Ga0068863_100267766
568 Ga0068860_100090865
569 Ga0068860_102304292
570 Ga0068862_100172687
571 Ga0068862_100351801
572 Ga0068862_101175508
573 Ga0081455_10043537
574 Ga0081455_10087341
575 Ga0081455_10348603
576 Ga0081538_10000121
577 Ga0081538_10002725
578 Ga0081538_10005620
579 Ga0081538_10025665
580 Ga0081538_10026748
581 Ga0081538_10101162
582 Ga0081540_1081442
583 Ga0081539_10298843
584 Ga0070717_10367342
585 Ga0075365_10174244
586 Ga0075363_100299711
587 Ga0075364_10269484
588 Ga0075364_11020398
589 Ga0075432_10000089
590 Ga0075432_10074890
591 Ga0070712_100073156
592 Ga0075362_10111021
593 Ga0075362_10636417
594 Ga0075367_10016087
595 Ga0075367_10286265
596 Ga0075369_10359570
597 Ga0075427_10041532
598 Ga0075366_10104617
599 Ga0075366_10664759
600 Ga0075370_10054203
601 Ga0075428_100003140
602 Ga0075428_100020286
603 Ga0075428_100248912
604 Ga0075430_100070649
605 Ga0075430_100936262
606 Ga0075431_100040254
607 Ga0075431_100104157
608 Ga0075431_100996980
609 Ga0075433_10008941
610 Ga0075433_10564249
611 Ga0075433_10584959
612 Ga0075433_11340479
613 Ga0075434_100023203
614 Ga0075434_100052739
615 Ga0075434_101381977
616 Ga0075434_101486634
617 Ga0075434_101915757
618 Ga0075429_100088040
619 Ga0075429_100088679
620 Ga0068865_100199960
621 Ga0099823_1000027
622 Ga0079104_1000167
623 Ga0075435_100007870
624 Ga0075435_100143677
625 Ga0105251_10000468
626 Ga0105251_10027826
627 Ga0105251_10088850
628 Ga0105244_10242081
629 Ga0105250_10000700
630 Ga0105250_10141584
631 Ga0111539_10077042
632 Ga0111539_11306653
633 Ga0105245_10048422
634 Ga0105245_11406497
635 Ga0114129_10006143
636 Ga0114129_11039810
637 Ga0105243_10037101
638 Ga0105243_10157710
639 Ga0105243_10273564
640 Ga0105243_10417466
641 Ga0105242_12265011
642 Ga0105238_10162773
643 Ga0105238_11103726
644 Ga0105238_12093470
645 Ga0105249_10003751
646 Ga0105249_10389331
647 Ga0105239_10107994
648 Ga0105239_11637001
649 Ga0105246_10018774
650 Ga0105246_10294949
651 Ga0157371_10000514
652 Ga0157370_10066534
653 Ga0157369_10157938
654 Ga0157378_10448923
655 Ga0163162_10107164
656 Ga0157372_10098403
657 Ga0157372_12460389
658 Ga0157375_10748115
659 Ga0157375_11426246
660 Ga0163163_10304217
661 Ga0163163_10630406
662 Ga0163163_11084987
663 Ga0157380_11253122
664 Ga0157380_12695558
665 Ga0182008_10208763
666 Ga0157377_11333776
667 Ga0157379_10082724
668 Ga0157379_10682736
669 Ga0157379_12378108
670 Ga0157376_10534499
671 Ga0157376_11245488
672 Ga0163161_10042241
673 Ga0163161_10109698
674 Ga0206354_11432042
675 Ga0209676_1001013
676 Ga0209025_1000658
677 Ga0207696_1005414
678 Ga0207696_1023888
679 Ga0207655_1000027
680 Ga0207713_1023926
681 Ga0207713_1025179
682 Ga0207713_1082015
683 Ga0207692_10025414
684 Ga0207692_10283302
685 Ga0207688_10066506
686 Ga0207688_10570064
687 Ga0207647_10087841
688 Ga0207699_10300038
689 Ga0207645_10095027
690 Ga0207705_10805637
691 Ga0207684_10079395
692 Ga0207707_10991725
693 Ga0207695_11186860
694 Ga0207693_10131442
695 Ga0207693_10215397
696 Ga0207662_10003558
697 Ga0207657_10619774
698 Ga0207646_10059402
699 Ga0207694_10956512
700 Ga0207687_10437265
701 Ga0207700_10012135
702 Ga0207664_10244523
703 Ga0207664_10435198
704 Ga0207690_10391822
705 Ga0207706_10154921
706 Ga0207686_10273605
707 Ga0207709_10000143
708 Ga0207709_10110168
709 Ga0207709_10504287
710 Ga0207709_11473931
711 Ga0207670_10449861
712 Ga0207669_10223888
713 Ga0207704_10258062
714 Ga0207691_11393456
715 Ga0207661_10284502
716 Ga0207679_10552418
717 Ga0207712_10356802
718 Ga0207703_11444346
719 Ga0207678_10373714
720 Ga0207678_10905042
721 Ga0207708_10339083
722 Ga0207708_11408987
723 Ga0207702_10008136
724 Ga0207641_10285863
725 Ga0207648_10689570
726 Ga0207648_10802231
727 Ga0207674_10916812
728 Ga0207674_11229441
729 Ga0207675_100048115
730 Ga0207683_10578343
731 Ga0209281_1000017
732 Ga0209389_1000118
733 Ga0209970_1079311
734 Ga0207428_10003928
735 Ga0207428_10711107
736 Ga0268265_10552164
737 Ga0268265_10750267
738 Ga0268264_10451465
739 Ga0268264_11725270
740 Ga0268256_1008178
741 Ga0316180_1159483
742 Ga0307513_10012516
743 Ga0307408_100058443
744 Ga0307408_100104884
745 Ga0307408_101987808
746 Ga0307516_10054467
747 Ga0307405_10027408
748 Ga0307405_10060410
749 Ga0307405_11314010
750 Ga0307413_10007334
751 Ga0307413_10014744
752 Ga0307413_10020121
753 Ga0307413_10471972
754 Ga0307413_10634896
755 Ga0307413_10710483
756 Ga0307413_10897369
757 Ga0307410_10000111
758 Ga0307410_10005365
759 Ga0307410_10009576
760 Ga0307410_10213304
761 Ga0307410_10549136
762 Ga0307406_10000655
763 Ga0307406_10006775
764 Ga0307406_10023429
765 Ga0307406_10421199
766 Ga0307406_11144875
767 Ga0307406_11638065
768 Ga0307407_10006736
769 Ga0307407_10018498
770 Ga0307407_10020192
771 Ga0307407_10058179
772 Ga0307407_10137679
773 Ga0307407_10212025
774 Ga0307407_10883695
775 Ga0307412_10070269
776 Ga0307409_100008043
777 Ga0307409_100117796
778 Ga0307409_100194515
779 Ga0307409_100309017
780 Ga0307409_100567991
781 Ga0307409_100767056
782 Ga0307409_100796862
783 Ga0307409_101071587
784 Ga0307409_101210925
785 Ga0307409_101271296
786 Ga0307416_100000114
787 Ga0307416_100005797
788 Ga0307416_100025133
789 Ga0307416_100132320
790 Ga0307416_100206172
791 Ga0307416_101531302
792 Ga0307414_10017803
793 Ga0307414_10056240
794 Ga0307414_10132848
795 Ga0307414_10601114
796 Ga0307414_10823356
797 Ga0307414_12232324
798 Ga0307411_10001422
799 Ga0307411_10059958
800 Ga0307411_10361511
801 Ga0307411_10632082
802 Ga0307415_100000213
803 Ga0307415_100031065
804 Ga0307415_100404482
805 Ga0307415_100442425
806 Ga0307415_101396828
807 Ga0373931_0141771
808 Ga0373931_0388780
809 Ga0395900_0994598
810 Ga0395905_0280389
811 Ga0395901_0563907
812 Ga0395901_1026800
813 Ga0436365_0870307
814 Ga0451797_0635688
815 Ga0451837_1529135
816 Ga0451841_0827512
817 Ga0451847_0187550
818 Ga0439443_043110
819 Ga0439448_0043733
820 Ga0439432_006933
821 Ga0439450_006355
822 Ga0439463_151097
823 Ga0450900_018739
824 Ga0450902_001142
825 Ga0450905_001334
826 Ga0439446_0006337
827 Ga0439459_0058436
828 Ga0439464_0195441
829 Ga0450901_000189
830 Ga0466972_0005508
831 Ga0466972_0086203
832 Ga0466965_0121774
833 Ga0466961_0246665
834 Ga0466963_0470462
835 Ga0466968_0001608
836 Ga0466970_0005091
837 Ga0466970_0364945
838 Ga0466957_0002829
839 Ga0466960_0006118
840 Ga0466960_0019105
841 Ga0466960_0026204
842 Ga0466960_0453944
843 Ga0466960_1051874
844 Ga0466959_0009295
845 Ga0466959_0170591
846 Ga0466959_0752992
847 Ga0466958_0617508
848 Ga0466967_0272155
849 Ga0466967_0649039
850 Ga0495584_0327717
851 Ga0495643_0000261
852 Ga0495663_0136383
853 Ga0495667_0942470
854 Ga0495656_0369889
855 Ga0495656_0429445
856 Ga0495624_0939434
857 Ga0495671_0310374
858 Ga0495672_0002554
859 Ga0495672_0167156
860 Ga0495680_1043503
861 Ga0496100_0184885
862 Ga0496101_0511531
863 Ga0496102_0007620
864 Ga0496102_0202943
865 Ga0496103_0164332
866 Ga0496104_0683720
867 Ga0496104_1157746
868 Ga0496105_0271992
869 Ga0496105_0584250
870 Ga0496106_0018632
871 Ga0496106_0088920
872 Ga0496107_0012021
873 Ga0496107_0158840
874 Ga0496108_0079136
875 Ga0496108_0708689
876 Ga0496109_0056623
877 Ga0496109_0805119
878 Ga0496109_1113292
879 Ga0496109_1477921
880 Ga0496110_0058335
881 Ga0496110_0403705
882 Ga0496110_0562210
883 Ga0496110_0786435
884 Ga0496111_0083195
885 Ga0496111_0191578
886 Ga0496112_0782089
887 Ga0496113_0480710
888 Ga0496114_0017911
889 Ga0496114_0090779
890 Ga0496114_0207523
891 Ga0496114_0308194
892 Ga0496115_0385793
893 Ga0496122_0044225
894 Ga0496125_0004691
895 Ga0496126_0013249
896 Ga0496126_0652954
897 Ga0501311_047293
898 Ga0501031_0096416
899 Ga0501034_0000267
900 Ga0501036_0137496
901 Ga0501036_0432029
902 Ga0501036_0660548
903 Ga0501038_0013540
904 Ga0501038_0063822
905 Ga0501039_0679605
906 Ga0501040_0503535
907 Ga0501040_0893322
908 Ga0501041_0008960
909 Ga0501042_0011975
910 Ga0501043_0044342
911 Ga0501046_0358434
912 Ga0501048_0181757
913 Ga0501067_0534010
914 Ga0501068_0062306
915 Ga0501069_1034473
916 Ga0501071_0054267
917 Ga0501071_0093657
918 Ga0501072_0216154
919 Ga0501072_0235677
920 Ga0501072_0480367
921 Ga0501073_0038913
922 Ga0501074_0023244
923 Ga0501074_0224533
924 Ga0501074_1055130
925 Ga0501074_1306865
926 Ga0501075_0018755
927 Ga0501075_0320310
928 Ga0501075_0358695
929 Ga0501076_0095343
930 Ga0501076_0394052
931 Ga0501076_0885063
932 Ga0501202_037851
933 Ga0501209_088898
934 Ga0501228_005484
935 Ga0501079_0377681
936 Ga0501079_0382236
937 Ga0501080_0318531
938 Ga0501081_0122580
939 Ga0501083_0441502
940 Ga0501273_078054
941 Ga0501045_0002072
942 Ga0501045_0029581
943 nmdc:mga03683_239558_c1
944 nmdc:mga03n38_286361_c1
945 nmdc:mga00v17_3687_c1
946 nmdc:mga0yw44_424340_c1
947 nmdc:mga0yw44_949644_c1
948 nmdc:mga0yw44_980734_c1
949 nmdc:mga0k408_501710_c1
950 nmdc:mga0k408_654753_c1
951 nmdc:mga06z11_274789_c1
952 nmdc:mga06z11_461843_c1
953 nmdc:mga04h51_106980_c1
954 nmdc:mga05p37_20250_c1
955 nmdc:mga09592_1544170_c1
956 nmdc:mga09592_453755_c1
957 nmdc:mga0qj67_452750_c1
958 nmdc:mga06r32_113659_c2
959 nmdc:mga06r32_696769_c1
960 nmdc:mga08y16_72357_c1
961 nmdc:mga0n895_113659_c1
962 nmdc:mga0n895_1193875_c1
963 nmdc:mga0n895_16124_c1
964 nmdc:mga0rr50_234542_c1
965 nmdc:mga0rr50_272934_c1
966 nmdc:mga0a205_81949_c1
967 nmdc:mga0a205_937927_c1
968 nmdc:mga0sz30_183902_c1
969 nmdc:mga0sz30_568887_c1
970 Ga0495655_0157386
971 Ga0495619_0365387
972 Ga0500652_148810
973 Ga0500659_0012041
974 Ga0501084_0033950
975 Ga0501084_0352947
976 Ga0501084_0594043
977 Ga0501084_1022397
978 Ga0501084_1128630
979 Ga0590075_008576
980 Ga0501082_0073360
981 Ga0501082_0393678
982 Ga0501082_0924353
983 Ga0501082_1283387
984 Ga0501082_1472674
985 Ga0466962_0258091
986 Ga0530510_0320749
987 Ga0530510_0351159
988 2555249478
989 2644512903
990 2687234616
991 2722881637
992 2765583625
993 2807408707
994 2807457037
995 2839144286
996 2851186738
997 2881931310
998 2928145098
999 8001784771
1000 8052496753
1001 8054931542
1002 8056118914
1003 8056123726
1004 8056140359
1005 8056209531
1006 8057531220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

2

125

0.94

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

2

38

0.88

PF18029

Glyoxalase_6

Glyoxalase-like domain

3

126

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9938 2 117
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9375 2 117
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8777 2 120
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8464 2 117
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8429 4 121
ID Description Score Start End Superfamily
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9937 2 116 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9371 71 116 3.30.720.110
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9326 70 117 3.10.180.10
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9213 2 116 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8721 70 120 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A4U3LX28-F1-model_v4 VOC family protein 1.001 2 120
AF-A0A1I5UIJ4-F1-model_v4 Catechol 2,3-dioxygenase 0.9999 2 118 GO:0051213
AF-A0A537JV89-F1-model_v4 VOC family protein 0.9999 3 106
AF-A0A2T5L776-F1-model_v4 deleted 0.9981 2 118
AF-A0A5M7CA37-F1-model_v4 VOC family protein 0.9978 2 117

Map