F455935

General Info

Members Datasets Scaffolds Average Seq Length
502 331 464 295

Family's Representative Sequence

Representative Sequence 3300053131|Ga0500652_108143|Ga0500652_108143_80_1114
Length 344
Sequence VWLPKGKVRSNVLKKLCQISLLKGGLRPNFVAYLNLPQIVIKTEQIMRVFVTGATGFIGSAIVQELLGAGHQVLGLARSDEGAKALAARGAAVHRGDLTDLESLRRGAAMSDGVIHTAFNHDFSKFKESCEADRHVIEALGGALAGSDRPLIITSGIGVLAPGGLAVEENEPNAGSNAIPRVATEEAAAAVAASGVHVSVVRLPPSVHGDGDHGFVPMVIGISREKGVSAYVGEGLNRWPAVHRLDAANLYRLVLEKGAAGARYHGVAEEGVPFRDIATVIGRRLNVPVVAKAPEEAAGHFGWLAHFAGRDVPASSQRTREQLGWQPKQSGLIADIDHECYFQS

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
9 2738541293 Rhizobium sp. GV031 Isolate Unclassified
10 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
11 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
12 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
13 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
14 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
15 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
16 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
17 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
18 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
19 2891562705 Microbispora tritici MT50 Isolate Unclassified
20 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
21 2904424332 Duganella sp. 1411 Isolate Rhizosphere
22 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
23 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
24 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
25 2928070936 Variovorax gossypii 1167 Isolate Unclassified
26 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
27 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
28 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
29 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
30 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
31 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
34 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
35 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
36 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
37 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
38 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
41 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
44 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
45 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
46 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
68 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
116 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
134 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
135 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
140 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
143 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
197 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
200 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
203 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
242 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
247 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
248 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
280 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
296 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
305 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
306 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
307 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
308 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
309 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
310 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
311 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
312 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
313 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
314 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
315 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
318 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
319 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
320 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
321 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
322 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
323 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
326 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
327 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
328 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
329 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
330 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
331 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.83
Metatranscriptomes 0.6
Isolates 7.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 13.55
Nodule 1.99
Rhizoplane 2.79
Rhizosphere 63.55
Stem 0
Stem Tuber 0
Unclassified 17.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000667 3300001979 Bacteria 14865
2 JGI24735J21928_10001891 3300002067 Bacteria 7350
3 JGI25155J39150_1000175 3300002704 Bacteria 28065
4 JGI25156J39149_1000379 3300002705 Bacteria 28192
5 JGI25154J39366_1000014 3300002738 Bacteria 265287
6 JGI25154J39366_1000312 3300002738 Bacteria 28149
7 JGI25157J39369_1000421 3300002741 Bacteria 28192
8 JGI25150J39212_1000504 3300002774 Bacteria 16160
9 JGI25151J46595_10000081 3300003187 Bacteria 131317
10 JGI25153J46596_10000117 3300003215 Bacteria 89953
11 JGI25153J46596_10010217 3300003215 Bacteria 4267
12 rootH1_10039163 3300003316 Bacteria 15334
13 rootH1_10118901 3300003316 Unclassified 2309
14 rootH1_10169498 3300003316 Unclassified 3886
15 rootH2_10183889 3300003320 Bacteria 3065
16 rootH2_10250409 3300003320 Bacteria 1222
17 rootL2_10061303 3300003322 Bacteria 4211
18 rootL2_10156153 3300003322 Bacteria 3318
19 rootL2_10181767 3300003322 Bacteria 1664
20 rootH1_10176393 3300003323 Unclassified 1607
21 rootH1_10193019 3300003323 Bacteria 1597
22 rootH1_10385647 3300003323 Unclassified 1349
23 Ga0055533_1000925 3300003756 Bacteria 8762
24 Ga0055542_1000674 3300003762 Bacteria 27585
25 Ga0055536_1002997 3300003781 Bacteria 9246
26 Ga0055540_1004264 3300003792 Bacteria 6544
27 Ga0055531_10000030 3300003794 Bacteria 157459
28 Ga0055531_10038177 3300003794 Bacteria 1446
29 Ga0055541_1002029 3300003841 Bacteria 4140
30 Ga0065165_1000636 3300005262 Bacteria 50815
31 Ga0065165_1000907 3300005262 Bacteria 38180
32 Ga0065165_1050049 3300005262 Bacteria 1191
33 Ga0070676_10006900 3300005328 Bacteria 6079
34 Ga0070683_100079799 3300005329 Bacteria 3063
35 Ga0070690_100032956 3300005330 Bacteria 3239
36 Ga0070690_100373390 3300005330 Unclassified 1041
37 Ga0068869_100019413 3300005334 Bacteria 4644
38 Ga0070666_10004542 3300005335 Bacteria 8456
39 Ga0070666_10378560 3300005335 Unclassified 1016
40 Ga0068868_100004001 3300005338 Bacteria 10289
41 Ga0070692_10056728 3300005345 Bacteria 2052
42 Ga0070668_100022968 3300005347 Bacteria 4716
43 Ga0070669_100106360 3300005353 Bacteria 2124
44 Ga0070675_100061455 3300005354 Unclassified 3102
45 Ga0070671_100006589 3300005355 Bacteria 9282
46 Ga0070667_100012524 3300005367 Bacteria 7015
47 Ga0070709_10035927 3300005434 Bacteria 3014
48 Ga0070709_10295045 3300005434 Bacteria 1182
49 Ga0070714_100069362 3300005435 Bacteria 3044
50 Ga0070714_100206877 3300005435 Bacteria 1797
51 Ga0070714_100265632 3300005435 Bacteria 1590
52 Ga0070711_100370949 3300005439 Bacteria 1155
53 Ga0070708_100000590 3300005445 Bacteria 27234
54 Ga0070663_100038554 3300005455 Bacteria 3334
55 Ga0070678_100083989 3300005456 Unclassified 2422
56 Ga0070662_100005630 3300005457 Bacteria 8010
57 Ga0070681_10126869 3300005458 Bacteria 2484
58 Ga0068867_100020762 3300005459 Bacteria 4682
59 Ga0070698_100201667 3300005471 Bacteria 1925
60 Ga0070699_100105417 3300005518 Bacteria 2473
61 Ga0070684_100061753 3300005535 Bacteria 3280
62 Ga0070697_100015509 3300005536 Bacteria 5982
63 Ga0070697_100037614 3300005536 Bacteria 3909
64 Ga0070697_100039730 3300005536 Bacteria 3805
65 Ga0070697_100095081 3300005536 Bacteria 2470
66 Ga0070697_100158205 3300005536 Bacteria 1913
67 Ga0070697_100296524 3300005536 Bacteria 1389
68 Ga0070695_100323207 3300005545 Bacteria 1148
69 Ga0070665_100016899 3300005548 Bacteria 7316
70 Ga0070665_100108176 3300005548 Bacteria 2783
71 Ga0070665_100146478 3300005548 Bacteria 2364
72 Ga0070704_100333625 3300005549 Bacteria 1275
73 Ga0068854_100323676 3300005578 Bacteria 1254
74 Ga0068856_100099785 3300005614 Bacteria 2895
75 Ga0068856_100192685 3300005614 Bacteria 2052
76 Ga0068852_100074445 3300005616 Bacteria 2991
77 Ga0068852_100358311 3300005616 Bacteria 1426
78 Ga0068859_100088653 3300005617 Bacteria 3143
79 Ga0068863_100085213 3300005841 Bacteria 2995
80 Ga0068863_100173289 3300005841 Bacteria 2070
81 Ga0068858_100022548 3300005842 Bacteria 5874
82 Ga0068860_100019276 3300005843 Bacteria 6622
83 Ga0068860_100437607 3300005843 Bacteria 1298
84 Ga0068862_100304011 3300005844 Bacteria 1468
85 Ga0081455_10156003 3300005937 Bacteria 1755
86 Ga0081539_10010606 3300005985 Bacteria 7443
87 Ga0081539_10142109 3300005985 Bacteria 1165
88 Ga0075365_10004901 3300006038 Bacteria 7154
89 Ga0075365_10105146 3300006038 Bacteria 1936
90 Ga0075432_10030072 3300006058 Bacteria 1877
91 Ga0070715_10018843 3300006163 Bacteria 2637
92 Ga0070715_10126279 3300006163 Bacteria 1225
93 Ga0070716_100267128 3300006173 Bacteria 1173
94 Ga0070712_100402671 3300006175 Bacteria 1131
95 Ga0097621_100059554 3300006237 Bacteria 3127
96 Ga0068871_100030448 3300006358 Bacteria 4250
97 Ga0075428_100019867 3300006844 Bacteria 7437
98 Ga0075430_100162762 3300006846 Bacteria 1857
99 Ga0075431_100209930 3300006847 Bacteria 1989
100 Ga0075434_100024483 3300006871 Archaea 5901
101 Ga0075429_100035009 3300006880 Bacteria 4364
102 Ga0068865_100030435 3300006881 Bacteria 3591
103 Ga0075436_100009927 3300006914 Bacteria 6510
104 Ga0097620_100088655 3300006931 Bacteria 3143
105 Ga0075435_100004917 3300007076 Bacteria 9266
106 Ga0075435_100034821 3300007076 Archaea 3992
107 Ga0099794_10052902 3300007265 Bacteria 1958
108 Ga0099794_10088948 3300007265 Bacteria 1531
109 Ga0099794_10136817 3300007265 Bacteria 1239
110 Ga0099795_10021718 3300007788 Bacteria 2109
111 Ga0105240_10548733 3300009093 Bacteria 1279
112 Ga0105247_10137608 3300009101 Bacteria 1597
113 Ga0114129_10466847 3300009147 Unclassified 1653
114 Ga0105243_10025042 3300009148 Bacteria 4557
115 Ga0105248_10013890 3300009177 Bacteria 8860
116 Ga0105248_10022225 3300009177 Bacteria 7033
117 Ga0105237_10019832 3300009545 Bacteria 6942
118 Ga0105237_10030141 3300009545 Bacteria 5512
119 Ga0105237_10057781 3300009545 Unclassified 3882
120 Ga0105237_10602222 3300009545 Unclassified 1106
121 Ga0105249_10034580 3300009553 Bacteria 4581
122 Ga0105249_10128524 3300009553 Bacteria 2416
123 Ga0123341_1002866 3300009765 Bacteria 14487
124 Ga0123342_1019294 3300009766 Bacteria 5238
125 Ga0099796_10004789 3300010159 Bacteria 3311
126 Ga0105239_10008923 3300010375 Bacteria 11345
127 Ga0105239_10009764 3300010375 Bacteria 10788
128 Ga0105239_10191055 3300010375 Bacteria 2292
129 Ga0105239_10531871 3300010375 Bacteria 1338
130 Ga0105246_10008492 3300011119 Bacteria 6315
131 Ga0157371_10000010 3300013102 Bacteria 384921
132 Ga0157369_10007546 3300013105 Bacteria 12515
133 Ga0157369_10047020 3300013105 Bacteria 4687
134 Ga0157369_10323700 3300013105 Bacteria 1602
135 Ga0157374_10011419 3300013296 Bacteria 7689
136 Ga0163162_10017404 3300013306 Bacteria 7030
137 Ga0163162_10121598 3300013306 Bacteria 2715
138 Ga0157372_10000042 3300013307 Bacteria 157651
139 Ga0157375_10002517 3300013308 Bacteria 15906
140 Ga0157375_10040322 3300013308 Bacteria 4500
141 Ga0163163_10169228 3300014325 Bacteria 2231
142 Ga0157380_10110424 3300014326 Bacteria 2309
143 Ga0182008_10047706 3300014497 Bacteria 2128
144 Ga0157379_10657412 3300014968 Unclassified 981
145 Ga0157376_10044208 3300014969 Bacteria 3660
146 Ga0163161_10009972 3300017792 Bacteria 6580
147 Ga0213872_10001762 3300021361 Bacteria 13555
148 Ga0213872_10017616 3300021361 Unclassified 3299
149 Ga0213872_10021111 3300021361 Bacteria 2998
150 Ga0213872_10053213 3300021361 Bacteria 1836
151 Ga0213874_10013408 3300021377 Bacteria 2123
152 Ga0209435_100010 3300025206 Bacteria 475373
153 Ga0209566_100224 3300025225 Bacteria 55927
154 Ga0209566_100804 3300025225 Bacteria 16378
155 Ga0209674_100043 3300025226 Bacteria 369728
156 Ga0209674_100251 3300025226 Bacteria 44867
157 Ga0207425_1000034 3300025245 Bacteria 227886
158 Ga0209646_1000001 3300025246 Bacteria 3092932
159 Ga0209646_1000002 3300025246 Bacteria 1425781
160 Ga0209026_1000001 3300025250 Bacteria 1228671
161 Ga0209026_1000178 3300025250 Bacteria 96368
162 Ga0209677_103747 3300025253 Bacteria 4740
163 Ga0209148_1000304 3300025254 Bacteria 70717
164 Ga0209759_1000001 3300025256 Bacteria 2799452
165 Ga0209129_1000094 3300025258 Bacteria 172051
166 Ga0209233_1018881 3300025261 Bacteria 1844
167 Ga0209673_1007651 3300025273 Bacteria 4930
168 Ga0209130_1026996 3300025284 Bacteria 1224
169 Ga0209676_1000065 3300025292 Bacteria 318605
170 Ga0209676_1001898 3300025292 Bacteria 17041
171 Ga0209025_1000184 3300025294 Bacteria 155611
172 Ga0209758_1000061 3300025297 Bacteria 320172
173 Ga0209758_1000159 3300025297 Bacteria 155588
174 Ga0209758_1030228 3300025297 Bacteria 2248
175 Ga0209050_1003257 3300025298 Bacteria 12215
176 Ga0209050_1025431 3300025298 Bacteria 2012
177 Ga0209050_1035450 3300025298 Bacteria 1474
178 Ga0207426_1021609 3300025302 Bacteria 2223
179 Ga0209051_1003976 3300025303 Bacteria 9396
180 Ga0209051_1025340 3300025303 Bacteria 2416
181 Ga0209257_1000013 3300025304 Bacteria 1047305
182 Ga0209257_1000504 3300025304 Bacteria 68999
183 Ga0207653_10008309 3300025885 Bacteria 3236
184 Ga0207653_10019751 3300025885 Bacteria 2126
185 Ga0207692_10101262 3300025898 Bacteria 1582
186 Ga0207642_10059203 3300025899 Bacteria 1770
187 Ga0207680_10008276 3300025903 Bacteria 5097
188 Ga0207685_10010530 3300025905 Bacteria 2735
189 Ga0207699_10008443 3300025906 Bacteria 5084
190 Ga0207645_10005397 3300025907 Bacteria 9273
191 Ga0207684_10494497 3300025910 Bacteria 1049
192 Ga0207684_10500741 3300025910 Bacteria 1041
193 Ga0207707_10009640 3300025912 Bacteria 8377
194 Ga0207707_10253345 3300025912 Bacteria 1529
195 Ga0207671_10011927 3300025914 Bacteria 7027
196 Ga0207671_10016362 3300025914 Bacteria 5766
197 Ga0207671_10307724 3300025914 Unclassified 1252
198 Ga0207693_10199443 3300025915 Bacteria 1574
199 Ga0207693_10341517 3300025915 Unclassified 1172
200 Ga0207649_10044907 3300025920 Bacteria 2707
201 Ga0207646_10142106 3300025922 Bacteria 2162
202 Ga0207646_10215719 3300025922 Unclassified 1733
203 Ga0207681_10380911 3300025923 Bacteria 1135
204 Ga0207687_10011037 3300025927 Bacteria 5905
205 Ga0207664_10293581 3300025929 Bacteria 1429
206 Ga0207664_10321674 3300025929 Bacteria 1365
207 Ga0207644_10060249 3300025931 Bacteria 2746
208 Ga0207706_10003934 3300025933 Bacteria 14082
209 Ga0207706_10018087 3300025933 Bacteria 6341
210 Ga0207686_10186029 3300025934 Bacteria 1477
211 Ga0207709_10124676 3300025935 Bacteria 1745
212 Ga0207665_10286625 3300025939 Bacteria 1227
213 Ga0207711_10006116 3300025941 Bacteria 10167
214 Ga0207711_10139428 3300025941 Bacteria 2181
215 Ga0207689_10042828 3300025942 Bacteria 3743
216 Ga0207667_10112612 3300025949 Bacteria 2806
217 Ga0207667_10644609 3300025949 Bacteria 1065
218 Ga0207712_10018179 3300025961 Bacteria 4575
219 Ga0207712_10324877 3300025961 Bacteria 1271
220 Ga0207668_10085314 3300025972 Unclassified 2304
221 Ga0207658_10015533 3300025986 Bacteria 5223
222 Ga0207677_10022319 3300026023 Bacteria 3888
223 Ga0207703_10024365 3300026035 Bacteria 4762
224 Ga0207678_10007546 3300026067 Bacteria 9614
225 Ga0207678_10031341 3300026067 Bacteria 4638
226 Ga0207678_10085406 3300026067 Unclassified 2698
227 Ga0207678_10371497 3300026067 Bacteria 1235
228 Ga0207702_10075722 3300026078 Bacteria 2908
229 Ga0207702_10162980 3300026078 Bacteria 2038
230 Ga0207648_10022742 3300026089 Bacteria 5626
231 Ga0207676_10363510 3300026095 Bacteria 1342
232 Ga0207674_10037779 3300026116 Bacteria 5018
233 Ga0207683_10007919 3300026121 Bacteria 9093
234 Ga0209179_1007755 3300027512 Bacteria 1783
235 Ga0209588_1001679 3300027671 Bacteria 5827
236 Ga0268266_10159817 3300028379 Bacteria 2037
237 Ga0268265_10154470 3300028380 Bacteria 1940
238 Ga0268264_10072001 3300028381 Unclassified 2930
239 Ga0268264_10478415 3300028381 Bacteria 1211
240 Ga0307515_10002427 3300028794 Bacteria 40656
241 Ga0307515_10028947 3300028794 Bacteria 9388
242 Ga0307515_10178602 3300028794 Bacteria 2083
243 Ga0265338_10006059 3300028800 Bacteria 15526
244 Ga0265338_10030280 3300028800 Bacteria 5337
245 Ga0265338_10083833 3300028800 Bacteria 2664
246 Ga0316181_1013750 3300030744 Bacteria 4862
247 Ga0265770_1000128 3300030878 Bacteria 9195
248 Ga0265760_10000177 3300031090 Bacteria 16628
249 Ga0265330_10057018 3300031235 Unclassified 1704
250 Ga0265320_10015692 3300031240 Bacteria 4274
251 Ga0265325_10004468 3300031241 Bacteria 8835
252 Ga0265340_10006498 3300031247 Bacteria 6431
253 Ga0265340_10041787 3300031247 Bacteria 2253
254 Ga0265340_10044968 3300031247 Bacteria 2159
255 Ga0265339_10000503 3300031249 Bacteria 30482
256 Ga0265316_10010656 3300031344 Bacteria 8358
257 Ga0307513_10000001 3300031456 Bacteria 1660464
258 Ga0307513_10002593 3300031456 Bacteria 24972
259 Ga0307513_10048472 3300031456 Bacteria 4611
260 Ga0307513_10271482 3300031456 Bacteria 1479
261 Ga0307408_100004109 3300031548 Bacteria 9932
262 Ga0265313_10000099 3300031595 Bacteria 88958
263 Ga0307508_10126733 3300031616 Bacteria 2156
264 Ga0265314_10005117 3300031711 Bacteria 11938
265 Ga0265342_10012537 3300031712 Bacteria 5738
266 Ga0307516_10088512 3300031730 Bacteria 2929
267 Ga0307516_10213024 3300031730 Bacteria 1645
268 Ga0307405_10004876 3300031731 Bacteria 6404
269 Ga0307406_10017470 3300031901 Bacteria 4177
270 Ga0307412_10113248 3300031911 Bacteria 1941
271 Ga0307415_100007992 3300032126 Bacteria 5833
272 Ga0307507_10022362 3300033179 Bacteria 6989
273 Ga0307510_10165207 3300033180 Bacteria 1803
274 Ga0373945_0026235 3300035116 Bacteria 2029
275 Ga0373947_0030872 3300035725 Bacteria 3151
276 Ga0372808_005184 3300036459 Bacteria 1707
277 Ga0395899_0000401 3300037312 Bacteria 50789
278 Ga0395899_0006184 3300037312 Bacteria 9278
279 Ga0395899_0425105 3300037312 Bacteria 875
280 Ga0395900_0033235 3300037418 Bacteria 5309
281 Ga0395900_0406486 3300037418 Bacteria 1324
282 Ga0395898_0099719 3300037466 Bacteria 2789
283 Ga0395905_0000872 3300037471 Bacteria 39336
284 Ga0395905_0022154 3300037471 Bacteria 6011
285 Ga0395905_0114802 3300037471 Bacteria 2530
286 Ga0436364_0178301 3300037853 Bacteria 6943
287 Ga0436364_1111527 3300037853 Bacteria 2607
288 Ga0436364_1455769 3300037853 Bacteria 2480
289 Ga0242419_002725 3300038698 Bacteria 1164
290 Ga0436361_0093651 3300039447 Bacteria 2423
291 Ga0436361_0576920 3300039447 Bacteria 94641
292 Ga0436361_0602027 3300039447 Bacteria 7208
293 Ga0436361_0654582 3300039447 Bacteria 9126
294 Ga0436361_1068692 3300039447 Bacteria 2028
295 Ga0436361_1144974 3300039447 Unclassified 1182
296 Ga0436363_0064738 3300039450 Bacteria 4813
297 Ga0451791_0456434 3300041451 Bacteria 1075
298 Ga0466969_0012766 3300044656 Bacteria 4427
299 Ga0466969_0083979 3300044656 Bacteria 1516
300 Ga0466972_0000127 3300044658 Bacteria 63923
301 Ga0466982_0000004 3300044672 Bacteria 386724
302 Ga0466965_0023867 3300044683 Bacteria 2955
303 Ga0466966_0002115 3300044684 Bacteria 12903
304 Ga0466966_0019063 3300044684 Bacteria 4520
305 Ga0466966_0019698 3300044684 Bacteria 4439
306 Ga0466966_0233442 3300044684 Bacteria 1109
307 Ga0466961_0004150 3300044693 Bacteria 9046
308 Ga0466961_0040225 3300044693 Bacteria 2998
309 Ga0466970_0000159 3300044765 Bacteria 32178
310 Ga0466970_0045323 3300044765 Bacteria 2341
311 Ga0466957_0027612 3300044842 Bacteria 3375
312 Ga0466957_0044781 3300044842 Unclassified 2682
313 Ga0466960_0001187 3300044901 Bacteria 9389
314 Ga0466960_0021917 3300044901 Unclassified 2851
315 Ga0466960_0045939 3300044901 Bacteria 2088
316 Ga0466959_0025887 3300045049 Bacteria 4351
317 Ga0466959_0036510 3300045049 Bacteria 3632
318 Ga0466959_0096267 3300045049 Bacteria 2122
319 Ga0466958_0002885 3300045836 Bacteria 8767
320 Ga0466958_0154678 3300045836 Bacteria 1447
321 Ga0466958_0168764 3300045836 Bacteria 1385
322 Ga0495590_0030829 3300046457 Bacteria 1878
323 Ga0495590_0048684 3300046457 Bacteria 1479
324 Ga0495591_000537 3300046458 Bacteria 29393
325 Ga0495629_0000037 3300046459 Bacteria 117099
326 Ga0495583_0002496 3300046506 Bacteria 15613
327 Ga0495606_0001399 3300046507 Bacteria 32508
328 Ga0495606_0001402 3300046507 Bacteria 32434
329 Ga0495610_0003212 3300046512 Bacteria 12940
330 Ga0495610_0010882 3300046512 Bacteria 5614
331 Ga0495610_0016675 3300046512 Bacteria 4218
332 Ga0495610_0062862 3300046512 Bacteria 1760
333 Ga0495616_0073892 3300046513 Bacteria 1644
334 Ga0495620_0000998 3300046515 Bacteria 17497
335 Ga0495628_0010130 3300046516 Bacteria 8016
336 Ga0495632_0000763 3300046519 Bacteria 28910
337 Ga0495643_0018942 3300046522 Bacteria 3987
338 Ga0495643_0102091 3300046522 Bacteria 1469
339 Ga0495648_0000230 3300046524 Bacteria 64054
340 Ga0495648_0098025 3300046524 Bacteria 1624
341 Ga0495654_0006138 3300046530 Bacteria 6879
342 Ga0495654_0071984 3300046530 Bacteria 1637
343 Ga0495640_0035889 3300046533 Bacteria 3507
344 Ga0495633_0027160 3300046558 Bacteria 2800
345 Ga0495634_0065849 3300046642 Bacteria 2400
346 Ga0495661_0000532 3300046665 Bacteria 39216
347 Ga0495660_0052171 3300046810 Bacteria 2223
348 Ga0495674_0362812 3300047319 Bacteria 1174
349 Ga0495680_0159471 3300047322 Unclassified 1639
350 Ga0495683_0000320 3300047323 Bacteria 40260
351 Ga0495673_0000186 3300047469 Bacteria 100563
352 Ga0495681_0002727 3300047470 Bacteria 12496
353 Ga0495681_0003614 3300047470 Bacteria 10756
354 Ga0495686_0024626 3300047472 Bacteria 3952
355 Ga0495686_0075392 3300047472 Bacteria 2068
356 Ga0496101_0079684 3300048904 Bacteria 2418
357 Ga0496101_0084564 3300048904 Bacteria 2350
358 Ga0496103_0001512 3300048906 Bacteria 15549
359 Ga0496104_0310389 3300048907 Bacteria 1490
360 Ga0496104_0373279 3300048907 Bacteria 1339
361 Ga0496113_0082176 3300048916 Bacteria 2470
362 Ga0496115_0000158 3300048918 Bacteria 63464
363 Ga0496115_0001891 3300048918 Bacteria 14988
364 Ga0496115_0132725 3300048918 Bacteria 2052
365 Ga0496116_0022624 3300048919 Bacteria 4705
366 Ga0496116_0029040 3300048919 Bacteria 3993
367 Ga0496116_0030233 3300048919 Bacteria 3894
368 Ga0496117_0034192 3300048920 Bacteria 3834
369 Ga0496117_0174525 3300048920 Bacteria 1243
370 Ga0496118_0032001 3300048921 Bacteria 4345
371 Ga0496118_0088683 3300048921 Bacteria 2138
372 Ga0496119_0000510 3300048922 Bacteria 52939
373 Ga0496119_0011826 3300048922 Bacteria 7170
374 Ga0496119_0174578 3300048922 Bacteria 1132
375 Ga0496120_0091987 3300048923 Bacteria 1619
376 Ga0496121_0002329 3300048924 Bacteria 29339
377 Ga0496121_0019649 3300048924 Bacteria 6744
378 Ga0496121_0032365 3300048924 Bacteria 4754
379 Ga0496121_0047233 3300048924 Bacteria 3675
380 Ga0496122_0000107 3300048925 Bacteria 193163
381 Ga0496122_0008719 3300048925 Bacteria 10854
382 Ga0496122_0020299 3300048925 Bacteria 6013
383 Ga0496122_0036949 3300048925 Bacteria 3940
384 Ga0496122_0038100 3300048925 Bacteria 3858
385 Ga0496123_0000063 3300048926 Bacteria 216072
386 Ga0496123_0008119 3300048926 Bacteria 9704
387 Ga0496123_0021416 3300048926 Bacteria 5025
388 Ga0496123_0035166 3300048926 Bacteria 3575
389 Ga0496124_0019735 3300048927 Bacteria 6259
390 Ga0496124_0020417 3300048927 Bacteria 6120
391 Ga0496124_0045289 3300048927 Bacteria 3772
392 Ga0496124_0051399 3300048927 Bacteria 3507
393 Ga0496125_0005448 3300048928 Bacteria 14138
394 Ga0496126_0007322 3300048929 Bacteria 12121
395 Ga0496126_0043949 3300048929 Bacteria 4118
396 Ga0496126_0272543 3300048929 Bacteria 1404
397 Ga0501032_0040524 3300049569 Bacteria 3166
398 Ga0501032_0068253 3300049569 Bacteria 2374
399 Ga0501033_0041388 3300049570 Bacteria 3438
400 Ga0501034_0042703 3300049571 Bacteria 4590
401 Ga0501034_0132759 3300049571 Bacteria 2473
402 Ga0501034_0400263 3300049571 Bacteria 1296
403 Ga0501038_0059948 3300049574 Bacteria 3258
404 Ga0501038_0125475 3300049574 Bacteria 2113
405 Ga0501043_0227844 3300049579 Bacteria 1440
406 Ga0501047_0000850 3300049581 Bacteria 31408
407 Ga0501047_0013929 3300049581 Bacteria 7640
408 Ga0501047_0057377 3300049581 Bacteria 3765
409 Ga0501047_0083155 3300049581 Bacteria 3077
410 Ga0501047_0240515 3300049581 Bacteria 1661
411 Ga0501070_0152299 3300049586 Bacteria 1908
412 Ga0501073_0003935 3300049589 Bacteria 11142
413 Ga0501073_0092160 3300049589 Bacteria 2106
414 Ga0501077_0015630 3300049593 Bacteria 4780
415 Ga0501080_0121926 3300049742 Bacteria 2415
416 Ga0501269_000016 3300049766 Bacteria 58863
417 Ga0501035_0000238 3300049822 Bacteria 65886
418 Ga0501044_0002163 3300049823 Bacteria 22528
419 Ga0501044_0029336 3300049823 Bacteria 5801
420 Ga0501044_0176978 3300049823 Bacteria 2102
421 Ga0501044_0199369 3300049823 Bacteria 1960
422 nmdc:mga05p37_102488_c1 3300050507 Bacteria 3525
423 nmdc:mga05p37_147575_c1 3300050507 Bacteria 2879
424 nmdc:mga09592_207356_c1 3300050508 Bacteria 1698
425 nmdc:mga0qj67_199992_c1 3300050509 Bacteria 1624
426 nmdc:mga06r32_49844_c1 3300050510 Bacteria 4006
427 nmdc:mga0n895_45503_c1 3300050512 Archaea 4283
428 nmdc:mga0n895_8184_c1 3300050512 Bacteria 9038
429 nmdc:mga0rr50_3298_c1 3300050513 Bacteria 9266
430 nmdc:mga08x19_1479_c1 3300050514 Bacteria 14556
431 nmdc:mga08x19_78993_c1 3300050514 Bacteria 2157
432 nmdc:mga0a205_106095_c1 3300050515 Bacteria 2708
433 nmdc:mga0a205_10744_c1 3300050515 Bacteria 8416
434 nmdc:mga0a205_147596_c1 3300050515 Archaea 2252
435 Ga0500610_0066486 3300053079 Bacteria 1880
436 Ga0495619_0089018 3300053085 Bacteria 2088
437 Ga0500644_0001980 3300053088 Bacteria 5222
438 Ga0500651_0001456 3300053093 Bacteria 11910
439 Ga0500555_001763 3300053103 Bacteria 6467
440 Ga0500556_0000097 3300053104 Bacteria 81329
441 Ga0500556_0021320 3300053104 Bacteria 2088
442 Ga0500593_000169 3300053117 Bacteria 26386
443 Ga0500595_020216 3300053119 Bacteria 2401
444 Ga0500608_000191 3300053122 Bacteria 24609
445 Ga0500652_108143 3300053131 Unclassified 1162
446 Ga0500658_0032375 3300053134 Bacteria 2050
447 Ga0500559_0093628 3300053136 Bacteria 1378
448 Ga0500561_0012313 3300053137 Bacteria 1822
449 Ga0500564_011335 3300053138 Bacteria 3929
450 Ga0500568_0000514 3300053139 Bacteria 28491
451 Ga0500568_0002443 3300053139 Bacteria 10935
452 Ga0500568_0026664 3300053139 Bacteria 2423
453 Ga0500577_0021776 3300053142 Bacteria 2117
454 Ga0500590_018124 3300053148 Bacteria 3644
455 Ga0500600_0072975 3300053149 Bacteria 1877
456 Ga0500636_0003875 3300053177 Bacteria 8444
457 Ga0500636_0062574 3300053177 Bacteria 2170
458 Ga0500645_003789 3300053730 Bacteria 6014
459 Ga0500645_043330 3300053730 Bacteria 1325
460 Ga0500609_002688 3300053731 Bacteria 2531
461 Ga0500661_010546 3300055283 Bacteria 1682
462 Ga0501082_0006824 3300060353 Bacteria 9869
463 Ga0466962_0020843 3300061719 Bacteria 3150
464 Ga0466962_0123292 3300061719 Bacteria 1251

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100206877 Ga0070714_1002068772 253
2 3300025929 Ga0207664_10321674 Ga0207664_103216741 253
3 3300037312 Ga0395899_0425105 Ga0395899_0425105_97_864 254
4 3300053117 Ga0500593_000169 Ga0500593_000169_3466_4356 258
5 3300005435 Ga0070714_100069362 Ga0070714_1000693622 261
6 3300028800 Ga0265338_10006059 Ga0265338_1000605911 263
7 3300031730 Ga0307516_10213024 Ga0307516_102130242 266
8 3300005841 Ga0068863_100085213 Ga0068863_1000852132 267
9 3300048922 Ga0496119_0011826 Ga0496119_0011826_5481_6401 267
10 3300053730 Ga0500645_043330 Ga0500645_043330_324_1265 267
11 3300044658 Ga0466972_0000127 Ga0466972_0000127_46915_47721 268
12 iso_pu_bacteria 2984527788 2984531423 268
13 iso_pu_bacteria 2984532647 2984532678 268
14 3300037853 Ga0436364_1111527 Ga0436364_1111527_532_1452 269
15 3300048918 Ga0496115_0132725 Ga0496115_0132725_197_1117 269
16 iso_pu_bacteria 2821111986 2821112462 269
17 iso_pu_bacteria 2904595352 2904600364 269
18 iso_pu_bacteria 8007375930 8007377458 269
19 iso_pu_bacteria 2946053406 2946055091 270
20 3300025949 Ga0207667_10644609 Ga0207667_106446091 271
21 3300025972 Ga0207668_10085314 Ga0207668_100853142 272
22 3300003841 Ga0055541_1002029 Ga0055541_10020293 273
23 3300005329 Ga0070683_100079799 Ga0070683_1000797992 273
24 3300005345 Ga0070692_10056728 Ga0070692_100567282 273
25 3300005458 Ga0070681_10126869 Ga0070681_101268692 273
26 3300005535 Ga0070684_100061753 Ga0070684_1000617532 273
27 3300005578 Ga0068854_100323676 Ga0068854_1003236761 273
28 3300005616 Ga0068852_100074445 Ga0068852_1000744453 273
29 3300013105 Ga0157369_10007546 Ga0157369_100075462 273
30 3300025225 Ga0209566_100804 Ga0209566_10080415 273
31 3300025912 Ga0207707_10009640 Ga0207707_100096405 273
32 3300026067 Ga0207678_10371497 Ga0207678_103714971 273
33 3300026116 Ga0207674_10037779 Ga0207674_100377793 273
34 3300046457 Ga0495590_0048684 Ga0495590_0048684_89_919 273
35 3300048923 Ga0496120_0091987 Ga0496120_0091987_71_904 273
36 3300048924 Ga0496121_0032365 Ga0496121_0032365_1627_2460 273
37 3300048929 Ga0496126_0272543 Ga0496126_0272543_155_988 273
38 3300002704 JGI25155J39150_1000175 JGI25155J39150_10001759 275
39 3300002705 JGI25156J39149_1000379 JGI25156J39149_10003799 275
40 3300002738 JGI25154J39366_1000312 JGI25154J39366_100031222 275
41 3300002741 JGI25157J39369_1000421 JGI25157J39369_10004219 275
42 3300025206 Ga0209435_100010 Ga0209435_100010440 275
43 3300025246 Ga0209646_1000001 Ga0209646_10000011702 275
44 3300025250 Ga0209026_1000001 Ga0209026_1000001356 275
45 3300025256 Ga0209759_1000001 Ga0209759_10000011333 275
46 3300025898 Ga0207692_10101262 Ga0207692_101012622 275
47 3300006871 Ga0075434_100024483 Ga0075434_1000244838 277
48 3300007076 Ga0075435_100034821 Ga0075435_1000348213 277
49 3300007265 Ga0099794_10088948 Ga0099794_100889482 277
50 3300036459 Ga0372808_005184 Ga0372808_005184_595_1515 277
51 3300047322 Ga0495680_0159471 Ga0495680_0159471_99_1028 277
52 3300050512 nmdc:mga0n895_45503_c1 nmdc:mga0n895_45503_c1_1319_2152 277
53 3300050515 nmdc:mga0a205_147596_c1 nmdc:mga0a205_147596_c1_1388_2221 277
54 3300053103 Ga0500555_001763 Ga0500555_001763_2006_2893 277
55 3300003781 Ga0055536_1002997 Ga0055536_10029974 278
56 3300005262 Ga0065165_1000907 Ga0065165_10009078 278
57 3300025292 Ga0209676_1001898 Ga0209676_100189819 278
58 3300025298 Ga0209050_1035450 Ga0209050_10354501 278
59 3300028794 Ga0307515_10002427 Ga0307515_100024277 278
60 3300031456 Ga0307513_10002593 Ga0307513_100025936 278
61 3300053079 Ga0500610_0066486 Ga0500610_0066486_499_1395 279
62 3300005548 Ga0070665_100108176 Ga0070665_1001081762 280
63 3300053177 Ga0500636_0003875 Ga0500636_0003875_4366_5247 280
64 3300005328 Ga0070676_10006900 Ga0070676_100069003 282
65 3300005330 Ga0070690_100032956 Ga0070690_1000329564 282
66 3300005334 Ga0068869_100019413 Ga0068869_1000194134 282
67 3300005335 Ga0070666_10004542 Ga0070666_100045422 282
68 3300005338 Ga0068868_100004001 Ga0068868_1000040014 282
69 3300005347 Ga0070668_100022968 Ga0070668_1000229684 282
70 3300005353 Ga0070669_100106360 Ga0070669_1001063602 282
71 3300005354 Ga0070675_100061455 Ga0070675_1000614554 282
72 3300005355 Ga0070671_100006589 Ga0070671_1000065894 282
73 3300005367 Ga0070667_100012524 Ga0070667_1000125248 282
74 3300005456 Ga0070678_100083989 Ga0070678_1000839891 282
75 3300005457 Ga0070662_100005630 Ga0070662_1000056305 282
76 3300005459 Ga0068867_100020762 Ga0068867_1000207624 282
77 3300005548 Ga0070665_100016899 Ga0070665_1000168998 282
78 3300005841 Ga0068863_100173289 Ga0068863_1001732892 282
79 3300005842 Ga0068858_100022548 Ga0068858_1000225482 282
80 3300005843 Ga0068860_100019276 Ga0068860_1000192766 282
81 3300006237 Ga0097621_100059554 Ga0097621_1000595544 282
82 3300006358 Ga0068871_100030448 Ga0068871_1000304483 282
83 3300006881 Ga0068865_100030435 Ga0068865_1000304354 282
84 3300009177 Ga0105248_10013890 Ga0105248_100138903 282
85 3300009177 Ga0105248_10022225 Ga0105248_100222253 282
86 3300009553 Ga0105249_10034580 Ga0105249_100345803 282
87 3300009553 Ga0105249_10128524 Ga0105249_101285242 282
88 3300010375 Ga0105239_10191055 Ga0105239_101910552 282
89 3300011119 Ga0105246_10008492 Ga0105246_100084923 282
90 3300013296 Ga0157374_10011419 Ga0157374_100114199 282
91 3300013306 Ga0163162_10017404 Ga0163162_100174044 282
92 3300013308 Ga0157375_10002517 Ga0157375_100025178 282
93 3300013308 Ga0157375_10040322 Ga0157375_100403223 282
94 3300014325 Ga0163163_10169228 Ga0163163_101692281 282
95 3300014968 Ga0157379_10657412 Ga0157379_106574121 282
96 3300014969 Ga0157376_10044208 Ga0157376_100442084 282
97 3300017792 Ga0163161_10009972 Ga0163161_100099729 282
98 3300025899 Ga0207642_10059203 Ga0207642_100592032 282
99 3300025903 Ga0207680_10008276 Ga0207680_100082763 282
100 3300025907 Ga0207645_10005397 Ga0207645_100053974 282
101 3300025912 Ga0207707_10253345 Ga0207707_102533452 282
102 3300025920 Ga0207649_10044907 Ga0207649_100449073 282
103 3300025923 Ga0207681_10380911 Ga0207681_103809112 282
104 3300025927 Ga0207687_10011037 Ga0207687_100110378 282
105 3300025931 Ga0207644_10060249 Ga0207644_100602492 282
106 3300025933 Ga0207706_10018087 Ga0207706_100180875 282
107 3300025934 Ga0207686_10186029 Ga0207686_101860292 282
108 3300025941 Ga0207711_10006116 Ga0207711_100061165 282
109 3300025942 Ga0207689_10042828 Ga0207689_100428282 282
110 3300025961 Ga0207712_10018179 Ga0207712_100181793 282
111 3300025961 Ga0207712_10324877 Ga0207712_103248771 282
112 3300025986 Ga0207658_10015533 Ga0207658_100155335 282
113 3300026023 Ga0207677_10022319 Ga0207677_100223194 282
114 3300026035 Ga0207703_10024365 Ga0207703_100243656 282
115 3300026067 Ga0207678_10085406 Ga0207678_100854063 282
116 3300026089 Ga0207648_10022742 Ga0207648_100227424 282
117 3300026121 Ga0207683_10007919 Ga0207683_100079194 282
118 3300028379 Ga0268266_10159817 Ga0268266_101598173 282
119 3300028381 Ga0268264_10072001 Ga0268264_100720012 282
120 3300053104 Ga0500556_0000097 Ga0500556_0000097_11131_12018 282
121 3300053093 Ga0500651_0001456 Ga0500651_0001456_8592_9479 283
122 3300053104 Ga0500556_0021320 Ga0500556_0021320_918_1805 283
123 3300025915 Ga0207693_10341517 Ga0207693_103415171 284
124 3300026067 Ga0207678_10007546 Ga0207678_100075465 284
125 3300048918 Ga0496115_0001891 Ga0496115_0001891_3638_4525 284
126 3300049586 Ga0501070_0152299 Ga0501070_0152299_570_1463 284
127 3300005262 Ga0065165_1050049 Ga0065165_10500491 285
128 3300025284 Ga0209130_1026996 Ga0209130_10269961 285
129 3300025302 Ga0207426_1021609 Ga0207426_10216092 285
130 3300025941 Ga0207711_10139428 Ga0207711_101394282 285
131 3300048922 Ga0496119_0174578 Ga0496119_0174578_143_1027 285
132 3300005445 Ga0070708_100000590 Ga0070708_10000059014 286
133 3300005518 Ga0070699_100105417 Ga0070699_1001054172 286
134 3300053148 Ga0500590_018124 Ga0500590_018124_712_1605 286
135 iso_pu_bacteria 2599185214 2599625301 286
136 iso_pu_bacteria 2599185226 2599673247 286
137 iso_pu_bacteria 2599185227 2599682917 286
138 iso_pu_bacteria 2599185229 2599694855 286
139 iso_pu_bacteria 2838054893 2838060427 286
140 iso_pu_bacteria 2928070936 2928077798 286
141 3300005844 Ga0068862_100304011 Ga0068862_1003040112 287
142 3300028380 Ga0268265_10154470 Ga0268265_101544702 287
143 3300028794 Ga0307515_10178602 Ga0307515_101786023 287
144 3300046522 Ga0495643_0102091 Ga0495643_0102091_154_1035 287
145 3300053137 Ga0500561_0012313 Ga0500561_0012313_893_1774 287
146 3300053139 Ga0500568_0000514 Ga0500568_0000514_20921_21787 287
147 3300005434 Ga0070709_10035927 Ga0070709_100359271 288
148 3300005536 Ga0070697_100296524 Ga0070697_1002965242 288
149 3300006058 Ga0075432_10030072 Ga0075432_100300722 288
150 3300050507 nmdc:mga05p37_102488_c1 nmdc:mga05p37_102488_c1_657_1544 288
151 iso_pu_bacteria 2884791551 2884793882 288
152 3300007265 Ga0099794_10052902 Ga0099794_100529022 289
153 3300021361 Ga0213872_10021111 Ga0213872_100211112 289
154 3300027671 Ga0209588_1001679 Ga0209588_10016795 289
155 3300050514 nmdc:mga08x19_78993_c1 nmdc:mga08x19_78993_c1_765_1682 289
156 3300003320 rootH2_10250409 rootH2_102504092 290
157 3300025885 Ga0207653_10019751 Ga0207653_100197512 290
158 3300025922 Ga0207646_10142106 Ga0207646_101421062 290
159 3300031730 Ga0307516_10088512 Ga0307516_100885124 290
160 3300044842 Ga0466957_0027612 Ga0466957_0027612_2294_3169 290
161 3300045836 Ga0466958_0002885 Ga0466958_0002885_5858_6733 290
162 3300061719 Ga0466962_0020843 Ga0466962_0020843_1578_2453 290
163 iso_pu_bacteria 2508501128 2509151009 290
164 iso_pu_bacteria 3002141150 3002144215 290
165 iso_pu_bacteria 8002317523 8002319370 290
166 iso_pu_bacteria 8046991243 8046994208 290
167 3300003323 rootH1_10176393 rootH1_101763931 291
168 3300005471 Ga0070698_100201667 Ga0070698_1002016672 291
169 3300005616 Ga0068852_100358311 Ga0068852_1003583112 291
170 3300014326 Ga0157380_10110424 Ga0157380_101104242 291
171 3300025261 Ga0209233_1018881 Ga0209233_10188812 291
172 3300025933 Ga0207706_10003934 Ga0207706_1000393410 291
173 3300046524 Ga0495648_0000230 Ga0495648_0000230_27137_28015 291
174 3300047323 Ga0495683_0000320 Ga0495683_0000320_33886_34770 291
175 3300047469 Ga0495673_0000186 Ga0495673_0000186_15480_16358 291
176 3300053088 Ga0500644_0001980 Ga0500644_0001980_620_1498 291
177 3300053138 Ga0500564_011335 Ga0500564_011335_2458_3336 291
178 iso_pu_bacteria 2511231002 2511247257 291
179 iso_pu_bacteria 2818991460 2819678588 291
180 iso_pu_bacteria 3003930520 3003932260 291
181 3300009093 Ga0105240_10548733 Ga0105240_105487332 292
182 3300028800 Ga0265338_10030280 Ga0265338_100302804 292
183 3300031235 Ga0265330_10057018 Ga0265330_100570181 292
184 3300031241 Ga0265325_10004468 Ga0265325_100044687 292
185 3300031249 Ga0265339_10000503 Ga0265339_1000050318 292
186 3300031344 Ga0265316_10010656 Ga0265316_100106565 292
187 3300031595 Ga0265313_10000099 Ga0265313_1000009938 292
188 3300031711 Ga0265314_10005117 Ga0265314_100051179 292
189 3300031712 Ga0265342_10012537 Ga0265342_100125371 292
190 3300039447 Ga0436361_1144974 Ga0436361_1144974_35_919 292
191 3300044656 Ga0466969_0012766 Ga0466969_0012766_2810_3715 292
192 3300044683 Ga0466965_0023867 Ga0466965_0023867_1892_2791 292
193 3300044765 Ga0466970_0045323 Ga0466970_0045323_818_1723 292
194 3300044901 Ga0466960_0001187 Ga0466960_0001187_877_1776 292
195 3300049569 Ga0501032_0068253 Ga0501032_0068253_1143_2054 292
196 3300049570 Ga0501033_0041388 Ga0501033_0041388_820_1731 292
197 3300049571 Ga0501034_0042703 Ga0501034_0042703_178_1089 292
198 3300049574 Ga0501038_0059948 Ga0501038_0059948_1739_2650 292
199 3300049581 Ga0501047_0240515 Ga0501047_0240515_150_1061 292
200 3300049823 Ga0501044_0199369 Ga0501044_0199369_597_1508 292
201 iso_pu_bacteria 2585427594 2585844718 292
202 iso_pu_bacteria 2738541293 2738803878 292
203 iso_pu_bacteria 2862281513 2862285650 292
204 iso_pu_bacteria 2899803654 2899804085 292
205 iso_pu_bacteria 2904690495 2904697022 292
206 iso_pu_bacteria 2908756301 2908762709 292
207 iso_pu_bacteria 8024486573 8024489975 292
208 3300003215 JGI25153J46596_10000117 JGI25153J46596_1000011773 293
209 3300003316 rootH1_10118901 rootH1_101189013 293
210 3300003322 rootL2_10156153 rootL2_101561531 293
211 3300005536 Ga0070697_100158205 Ga0070697_1001582052 293
212 3300005614 Ga0068856_100099785 Ga0068856_1000997853 293
213 3300025297 Ga0209758_1000061 Ga0209758_1000061162 293
214 3300026078 Ga0207702_10075722 Ga0207702_100757221 293
215 3300028800 Ga0265338_10083833 Ga0265338_100838332 293
216 3300031240 Ga0265320_10015692 Ga0265320_100156921 293
217 3300044684 Ga0466966_0019698 Ga0466966_0019698_115_1020 293
218 3300044693 Ga0466961_0040225 Ga0466961_0040225_1239_2144 293
219 3300045049 Ga0466959_0025887 Ga0466959_0025887_551_1456 293
220 3300045836 Ga0466958_0154678 Ga0466958_0154678_259_1164 293
221 3300049581 Ga0501047_0057377 Ga0501047_0057377_2301_3185 293
222 3300049589 Ga0501073_0003935 Ga0501073_0003935_9931_10815 293
223 3300049593 Ga0501077_0015630 Ga0501077_0015630_1486_2373 293
224 3300053119 Ga0500595_020216 Ga0500595_020216_907_1788 293
225 3300055283 Ga0500661_010546 Ga0500661_010546_485_1402 293
226 iso_pu_bacteria 2600255286 2601639996 293
227 iso_pu_bacteria 2854916844 2854921135 293
228 iso_pu_bacteria 2856741275 2856746432 293
229 iso_pu_bacteria 2874123672 2874125582 293
230 iso_pu_bacteria 2883291878 2883293605 293
231 iso_pu_bacteria 2891562705 2891567992 293
232 iso_pu_bacteria 2904424332 2904428186 293
233 iso_pu_bacteria 8056689827 8056695063 293
234 3300003322 rootL2_10181767 rootL2_101817672 294
235 3300003792 Ga0055540_1004264 Ga0055540_10042644 294
236 3300005545 Ga0070695_100323207 Ga0070695_1003232071 294
237 3300005548 Ga0070665_100146478 Ga0070665_1001464783 294
238 3300005843 Ga0068860_100437607 Ga0068860_1004376072 294
239 3300006844 Ga0075428_100019867 Ga0075428_1000198678 294
240 3300006880 Ga0075429_100035009 Ga0075429_1000350092 294
241 3300006914 Ga0075436_100009927 Ga0075436_1000099274 294
242 3300009101 Ga0105247_10137608 Ga0105247_101376081 294
243 3300009148 Ga0105243_10025042 Ga0105243_100250423 294
244 3300009545 Ga0105237_10602222 Ga0105237_106022221 294
245 3300025303 Ga0209051_1003976 Ga0209051_10039767 294
246 3300025885 Ga0207653_10008309 Ga0207653_100083094 294
247 3300025910 Ga0207684_10500741 Ga0207684_105007411 294
248 3300025922 Ga0207646_10215719 Ga0207646_102157191 294
249 3300025935 Ga0207709_10124676 Ga0207709_101246762 294
250 3300031456 Ga0307513_10271482 Ga0307513_102714822 294
251 3300037312 Ga0395899_0006184 Ga0395899_0006184_6784_7671 294
252 3300037418 Ga0395900_0033235 Ga0395900_0033235_134_1021 294
253 3300037418 Ga0395900_0406486 Ga0395900_0406486_321_1208 294
254 3300037471 Ga0395905_0114802 Ga0395905_0114802_595_1482 294
255 3300037853 Ga0436364_1455769 Ga0436364_1455769_514_1419 294
256 3300046515 Ga0495620_0000998 Ga0495620_0000998_5143_6033 294
257 3300048925 Ga0496122_0000107 Ga0496122_0000107_68092_68985 294
258 3300048926 Ga0496123_0000063 Ga0496123_0000063_124124_125017 294
259 3300049574 Ga0501038_0125475 Ga0501038_0125475_101_988 294
260 3300049581 Ga0501047_0083155 Ga0501047_0083155_512_1399 294
261 3300049589 Ga0501073_0092160 Ga0501073_0092160_991_1878 294
262 3300049742 Ga0501080_0121926 Ga0501080_0121926_1434_2321 294
263 3300049823 Ga0501044_0029336 Ga0501044_0029336_649_1536 294
264 3300050508 nmdc:mga09592_207356_c1 nmdc:mga09592_207356_c1_180_1067 294
265 3300050510 nmdc:mga06r32_49844_c1 nmdc:mga06r32_49844_c1_2052_2939 294
266 3300050514 nmdc:mga08x19_1479_c1 nmdc:mga08x19_1479_c1_3292_4236 294
267 3300053139 Ga0500568_0002443 Ga0500568_0002443_5678_6565 294
268 3300053142 Ga0500577_0021776 Ga0500577_0021776_953_1837 294
269 3300053177 Ga0500636_0062574 Ga0500636_0062574_631_1533 294
270 3300060353 Ga0501082_0006824 Ga0501082_0006824_5266_6153 294
271 iso_pu_bacteria 2929921140 2929923644 294
272 3300002067 JGI24735J21928_10001891 JGI24735J21928_1000189110 295
273 3300003756 Ga0055533_1000925 Ga0055533_10009254 295
274 3300003794 Ga0055531_10000030 Ga0055531_1000003063 295
275 3300003794 Ga0055531_10038177 Ga0055531_100381772 295
276 3300005455 Ga0070663_100038554 Ga0070663_1000385543 295
277 3300005536 Ga0070697_100037614 Ga0070697_1000376146 295
278 3300005985 Ga0081539_10142109 Ga0081539_101421091 295
279 3300009765 Ga0123341_1002866 Ga0123341_10028665 295
280 3300009766 Ga0123342_1019294 Ga0123342_10192945 295
281 3300013105 Ga0157369_10047020 Ga0157369_100470207 295
282 3300013105 Ga0157369_10323700 Ga0157369_103237001 295
283 3300013307 Ga0157372_10000042 Ga0157372_1000004216 295
284 3300025226 Ga0209674_100043 Ga0209674_100043183 295
285 3300025292 Ga0209676_1000065 Ga0209676_1000065217 295
286 3300025298 Ga0209050_1003257 Ga0209050_10032574 295
287 3300025298 Ga0209050_1025431 Ga0209050_10254312 295
288 3300025304 Ga0209257_1000013 Ga0209257_1000013372 295
289 3300025304 Ga0209257_1000504 Ga0209257_100050437 295
290 3300025910 Ga0207684_10494497 Ga0207684_104944971 295
291 3300026067 Ga0207678_10031341 Ga0207678_100313413 295
292 3300028794 Ga0307515_10028947 Ga0307515_1002894712 295
293 3300030878 Ga0265770_1000128 Ga0265770_10001286 295
294 3300031090 Ga0265760_10000177 Ga0265760_100001772 295
295 3300031247 Ga0265340_10006498 Ga0265340_100064987 295
296 3300031247 Ga0265340_10041787 Ga0265340_100417872 295
297 3300031247 Ga0265340_10044968 Ga0265340_100449683 295
298 3300031456 Ga0307513_10048472 Ga0307513_100484725 295
299 3300031548 Ga0307408_100004109 Ga0307408_1000041097 295
300 3300031901 Ga0307406_10017470 Ga0307406_100174703 295
301 3300031911 Ga0307412_10113248 Ga0307412_101132482 295
302 3300033179 Ga0307507_10022362 Ga0307507_100223624 295
303 3300037312 Ga0395899_0000401 Ga0395899_0000401_16742_17722 295
304 3300037466 Ga0395898_0099719 Ga0395898_0099719_1541_2431 295
305 3300041451 Ga0451791_0456434 Ga0451791_0456434_64_954 295
306 3300044684 Ga0466966_0019063 Ga0466966_0019063_1548_2438 295
307 3300044693 Ga0466961_0004150 Ga0466961_0004150_5657_6547 295
308 3300044765 Ga0466970_0000159 Ga0466970_0000159_19700_20587 295
309 3300044901 Ga0466960_0021917 Ga0466960_0021917_498_1385 295
310 3300045049 Ga0466959_0036510 Ga0466959_0036510_2489_3379 295
311 3300046507 Ga0495606_0001399 Ga0495606_0001399_7690_8580 295
312 3300046512 Ga0495610_0016675 Ga0495610_0016675_906_1832 295
313 3300046516 Ga0495628_0010130 Ga0495628_0010130_5884_6774 295
314 3300048916 Ga0496113_0082176 Ga0496113_0082176_534_1424 295
315 3300048918 Ga0496115_0000158 Ga0496115_0000158_9183_10073 295
316 3300048922 Ga0496119_0000510 Ga0496119_0000510_22245_23147 295
317 3300048925 Ga0496122_0020299 Ga0496122_0020299_327_1265 295
318 3300048926 Ga0496123_0008119 Ga0496123_0008119_3073_4011 295
319 3300053134 Ga0500658_0032375 Ga0500658_0032375_522_1409 295
320 3300053730 Ga0500645_003789 Ga0500645_003789_2622_3560 295
321 3300053731 Ga0500609_002688 Ga0500609_002688_232_1119 295
322 iso_pu_bacteria 8003151029 8003155223 295
323 3300002774 JGI25150J39212_1000504 JGI25150J39212_10005044 296
324 3300003187 JGI25151J46595_10000081 JGI25151J46595_1000008141 296
325 3300003215 JGI25153J46596_10010217 JGI25153J46596_100102173 296
326 3300003316 rootH1_10039163 rootH1_100391639 296
327 3300003320 rootH2_10183889 rootH2_101838892 296
328 3300003323 rootH1_10385647 rootH1_103856471 296
329 3300003762 Ga0055542_1000674 Ga0055542_10006746 296
330 3300005262 Ga0065165_1000636 Ga0065165_100063646 296
331 3300005330 Ga0070690_100373390 Ga0070690_1003733901 296
332 3300005335 Ga0070666_10378560 Ga0070666_103785601 296
333 3300005434 Ga0070709_10295045 Ga0070709_102950451 296
334 3300005435 Ga0070714_100265632 Ga0070714_1002656321 296
335 3300005439 Ga0070711_100370949 Ga0070711_1003709492 296
336 3300005536 Ga0070697_100015509 Ga0070697_1000155095 296
337 3300005549 Ga0070704_100333625 Ga0070704_1003336251 296
338 3300005937 Ga0081455_10156003 Ga0081455_101560031 296
339 3300005985 Ga0081539_10010606 Ga0081539_100106068 296
340 3300006038 Ga0075365_10004901 Ga0075365_1000490112 296
341 3300006038 Ga0075365_10105146 Ga0075365_101051461 296
342 3300006163 Ga0070715_10126279 Ga0070715_101262792 296
343 3300006173 Ga0070716_100267128 Ga0070716_1002671282 296
344 3300006175 Ga0070712_100402671 Ga0070712_1004026711 296
345 3300006846 Ga0075430_100162762 Ga0075430_1001627622 296
346 3300007265 Ga0099794_10136817 Ga0099794_101368171 296
347 3300007788 Ga0099795_10021718 Ga0099795_100217181 296
348 3300009545 Ga0105237_10030141 Ga0105237_100301414 296
349 3300009545 Ga0105237_10057781 Ga0105237_100577811 296
350 3300010159 Ga0099796_10004789 Ga0099796_100047893 296
351 3300010375 Ga0105239_10008923 Ga0105239_100089235 296
352 3300010375 Ga0105239_10009764 Ga0105239_1000976410 296
353 3300010375 Ga0105239_10531871 Ga0105239_105318711 296
354 3300013102 Ga0157371_10000010 Ga0157371_10000010212 296
355 3300013306 Ga0163162_10121598 Ga0163162_101215982 296
356 3300014497 Ga0182008_10047706 Ga0182008_100477062 296
357 3300021361 Ga0213872_10053213 Ga0213872_100532132 296
358 3300025225 Ga0209566_100224 Ga0209566_10022416 296
359 3300025226 Ga0209674_100251 Ga0209674_10025124 296
360 3300025245 Ga0207425_1000034 Ga0207425_1000034183 296
361 3300025253 Ga0209677_103747 Ga0209677_1037474 296
362 3300025254 Ga0209148_1000304 Ga0209148_100030416 296
363 3300025258 Ga0209129_1000094 Ga0209129_1000094128 296
364 3300025273 Ga0209673_1007651 Ga0209673_10076514 296
365 3300025294 Ga0209025_1000184 Ga0209025_100018442 296
366 3300025297 Ga0209758_1000159 Ga0209758_100015942 296
367 3300025297 Ga0209758_1030228 Ga0209758_10302283 296
368 3300025303 Ga0209051_1025340 Ga0209051_10253402 296
369 3300025906 Ga0207699_10008443 Ga0207699_100084436 296
370 3300025914 Ga0207671_10016362 Ga0207671_100163622 296
371 3300025914 Ga0207671_10307724 Ga0207671_103077241 296
372 3300025915 Ga0207693_10199443 Ga0207693_101994432 296
373 3300025929 Ga0207664_10293581 Ga0207664_102935812 296
374 3300025939 Ga0207665_10286625 Ga0207665_102866252 296
375 3300027512 Ga0209179_1007755 Ga0209179_10077552 296
376 3300028381 Ga0268264_10478415 Ga0268264_104784151 296
377 3300031456 Ga0307513_10000001 Ga0307513_1000000160 296
378 3300031616 Ga0307508_10126733 Ga0307508_101267332 296
379 3300031731 Ga0307405_10004876 Ga0307405_100048764 296
380 3300033180 Ga0307510_10165207 Ga0307510_101652072 296
381 3300035116 Ga0373945_0026235 Ga0373945_0026235_697_1653 296
382 3300035725 Ga0373947_0030872 Ga0373947_0030872_260_1216 296
383 3300037471 Ga0395905_0000872 Ga0395905_0000872_27442_28389 296
384 3300037471 Ga0395905_0022154 Ga0395905_0022154_1309_2202 296
385 3300038698 Ga0242419_002725 Ga0242419_002725_174_1067 296
386 3300039447 Ga0436361_0602027 Ga0436361_0602027_5434_6327 296
387 3300046457 Ga0495590_0030829 Ga0495590_0030829_924_1817 296
388 3300046458 Ga0495591_000537 Ga0495591_000537_16313_17209 296
389 3300046459 Ga0495629_0000037 Ga0495629_0000037_86891_87784 296
390 3300046507 Ga0495606_0001402 Ga0495606_0001402_11077_11973 296
391 3300046512 Ga0495610_0003212 Ga0495610_0003212_7591_8487 296
392 3300046512 Ga0495610_0062862 Ga0495610_0062862_732_1628 296
393 3300046519 Ga0495632_0000763 Ga0495632_0000763_12296_13192 296
394 3300046522 Ga0495643_0018942 Ga0495643_0018942_1723_2619 296
395 3300046524 Ga0495648_0098025 Ga0495648_0098025_81_974 296
396 3300046530 Ga0495654_0071984 Ga0495654_0071984_166_1062 296
397 3300046533 Ga0495640_0035889 Ga0495640_0035889_1140_2096 296
398 3300046642 Ga0495634_0065849 Ga0495634_0065849_716_1672 296
399 3300046665 Ga0495661_0000532 Ga0495661_0000532_18101_18997 296
400 3300047319 Ga0495674_0362812 Ga0495674_0362812_58_1014 296
401 3300047470 Ga0495681_0002727 Ga0495681_0002727_7814_8710 296
402 3300047470 Ga0495681_0003614 Ga0495681_0003614_5520_6416 296
403 3300047472 Ga0495686_0024626 Ga0495686_0024626_1144_2037 296
404 3300047472 Ga0495686_0075392 Ga0495686_0075392_827_1720 296
405 3300048904 Ga0496101_0079684 Ga0496101_0079684_862_1758 296
406 3300048907 Ga0496104_0310389 Ga0496104_0310389_342_1235 296
407 3300048919 Ga0496116_0022624 Ga0496116_0022624_2079_2975 296
408 3300048919 Ga0496116_0029040 Ga0496116_0029040_1678_2574 296
409 3300048919 Ga0496116_0030233 Ga0496116_0030233_565_1461 296
410 3300048920 Ga0496117_0034192 Ga0496117_0034192_1387_2283 296
411 3300048920 Ga0496117_0174525 Ga0496117_0174525_56_952 296
412 3300048921 Ga0496118_0032001 Ga0496118_0032001_1996_2892 296
413 3300048921 Ga0496118_0088683 Ga0496118_0088683_84_980 296
414 3300048924 Ga0496121_0019649 Ga0496121_0019649_3778_4674 296
415 3300048924 Ga0496121_0047233 Ga0496121_0047233_1608_2504 296
416 3300048925 Ga0496122_0008719 Ga0496122_0008719_1590_2486 296
417 3300048925 Ga0496122_0036949 Ga0496122_0036949_1455_2351 296
418 3300048925 Ga0496122_0038100 Ga0496122_0038100_1591_2487 296
419 3300048926 Ga0496123_0021416 Ga0496123_0021416_1172_2068 296
420 3300048926 Ga0496123_0035166 Ga0496123_0035166_1508_2404 296
421 3300048927 Ga0496124_0019735 Ga0496124_0019735_3266_4162 296
422 3300048927 Ga0496124_0020417 Ga0496124_0020417_3143_4039 296
423 3300048927 Ga0496124_0045289 Ga0496124_0045289_1981_2877 296
424 3300048927 Ga0496124_0051399 Ga0496124_0051399_1440_2336 296
425 3300048928 Ga0496125_0005448 Ga0496125_0005448_10773_11669 296
426 3300048929 Ga0496126_0043949 Ga0496126_0043949_1095_1988 296
427 3300049569 Ga0501032_0040524 Ga0501032_0040524_229_1125 296
428 3300049571 Ga0501034_0132759 Ga0501034_0132759_146_1039 296
429 3300049579 Ga0501043_0227844 Ga0501043_0227844_481_1377 296
430 3300049581 Ga0501047_0000850 Ga0501047_0000850_8836_9732 296
431 3300049766 Ga0501269_000016 Ga0501269_000016_7217_8110 296
432 3300049822 Ga0501035_0000238 Ga0501035_0000238_41399_42295 296
433 3300049823 Ga0501044_0002163 Ga0501044_0002163_15529_16425 296
434 3300050507 nmdc:mga05p37_147575_c1 nmdc:mga05p37_147575_c1_1638_2531 296
435 3300050509 nmdc:mga0qj67_199992_c1 nmdc:mga0qj67_199992_c1_432_1325 296
436 3300050515 nmdc:mga0a205_106095_c1 nmdc:mga0a205_106095_c1_1636_2529 296
437 3300053085 Ga0495619_0089018 Ga0495619_0089018_429_1346 296
438 3300053122 Ga0500608_000191 Ga0500608_000191_8907_9824 296
439 3300053136 Ga0500559_0093628 Ga0500559_0093628_353_1243 296
440 3300053149 Ga0500600_0072975 Ga0500600_0072975_624_1562 296
441 iso_pu_bacteria 2874123672 2874126210 296
442 3300003316 rootH1_10169498 rootH1_101694984 297
443 3300003322 rootL2_10061303 rootL2_100613031 297
444 3300003323 rootH1_10193019 rootH1_101930192 297
445 3300005536 Ga0070697_100039730 Ga0070697_1000397303 297
446 3300005536 Ga0070697_100095081 Ga0070697_1000950813 297
447 3300005617 Ga0068859_100088653 Ga0068859_1000886532 297
448 3300006163 Ga0070715_10018843 Ga0070715_100188433 297
449 3300006847 Ga0075431_100209930 Ga0075431_1002099302 297
450 3300006931 Ga0097620_100088655 Ga0097620_1000886552 297
451 3300009147 Ga0114129_10466847 Ga0114129_104668472 297
452 3300009545 Ga0105237_10019832 Ga0105237_100198327 297
453 3300021361 Ga0213872_10001762 Ga0213872_100017628 297
454 3300021377 Ga0213874_10013408 Ga0213874_100134082 297
455 3300025905 Ga0207685_10010530 Ga0207685_100105302 297
456 3300025914 Ga0207671_10011927 Ga0207671_100119277 297
457 3300025949 Ga0207667_10112612 Ga0207667_101126121 297
458 3300030744 Ga0316181_1013750 Ga0316181_10137508 297
459 3300032126 Ga0307415_100007992 Ga0307415_1000079924 297
460 3300037853 Ga0436364_0178301 Ga0436364_0178301_805_1701 297
461 3300039447 Ga0436361_0093651 Ga0436361_0093651_237_1133 297
462 3300039447 Ga0436361_0576920 Ga0436361_0576920_37698_38597 297
463 3300039447 Ga0436361_1068692 Ga0436361_1068692_63_956 297
464 3300039450 Ga0436363_0064738 Ga0436363_0064738_2481_3422 297
465 3300046506 Ga0495583_0002496 Ga0495583_0002496_13814_14755 297
466 3300046512 Ga0495610_0010882 Ga0495610_0010882_3123_4019 297
467 3300046558 Ga0495633_0027160 Ga0495633_0027160_1525_2427 297
468 3300048904 Ga0496101_0084564 Ga0496101_0084564_1252_2184 297
469 3300048906 Ga0496103_0001512 Ga0496103_0001512_385_1287 297
470 3300048924 Ga0496121_0002329 Ga0496121_0002329_15434_16330 297
471 3300048929 Ga0496126_0007322 Ga0496126_0007322_6951_7883 297
472 3300049571 Ga0501034_0400263 Ga0501034_0400263_65_976 297
473 3300049581 Ga0501047_0013929 Ga0501047_0013929_1276_2175 297
474 3300049823 Ga0501044_0176978 Ga0501044_0176978_500_1399 297
475 3300005614 Ga0068856_100192685 Ga0068856_1001926852 298
476 3300007076 Ga0075435_100004917 Ga0075435_10000491710 298
477 3300021361 Ga0213872_10017616 Ga0213872_100176162 298
478 3300026078 Ga0207702_10162980 Ga0207702_101629802 298
479 3300026095 Ga0207676_10363510 Ga0207676_103635101 298
480 3300039447 Ga0436361_0654582 Ga0436361_0654582_446_1351 298
481 3300044656 Ga0466969_0083979 Ga0466969_0083979_527_1432 298
482 3300044672 Ga0466982_0000004 Ga0466982_0000004_145324_146232 298
483 3300044684 Ga0466966_0002115 Ga0466966_0002115_8603_9511 298
484 3300044684 Ga0466966_0233442 Ga0466966_0233442_44_1021 298
485 3300044842 Ga0466957_0044781 Ga0466957_0044781_79_1083 298
486 3300044901 Ga0466960_0045939 Ga0466960_0045939_673_1581 298
487 3300045049 Ga0466959_0096267 Ga0466959_0096267_760_1788 298
488 3300045836 Ga0466958_0168764 Ga0466958_0168764_114_1142 298
489 3300046513 Ga0495616_0073892 Ga0495616_0073892_290_1207 298
490 3300046530 Ga0495654_0006138 Ga0495654_0006138_3316_4224 298
491 3300046810 Ga0495660_0052171 Ga0495660_0052171_286_1203 298
492 3300048907 Ga0496104_0373279 Ga0496104_0373279_105_1010 298
493 3300050512 nmdc:mga0n895_8184_c1 nmdc:mga0n895_8184_c1_6986_7945 298
494 3300050513 nmdc:mga0rr50_3298_c1 nmdc:mga0rr50_3298_c1_1075_2034 298
495 3300050515 nmdc:mga0a205_10744_c1 nmdc:mga0a205_10744_c1_5394_6353 298
496 3300053131 Ga0500652_108143 Ga0500652_108143_80_1114 298
497 3300053139 Ga0500568_0026664 Ga0500568_0026664_1157_2092 298
498 3300061719 Ga0466962_0123292 Ga0466962_0123292_20_1048 298
499 3300001979 JGI24740J21852_10000667 JGI24740J21852_100006678 299
500 3300002738 JGI25154J39366_1000014 JGI25154J39366_1000014163 299
501 3300025246 Ga0209646_1000002 Ga0209646_1000002961 299
502 3300025250 Ga0209026_1000178 Ga0209026_100017846 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

49

142

0.92

PF05368

NmrA

NmrA-like family

49

142

0.88

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

50

171

0.86

PF07993

NAD_binding_4

Male sterility protein

51

115

0.82

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

50

123

0.8

PF13460

NAD_binding_10

NAD(P)H-binding

53

224

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s2j-assembly1.cif.gz_A square conformation of ktra r16k mutant ring with bound atp 0.841 2 109
4j91-assembly1.cif.gz_A-2 diamond-shaped octameric structure of ktra with adp bound 0.8361 3 109
4j91-assembly1.cif.gz_C-2 diamond-shaped octameric structure of ktra with adp bound 0.8357 3 109
4j91-assembly1.cif.gz_B-2 diamond-shaped octameric structure of ktra with adp bound 0.8355 3 109
4j91-assembly1.cif.gz_D-2 diamond-shaped octameric structure of ktra with adp bound 0.8352 3 109
ID Description Score Start End Superfamily
af_Q9Y7K4_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9823 1 261 3.40.50.720
af_Q9Y7K4_1_260_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9786 1 261 3.40.50.720
af_Q12177_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9762 1 259 3.40.50.720
af_Q12177_1_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9616 1 259 3.40.50.720
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8901 2 32 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A4Y3TQQ8-F1-model_v4 NAD-dependent dehydratase 0.9796 1 291 GO:0004029
GO:0005737
AF-A0A254Q6J3-F1-model_v4 SDR family oxidoreductase 0.979 1 292 GO:0004029
GO:0005737
AF-A0A7V3MJ56-F1-model_v4 3-beta hydroxysteroid dehydrogenase 0.9773 161 298 GO:0004029
GO:0005737
AF-B6HC03-F1-model_v4 Pc18g00870 protein 0.9771 1 298 GO:0004029
GO:0005737
AF-A0A4Q6CMB8-F1-model_v4 deleted 0.9771 1 83

Feature Viewer

pLDDT pTM Quality
95.56 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map