F455935
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 502 | 331 | 464 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300053131|Ga0500652_108143|Ga0500652_108143_80_1114 |
| Length | 344 |
| Sequence | VWLPKGKVRSNVLKKLCQISLLKGGLRPNFVAYLNLPQIVIKTEQIMRVFVTGATGFIGSAIVQELLGAGHQVLGLARSDEGAKALAARGAAVHRGDLTDLESLRRGAAMSDGVIHTAFNHDFSKFKESCEADRHVIEALGGALAGSDRPLIITSGIGVLAPGGLAVEENEPNAGSNAIPRVATEEAAAAVAASGVHVSVVRLPPSVHGDGDHGFVPMVIGISREKGVSAYVGEGLNRWPAVHRLDAANLYRLVLEKGAAGARYHGVAEEGVPFRDIATVIGRRLNVPVVAKAPEEAAGHFGWLAHFAGRDVPASSQRTREQLGWQPKQSGLIADIDHECYFQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 3 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 9 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 10 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 11 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 12 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 13 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 14 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 15 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 16 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 17 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 18 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 19 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 20 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 21 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 22 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 23 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 24 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 25 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 26 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 27 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 28 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 29 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 30 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 31 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 32 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 33 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 34 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 35 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 36 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 37 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 38 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 39 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 40 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 41 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 42 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 43 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 44 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 45 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 48 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 52 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 56 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 58 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 116 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 133 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 134 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 197 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 202 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 220 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 226 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 227 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 230 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 235 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 241 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 271 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 272 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 273 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 274 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 275 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 276 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 277 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 278 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 279 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 280 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 306 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 307 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 308 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 309 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 310 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 311 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 312 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 313 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 314 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 315 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 318 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 319 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 320 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 323 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 324 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 326 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 327 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 328 | 8007375930 | Clostridium sp. YIM B02565 | Isolate | Unclassified |
| 329 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 330 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 331 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.83 |
| Metatranscriptomes | 0.6 |
| Isolates | 7.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.4 |
| Bulb | 0 |
| Endosphere | 13.55 |
| Nodule | 1.99 |
| Rhizoplane | 2.79 |
| Rhizosphere | 63.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000667 | 3300001979 | Bacteria | 14865 |
| 2 | JGI24735J21928_10001891 | 3300002067 | Bacteria | 7350 |
| 3 | JGI25155J39150_1000175 | 3300002704 | Bacteria | 28065 |
| 4 | JGI25156J39149_1000379 | 3300002705 | Bacteria | 28192 |
| 5 | JGI25154J39366_1000014 | 3300002738 | Bacteria | 265287 |
| 6 | JGI25154J39366_1000312 | 3300002738 | Bacteria | 28149 |
| 7 | JGI25157J39369_1000421 | 3300002741 | Bacteria | 28192 |
| 8 | JGI25150J39212_1000504 | 3300002774 | Bacteria | 16160 |
| 9 | JGI25151J46595_10000081 | 3300003187 | Bacteria | 131317 |
| 10 | JGI25153J46596_10000117 | 3300003215 | Bacteria | 89953 |
| 11 | JGI25153J46596_10010217 | 3300003215 | Bacteria | 4267 |
| 12 | rootH1_10039163 | 3300003316 | Bacteria | 15334 |
| 13 | rootH1_10118901 | 3300003316 | Unclassified | 2309 |
| 14 | rootH1_10169498 | 3300003316 | Unclassified | 3886 |
| 15 | rootH2_10183889 | 3300003320 | Bacteria | 3065 |
| 16 | rootH2_10250409 | 3300003320 | Bacteria | 1222 |
| 17 | rootL2_10061303 | 3300003322 | Bacteria | 4211 |
| 18 | rootL2_10156153 | 3300003322 | Bacteria | 3318 |
| 19 | rootL2_10181767 | 3300003322 | Bacteria | 1664 |
| 20 | rootH1_10176393 | 3300003323 | Unclassified | 1607 |
| 21 | rootH1_10193019 | 3300003323 | Bacteria | 1597 |
| 22 | rootH1_10385647 | 3300003323 | Unclassified | 1349 |
| 23 | Ga0055533_1000925 | 3300003756 | Bacteria | 8762 |
| 24 | Ga0055542_1000674 | 3300003762 | Bacteria | 27585 |
| 25 | Ga0055536_1002997 | 3300003781 | Bacteria | 9246 |
| 26 | Ga0055540_1004264 | 3300003792 | Bacteria | 6544 |
| 27 | Ga0055531_10000030 | 3300003794 | Bacteria | 157459 |
| 28 | Ga0055531_10038177 | 3300003794 | Bacteria | 1446 |
| 29 | Ga0055541_1002029 | 3300003841 | Bacteria | 4140 |
| 30 | Ga0065165_1000636 | 3300005262 | Bacteria | 50815 |
| 31 | Ga0065165_1000907 | 3300005262 | Bacteria | 38180 |
| 32 | Ga0065165_1050049 | 3300005262 | Bacteria | 1191 |
| 33 | Ga0070676_10006900 | 3300005328 | Bacteria | 6079 |
| 34 | Ga0070683_100079799 | 3300005329 | Bacteria | 3063 |
| 35 | Ga0070690_100032956 | 3300005330 | Bacteria | 3239 |
| 36 | Ga0070690_100373390 | 3300005330 | Unclassified | 1041 |
| 37 | Ga0068869_100019413 | 3300005334 | Bacteria | 4644 |
| 38 | Ga0070666_10004542 | 3300005335 | Bacteria | 8456 |
| 39 | Ga0070666_10378560 | 3300005335 | Unclassified | 1016 |
| 40 | Ga0068868_100004001 | 3300005338 | Bacteria | 10289 |
| 41 | Ga0070692_10056728 | 3300005345 | Bacteria | 2052 |
| 42 | Ga0070668_100022968 | 3300005347 | Bacteria | 4716 |
| 43 | Ga0070669_100106360 | 3300005353 | Bacteria | 2124 |
| 44 | Ga0070675_100061455 | 3300005354 | Unclassified | 3102 |
| 45 | Ga0070671_100006589 | 3300005355 | Bacteria | 9282 |
| 46 | Ga0070667_100012524 | 3300005367 | Bacteria | 7015 |
| 47 | Ga0070709_10035927 | 3300005434 | Bacteria | 3014 |
| 48 | Ga0070709_10295045 | 3300005434 | Bacteria | 1182 |
| 49 | Ga0070714_100069362 | 3300005435 | Bacteria | 3044 |
| 50 | Ga0070714_100206877 | 3300005435 | Bacteria | 1797 |
| 51 | Ga0070714_100265632 | 3300005435 | Bacteria | 1590 |
| 52 | Ga0070711_100370949 | 3300005439 | Bacteria | 1155 |
| 53 | Ga0070708_100000590 | 3300005445 | Bacteria | 27234 |
| 54 | Ga0070663_100038554 | 3300005455 | Bacteria | 3334 |
| 55 | Ga0070678_100083989 | 3300005456 | Unclassified | 2422 |
| 56 | Ga0070662_100005630 | 3300005457 | Bacteria | 8010 |
| 57 | Ga0070681_10126869 | 3300005458 | Bacteria | 2484 |
| 58 | Ga0068867_100020762 | 3300005459 | Bacteria | 4682 |
| 59 | Ga0070698_100201667 | 3300005471 | Bacteria | 1925 |
| 60 | Ga0070699_100105417 | 3300005518 | Bacteria | 2473 |
| 61 | Ga0070684_100061753 | 3300005535 | Bacteria | 3280 |
| 62 | Ga0070697_100015509 | 3300005536 | Bacteria | 5982 |
| 63 | Ga0070697_100037614 | 3300005536 | Bacteria | 3909 |
| 64 | Ga0070697_100039730 | 3300005536 | Bacteria | 3805 |
| 65 | Ga0070697_100095081 | 3300005536 | Bacteria | 2470 |
| 66 | Ga0070697_100158205 | 3300005536 | Bacteria | 1913 |
| 67 | Ga0070697_100296524 | 3300005536 | Bacteria | 1389 |
| 68 | Ga0070695_100323207 | 3300005545 | Bacteria | 1148 |
| 69 | Ga0070665_100016899 | 3300005548 | Bacteria | 7316 |
| 70 | Ga0070665_100108176 | 3300005548 | Bacteria | 2783 |
| 71 | Ga0070665_100146478 | 3300005548 | Bacteria | 2364 |
| 72 | Ga0070704_100333625 | 3300005549 | Bacteria | 1275 |
| 73 | Ga0068854_100323676 | 3300005578 | Bacteria | 1254 |
| 74 | Ga0068856_100099785 | 3300005614 | Bacteria | 2895 |
| 75 | Ga0068856_100192685 | 3300005614 | Bacteria | 2052 |
| 76 | Ga0068852_100074445 | 3300005616 | Bacteria | 2991 |
| 77 | Ga0068852_100358311 | 3300005616 | Bacteria | 1426 |
| 78 | Ga0068859_100088653 | 3300005617 | Bacteria | 3143 |
| 79 | Ga0068863_100085213 | 3300005841 | Bacteria | 2995 |
| 80 | Ga0068863_100173289 | 3300005841 | Bacteria | 2070 |
| 81 | Ga0068858_100022548 | 3300005842 | Bacteria | 5874 |
| 82 | Ga0068860_100019276 | 3300005843 | Bacteria | 6622 |
| 83 | Ga0068860_100437607 | 3300005843 | Bacteria | 1298 |
| 84 | Ga0068862_100304011 | 3300005844 | Bacteria | 1468 |
| 85 | Ga0081455_10156003 | 3300005937 | Bacteria | 1755 |
| 86 | Ga0081539_10010606 | 3300005985 | Bacteria | 7443 |
| 87 | Ga0081539_10142109 | 3300005985 | Bacteria | 1165 |
| 88 | Ga0075365_10004901 | 3300006038 | Bacteria | 7154 |
| 89 | Ga0075365_10105146 | 3300006038 | Bacteria | 1936 |
| 90 | Ga0075432_10030072 | 3300006058 | Bacteria | 1877 |
| 91 | Ga0070715_10018843 | 3300006163 | Bacteria | 2637 |
| 92 | Ga0070715_10126279 | 3300006163 | Bacteria | 1225 |
| 93 | Ga0070716_100267128 | 3300006173 | Bacteria | 1173 |
| 94 | Ga0070712_100402671 | 3300006175 | Bacteria | 1131 |
| 95 | Ga0097621_100059554 | 3300006237 | Bacteria | 3127 |
| 96 | Ga0068871_100030448 | 3300006358 | Bacteria | 4250 |
| 97 | Ga0075428_100019867 | 3300006844 | Bacteria | 7437 |
| 98 | Ga0075430_100162762 | 3300006846 | Bacteria | 1857 |
| 99 | Ga0075431_100209930 | 3300006847 | Bacteria | 1989 |
| 100 | Ga0075434_100024483 | 3300006871 | Archaea | 5901 |
| 101 | Ga0075429_100035009 | 3300006880 | Bacteria | 4364 |
| 102 | Ga0068865_100030435 | 3300006881 | Bacteria | 3591 |
| 103 | Ga0075436_100009927 | 3300006914 | Bacteria | 6510 |
| 104 | Ga0097620_100088655 | 3300006931 | Bacteria | 3143 |
| 105 | Ga0075435_100004917 | 3300007076 | Bacteria | 9266 |
| 106 | Ga0075435_100034821 | 3300007076 | Archaea | 3992 |
| 107 | Ga0099794_10052902 | 3300007265 | Bacteria | 1958 |
| 108 | Ga0099794_10088948 | 3300007265 | Bacteria | 1531 |
| 109 | Ga0099794_10136817 | 3300007265 | Bacteria | 1239 |
| 110 | Ga0099795_10021718 | 3300007788 | Bacteria | 2109 |
| 111 | Ga0105240_10548733 | 3300009093 | Bacteria | 1279 |
| 112 | Ga0105247_10137608 | 3300009101 | Bacteria | 1597 |
| 113 | Ga0114129_10466847 | 3300009147 | Unclassified | 1653 |
| 114 | Ga0105243_10025042 | 3300009148 | Bacteria | 4557 |
| 115 | Ga0105248_10013890 | 3300009177 | Bacteria | 8860 |
| 116 | Ga0105248_10022225 | 3300009177 | Bacteria | 7033 |
| 117 | Ga0105237_10019832 | 3300009545 | Bacteria | 6942 |
| 118 | Ga0105237_10030141 | 3300009545 | Bacteria | 5512 |
| 119 | Ga0105237_10057781 | 3300009545 | Unclassified | 3882 |
| 120 | Ga0105237_10602222 | 3300009545 | Unclassified | 1106 |
| 121 | Ga0105249_10034580 | 3300009553 | Bacteria | 4581 |
| 122 | Ga0105249_10128524 | 3300009553 | Bacteria | 2416 |
| 123 | Ga0123341_1002866 | 3300009765 | Bacteria | 14487 |
| 124 | Ga0123342_1019294 | 3300009766 | Bacteria | 5238 |
| 125 | Ga0099796_10004789 | 3300010159 | Bacteria | 3311 |
| 126 | Ga0105239_10008923 | 3300010375 | Bacteria | 11345 |
| 127 | Ga0105239_10009764 | 3300010375 | Bacteria | 10788 |
| 128 | Ga0105239_10191055 | 3300010375 | Bacteria | 2292 |
| 129 | Ga0105239_10531871 | 3300010375 | Bacteria | 1338 |
| 130 | Ga0105246_10008492 | 3300011119 | Bacteria | 6315 |
| 131 | Ga0157371_10000010 | 3300013102 | Bacteria | 384921 |
| 132 | Ga0157369_10007546 | 3300013105 | Bacteria | 12515 |
| 133 | Ga0157369_10047020 | 3300013105 | Bacteria | 4687 |
| 134 | Ga0157369_10323700 | 3300013105 | Bacteria | 1602 |
| 135 | Ga0157374_10011419 | 3300013296 | Bacteria | 7689 |
| 136 | Ga0163162_10017404 | 3300013306 | Bacteria | 7030 |
| 137 | Ga0163162_10121598 | 3300013306 | Bacteria | 2715 |
| 138 | Ga0157372_10000042 | 3300013307 | Bacteria | 157651 |
| 139 | Ga0157375_10002517 | 3300013308 | Bacteria | 15906 |
| 140 | Ga0157375_10040322 | 3300013308 | Bacteria | 4500 |
| 141 | Ga0163163_10169228 | 3300014325 | Bacteria | 2231 |
| 142 | Ga0157380_10110424 | 3300014326 | Bacteria | 2309 |
| 143 | Ga0182008_10047706 | 3300014497 | Bacteria | 2128 |
| 144 | Ga0157379_10657412 | 3300014968 | Unclassified | 981 |
| 145 | Ga0157376_10044208 | 3300014969 | Bacteria | 3660 |
| 146 | Ga0163161_10009972 | 3300017792 | Bacteria | 6580 |
| 147 | Ga0213872_10001762 | 3300021361 | Bacteria | 13555 |
| 148 | Ga0213872_10017616 | 3300021361 | Unclassified | 3299 |
| 149 | Ga0213872_10021111 | 3300021361 | Bacteria | 2998 |
| 150 | Ga0213872_10053213 | 3300021361 | Bacteria | 1836 |
| 151 | Ga0213874_10013408 | 3300021377 | Bacteria | 2123 |
| 152 | Ga0209435_100010 | 3300025206 | Bacteria | 475373 |
| 153 | Ga0209566_100224 | 3300025225 | Bacteria | 55927 |
| 154 | Ga0209566_100804 | 3300025225 | Bacteria | 16378 |
| 155 | Ga0209674_100043 | 3300025226 | Bacteria | 369728 |
| 156 | Ga0209674_100251 | 3300025226 | Bacteria | 44867 |
| 157 | Ga0207425_1000034 | 3300025245 | Bacteria | 227886 |
| 158 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 159 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 160 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 161 | Ga0209026_1000178 | 3300025250 | Bacteria | 96368 |
| 162 | Ga0209677_103747 | 3300025253 | Bacteria | 4740 |
| 163 | Ga0209148_1000304 | 3300025254 | Bacteria | 70717 |
| 164 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 165 | Ga0209129_1000094 | 3300025258 | Bacteria | 172051 |
| 166 | Ga0209233_1018881 | 3300025261 | Bacteria | 1844 |
| 167 | Ga0209673_1007651 | 3300025273 | Bacteria | 4930 |
| 168 | Ga0209130_1026996 | 3300025284 | Bacteria | 1224 |
| 169 | Ga0209676_1000065 | 3300025292 | Bacteria | 318605 |
| 170 | Ga0209676_1001898 | 3300025292 | Bacteria | 17041 |
| 171 | Ga0209025_1000184 | 3300025294 | Bacteria | 155611 |
| 172 | Ga0209758_1000061 | 3300025297 | Bacteria | 320172 |
| 173 | Ga0209758_1000159 | 3300025297 | Bacteria | 155588 |
| 174 | Ga0209758_1030228 | 3300025297 | Bacteria | 2248 |
| 175 | Ga0209050_1003257 | 3300025298 | Bacteria | 12215 |
| 176 | Ga0209050_1025431 | 3300025298 | Bacteria | 2012 |
| 177 | Ga0209050_1035450 | 3300025298 | Bacteria | 1474 |
| 178 | Ga0207426_1021609 | 3300025302 | Bacteria | 2223 |
| 179 | Ga0209051_1003976 | 3300025303 | Bacteria | 9396 |
| 180 | Ga0209051_1025340 | 3300025303 | Bacteria | 2416 |
| 181 | Ga0209257_1000013 | 3300025304 | Bacteria | 1047305 |
| 182 | Ga0209257_1000504 | 3300025304 | Bacteria | 68999 |
| 183 | Ga0207653_10008309 | 3300025885 | Bacteria | 3236 |
| 184 | Ga0207653_10019751 | 3300025885 | Bacteria | 2126 |
| 185 | Ga0207692_10101262 | 3300025898 | Bacteria | 1582 |
| 186 | Ga0207642_10059203 | 3300025899 | Bacteria | 1770 |
| 187 | Ga0207680_10008276 | 3300025903 | Bacteria | 5097 |
| 188 | Ga0207685_10010530 | 3300025905 | Bacteria | 2735 |
| 189 | Ga0207699_10008443 | 3300025906 | Bacteria | 5084 |
| 190 | Ga0207645_10005397 | 3300025907 | Bacteria | 9273 |
| 191 | Ga0207684_10494497 | 3300025910 | Bacteria | 1049 |
| 192 | Ga0207684_10500741 | 3300025910 | Bacteria | 1041 |
| 193 | Ga0207707_10009640 | 3300025912 | Bacteria | 8377 |
| 194 | Ga0207707_10253345 | 3300025912 | Bacteria | 1529 |
| 195 | Ga0207671_10011927 | 3300025914 | Bacteria | 7027 |
| 196 | Ga0207671_10016362 | 3300025914 | Bacteria | 5766 |
| 197 | Ga0207671_10307724 | 3300025914 | Unclassified | 1252 |
| 198 | Ga0207693_10199443 | 3300025915 | Bacteria | 1574 |
| 199 | Ga0207693_10341517 | 3300025915 | Unclassified | 1172 |
| 200 | Ga0207649_10044907 | 3300025920 | Bacteria | 2707 |
| 201 | Ga0207646_10142106 | 3300025922 | Bacteria | 2162 |
| 202 | Ga0207646_10215719 | 3300025922 | Unclassified | 1733 |
| 203 | Ga0207681_10380911 | 3300025923 | Bacteria | 1135 |
| 204 | Ga0207687_10011037 | 3300025927 | Bacteria | 5905 |
| 205 | Ga0207664_10293581 | 3300025929 | Bacteria | 1429 |
| 206 | Ga0207664_10321674 | 3300025929 | Bacteria | 1365 |
| 207 | Ga0207644_10060249 | 3300025931 | Bacteria | 2746 |
| 208 | Ga0207706_10003934 | 3300025933 | Bacteria | 14082 |
| 209 | Ga0207706_10018087 | 3300025933 | Bacteria | 6341 |
| 210 | Ga0207686_10186029 | 3300025934 | Bacteria | 1477 |
| 211 | Ga0207709_10124676 | 3300025935 | Bacteria | 1745 |
| 212 | Ga0207665_10286625 | 3300025939 | Bacteria | 1227 |
| 213 | Ga0207711_10006116 | 3300025941 | Bacteria | 10167 |
| 214 | Ga0207711_10139428 | 3300025941 | Bacteria | 2181 |
| 215 | Ga0207689_10042828 | 3300025942 | Bacteria | 3743 |
| 216 | Ga0207667_10112612 | 3300025949 | Bacteria | 2806 |
| 217 | Ga0207667_10644609 | 3300025949 | Bacteria | 1065 |
| 218 | Ga0207712_10018179 | 3300025961 | Bacteria | 4575 |
| 219 | Ga0207712_10324877 | 3300025961 | Bacteria | 1271 |
| 220 | Ga0207668_10085314 | 3300025972 | Unclassified | 2304 |
| 221 | Ga0207658_10015533 | 3300025986 | Bacteria | 5223 |
| 222 | Ga0207677_10022319 | 3300026023 | Bacteria | 3888 |
| 223 | Ga0207703_10024365 | 3300026035 | Bacteria | 4762 |
| 224 | Ga0207678_10007546 | 3300026067 | Bacteria | 9614 |
| 225 | Ga0207678_10031341 | 3300026067 | Bacteria | 4638 |
| 226 | Ga0207678_10085406 | 3300026067 | Unclassified | 2698 |
| 227 | Ga0207678_10371497 | 3300026067 | Bacteria | 1235 |
| 228 | Ga0207702_10075722 | 3300026078 | Bacteria | 2908 |
| 229 | Ga0207702_10162980 | 3300026078 | Bacteria | 2038 |
| 230 | Ga0207648_10022742 | 3300026089 | Bacteria | 5626 |
| 231 | Ga0207676_10363510 | 3300026095 | Bacteria | 1342 |
| 232 | Ga0207674_10037779 | 3300026116 | Bacteria | 5018 |
| 233 | Ga0207683_10007919 | 3300026121 | Bacteria | 9093 |
| 234 | Ga0209179_1007755 | 3300027512 | Bacteria | 1783 |
| 235 | Ga0209588_1001679 | 3300027671 | Bacteria | 5827 |
| 236 | Ga0268266_10159817 | 3300028379 | Bacteria | 2037 |
| 237 | Ga0268265_10154470 | 3300028380 | Bacteria | 1940 |
| 238 | Ga0268264_10072001 | 3300028381 | Unclassified | 2930 |
| 239 | Ga0268264_10478415 | 3300028381 | Bacteria | 1211 |
| 240 | Ga0307515_10002427 | 3300028794 | Bacteria | 40656 |
| 241 | Ga0307515_10028947 | 3300028794 | Bacteria | 9388 |
| 242 | Ga0307515_10178602 | 3300028794 | Bacteria | 2083 |
| 243 | Ga0265338_10006059 | 3300028800 | Bacteria | 15526 |
| 244 | Ga0265338_10030280 | 3300028800 | Bacteria | 5337 |
| 245 | Ga0265338_10083833 | 3300028800 | Bacteria | 2664 |
| 246 | Ga0316181_1013750 | 3300030744 | Bacteria | 4862 |
| 247 | Ga0265770_1000128 | 3300030878 | Bacteria | 9195 |
| 248 | Ga0265760_10000177 | 3300031090 | Bacteria | 16628 |
| 249 | Ga0265330_10057018 | 3300031235 | Unclassified | 1704 |
| 250 | Ga0265320_10015692 | 3300031240 | Bacteria | 4274 |
| 251 | Ga0265325_10004468 | 3300031241 | Bacteria | 8835 |
| 252 | Ga0265340_10006498 | 3300031247 | Bacteria | 6431 |
| 253 | Ga0265340_10041787 | 3300031247 | Bacteria | 2253 |
| 254 | Ga0265340_10044968 | 3300031247 | Bacteria | 2159 |
| 255 | Ga0265339_10000503 | 3300031249 | Bacteria | 30482 |
| 256 | Ga0265316_10010656 | 3300031344 | Bacteria | 8358 |
| 257 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 258 | Ga0307513_10002593 | 3300031456 | Bacteria | 24972 |
| 259 | Ga0307513_10048472 | 3300031456 | Bacteria | 4611 |
| 260 | Ga0307513_10271482 | 3300031456 | Bacteria | 1479 |
| 261 | Ga0307408_100004109 | 3300031548 | Bacteria | 9932 |
| 262 | Ga0265313_10000099 | 3300031595 | Bacteria | 88958 |
| 263 | Ga0307508_10126733 | 3300031616 | Bacteria | 2156 |
| 264 | Ga0265314_10005117 | 3300031711 | Bacteria | 11938 |
| 265 | Ga0265342_10012537 | 3300031712 | Bacteria | 5738 |
| 266 | Ga0307516_10088512 | 3300031730 | Bacteria | 2929 |
| 267 | Ga0307516_10213024 | 3300031730 | Bacteria | 1645 |
| 268 | Ga0307405_10004876 | 3300031731 | Bacteria | 6404 |
| 269 | Ga0307406_10017470 | 3300031901 | Bacteria | 4177 |
| 270 | Ga0307412_10113248 | 3300031911 | Bacteria | 1941 |
| 271 | Ga0307415_100007992 | 3300032126 | Bacteria | 5833 |
| 272 | Ga0307507_10022362 | 3300033179 | Bacteria | 6989 |
| 273 | Ga0307510_10165207 | 3300033180 | Bacteria | 1803 |
| 274 | Ga0373945_0026235 | 3300035116 | Bacteria | 2029 |
| 275 | Ga0373947_0030872 | 3300035725 | Bacteria | 3151 |
| 276 | Ga0372808_005184 | 3300036459 | Bacteria | 1707 |
| 277 | Ga0395899_0000401 | 3300037312 | Bacteria | 50789 |
| 278 | Ga0395899_0006184 | 3300037312 | Bacteria | 9278 |
| 279 | Ga0395899_0425105 | 3300037312 | Bacteria | 875 |
| 280 | Ga0395900_0033235 | 3300037418 | Bacteria | 5309 |
| 281 | Ga0395900_0406486 | 3300037418 | Bacteria | 1324 |
| 282 | Ga0395898_0099719 | 3300037466 | Bacteria | 2789 |
| 283 | Ga0395905_0000872 | 3300037471 | Bacteria | 39336 |
| 284 | Ga0395905_0022154 | 3300037471 | Bacteria | 6011 |
| 285 | Ga0395905_0114802 | 3300037471 | Bacteria | 2530 |
| 286 | Ga0436364_0178301 | 3300037853 | Bacteria | 6943 |
| 287 | Ga0436364_1111527 | 3300037853 | Bacteria | 2607 |
| 288 | Ga0436364_1455769 | 3300037853 | Bacteria | 2480 |
| 289 | Ga0242419_002725 | 3300038698 | Bacteria | 1164 |
| 290 | Ga0436361_0093651 | 3300039447 | Bacteria | 2423 |
| 291 | Ga0436361_0576920 | 3300039447 | Bacteria | 94641 |
| 292 | Ga0436361_0602027 | 3300039447 | Bacteria | 7208 |
| 293 | Ga0436361_0654582 | 3300039447 | Bacteria | 9126 |
| 294 | Ga0436361_1068692 | 3300039447 | Bacteria | 2028 |
| 295 | Ga0436361_1144974 | 3300039447 | Unclassified | 1182 |
| 296 | Ga0436363_0064738 | 3300039450 | Bacteria | 4813 |
| 297 | Ga0451791_0456434 | 3300041451 | Bacteria | 1075 |
| 298 | Ga0466969_0012766 | 3300044656 | Bacteria | 4427 |
| 299 | Ga0466969_0083979 | 3300044656 | Bacteria | 1516 |
| 300 | Ga0466972_0000127 | 3300044658 | Bacteria | 63923 |
| 301 | Ga0466982_0000004 | 3300044672 | Bacteria | 386724 |
| 302 | Ga0466965_0023867 | 3300044683 | Bacteria | 2955 |
| 303 | Ga0466966_0002115 | 3300044684 | Bacteria | 12903 |
| 304 | Ga0466966_0019063 | 3300044684 | Bacteria | 4520 |
| 305 | Ga0466966_0019698 | 3300044684 | Bacteria | 4439 |
| 306 | Ga0466966_0233442 | 3300044684 | Bacteria | 1109 |
| 307 | Ga0466961_0004150 | 3300044693 | Bacteria | 9046 |
| 308 | Ga0466961_0040225 | 3300044693 | Bacteria | 2998 |
| 309 | Ga0466970_0000159 | 3300044765 | Bacteria | 32178 |
| 310 | Ga0466970_0045323 | 3300044765 | Bacteria | 2341 |
| 311 | Ga0466957_0027612 | 3300044842 | Bacteria | 3375 |
| 312 | Ga0466957_0044781 | 3300044842 | Unclassified | 2682 |
| 313 | Ga0466960_0001187 | 3300044901 | Bacteria | 9389 |
| 314 | Ga0466960_0021917 | 3300044901 | Unclassified | 2851 |
| 315 | Ga0466960_0045939 | 3300044901 | Bacteria | 2088 |
| 316 | Ga0466959_0025887 | 3300045049 | Bacteria | 4351 |
| 317 | Ga0466959_0036510 | 3300045049 | Bacteria | 3632 |
| 318 | Ga0466959_0096267 | 3300045049 | Bacteria | 2122 |
| 319 | Ga0466958_0002885 | 3300045836 | Bacteria | 8767 |
| 320 | Ga0466958_0154678 | 3300045836 | Bacteria | 1447 |
| 321 | Ga0466958_0168764 | 3300045836 | Bacteria | 1385 |
| 322 | Ga0495590_0030829 | 3300046457 | Bacteria | 1878 |
| 323 | Ga0495590_0048684 | 3300046457 | Bacteria | 1479 |
| 324 | Ga0495591_000537 | 3300046458 | Bacteria | 29393 |
| 325 | Ga0495629_0000037 | 3300046459 | Bacteria | 117099 |
| 326 | Ga0495583_0002496 | 3300046506 | Bacteria | 15613 |
| 327 | Ga0495606_0001399 | 3300046507 | Bacteria | 32508 |
| 328 | Ga0495606_0001402 | 3300046507 | Bacteria | 32434 |
| 329 | Ga0495610_0003212 | 3300046512 | Bacteria | 12940 |
| 330 | Ga0495610_0010882 | 3300046512 | Bacteria | 5614 |
| 331 | Ga0495610_0016675 | 3300046512 | Bacteria | 4218 |
| 332 | Ga0495610_0062862 | 3300046512 | Bacteria | 1760 |
| 333 | Ga0495616_0073892 | 3300046513 | Bacteria | 1644 |
| 334 | Ga0495620_0000998 | 3300046515 | Bacteria | 17497 |
| 335 | Ga0495628_0010130 | 3300046516 | Bacteria | 8016 |
| 336 | Ga0495632_0000763 | 3300046519 | Bacteria | 28910 |
| 337 | Ga0495643_0018942 | 3300046522 | Bacteria | 3987 |
| 338 | Ga0495643_0102091 | 3300046522 | Bacteria | 1469 |
| 339 | Ga0495648_0000230 | 3300046524 | Bacteria | 64054 |
| 340 | Ga0495648_0098025 | 3300046524 | Bacteria | 1624 |
| 341 | Ga0495654_0006138 | 3300046530 | Bacteria | 6879 |
| 342 | Ga0495654_0071984 | 3300046530 | Bacteria | 1637 |
| 343 | Ga0495640_0035889 | 3300046533 | Bacteria | 3507 |
| 344 | Ga0495633_0027160 | 3300046558 | Bacteria | 2800 |
| 345 | Ga0495634_0065849 | 3300046642 | Bacteria | 2400 |
| 346 | Ga0495661_0000532 | 3300046665 | Bacteria | 39216 |
| 347 | Ga0495660_0052171 | 3300046810 | Bacteria | 2223 |
| 348 | Ga0495674_0362812 | 3300047319 | Bacteria | 1174 |
| 349 | Ga0495680_0159471 | 3300047322 | Unclassified | 1639 |
| 350 | Ga0495683_0000320 | 3300047323 | Bacteria | 40260 |
| 351 | Ga0495673_0000186 | 3300047469 | Bacteria | 100563 |
| 352 | Ga0495681_0002727 | 3300047470 | Bacteria | 12496 |
| 353 | Ga0495681_0003614 | 3300047470 | Bacteria | 10756 |
| 354 | Ga0495686_0024626 | 3300047472 | Bacteria | 3952 |
| 355 | Ga0495686_0075392 | 3300047472 | Bacteria | 2068 |
| 356 | Ga0496101_0079684 | 3300048904 | Bacteria | 2418 |
| 357 | Ga0496101_0084564 | 3300048904 | Bacteria | 2350 |
| 358 | Ga0496103_0001512 | 3300048906 | Bacteria | 15549 |
| 359 | Ga0496104_0310389 | 3300048907 | Bacteria | 1490 |
| 360 | Ga0496104_0373279 | 3300048907 | Bacteria | 1339 |
| 361 | Ga0496113_0082176 | 3300048916 | Bacteria | 2470 |
| 362 | Ga0496115_0000158 | 3300048918 | Bacteria | 63464 |
| 363 | Ga0496115_0001891 | 3300048918 | Bacteria | 14988 |
| 364 | Ga0496115_0132725 | 3300048918 | Bacteria | 2052 |
| 365 | Ga0496116_0022624 | 3300048919 | Bacteria | 4705 |
| 366 | Ga0496116_0029040 | 3300048919 | Bacteria | 3993 |
| 367 | Ga0496116_0030233 | 3300048919 | Bacteria | 3894 |
| 368 | Ga0496117_0034192 | 3300048920 | Bacteria | 3834 |
| 369 | Ga0496117_0174525 | 3300048920 | Bacteria | 1243 |
| 370 | Ga0496118_0032001 | 3300048921 | Bacteria | 4345 |
| 371 | Ga0496118_0088683 | 3300048921 | Bacteria | 2138 |
| 372 | Ga0496119_0000510 | 3300048922 | Bacteria | 52939 |
| 373 | Ga0496119_0011826 | 3300048922 | Bacteria | 7170 |
| 374 | Ga0496119_0174578 | 3300048922 | Bacteria | 1132 |
| 375 | Ga0496120_0091987 | 3300048923 | Bacteria | 1619 |
| 376 | Ga0496121_0002329 | 3300048924 | Bacteria | 29339 |
| 377 | Ga0496121_0019649 | 3300048924 | Bacteria | 6744 |
| 378 | Ga0496121_0032365 | 3300048924 | Bacteria | 4754 |
| 379 | Ga0496121_0047233 | 3300048924 | Bacteria | 3675 |
| 380 | Ga0496122_0000107 | 3300048925 | Bacteria | 193163 |
| 381 | Ga0496122_0008719 | 3300048925 | Bacteria | 10854 |
| 382 | Ga0496122_0020299 | 3300048925 | Bacteria | 6013 |
| 383 | Ga0496122_0036949 | 3300048925 | Bacteria | 3940 |
| 384 | Ga0496122_0038100 | 3300048925 | Bacteria | 3858 |
| 385 | Ga0496123_0000063 | 3300048926 | Bacteria | 216072 |
| 386 | Ga0496123_0008119 | 3300048926 | Bacteria | 9704 |
| 387 | Ga0496123_0021416 | 3300048926 | Bacteria | 5025 |
| 388 | Ga0496123_0035166 | 3300048926 | Bacteria | 3575 |
| 389 | Ga0496124_0019735 | 3300048927 | Bacteria | 6259 |
| 390 | Ga0496124_0020417 | 3300048927 | Bacteria | 6120 |
| 391 | Ga0496124_0045289 | 3300048927 | Bacteria | 3772 |
| 392 | Ga0496124_0051399 | 3300048927 | Bacteria | 3507 |
| 393 | Ga0496125_0005448 | 3300048928 | Bacteria | 14138 |
| 394 | Ga0496126_0007322 | 3300048929 | Bacteria | 12121 |
| 395 | Ga0496126_0043949 | 3300048929 | Bacteria | 4118 |
| 396 | Ga0496126_0272543 | 3300048929 | Bacteria | 1404 |
| 397 | Ga0501032_0040524 | 3300049569 | Bacteria | 3166 |
| 398 | Ga0501032_0068253 | 3300049569 | Bacteria | 2374 |
| 399 | Ga0501033_0041388 | 3300049570 | Bacteria | 3438 |
| 400 | Ga0501034_0042703 | 3300049571 | Bacteria | 4590 |
| 401 | Ga0501034_0132759 | 3300049571 | Bacteria | 2473 |
| 402 | Ga0501034_0400263 | 3300049571 | Bacteria | 1296 |
| 403 | Ga0501038_0059948 | 3300049574 | Bacteria | 3258 |
| 404 | Ga0501038_0125475 | 3300049574 | Bacteria | 2113 |
| 405 | Ga0501043_0227844 | 3300049579 | Bacteria | 1440 |
| 406 | Ga0501047_0000850 | 3300049581 | Bacteria | 31408 |
| 407 | Ga0501047_0013929 | 3300049581 | Bacteria | 7640 |
| 408 | Ga0501047_0057377 | 3300049581 | Bacteria | 3765 |
| 409 | Ga0501047_0083155 | 3300049581 | Bacteria | 3077 |
| 410 | Ga0501047_0240515 | 3300049581 | Bacteria | 1661 |
| 411 | Ga0501070_0152299 | 3300049586 | Bacteria | 1908 |
| 412 | Ga0501073_0003935 | 3300049589 | Bacteria | 11142 |
| 413 | Ga0501073_0092160 | 3300049589 | Bacteria | 2106 |
| 414 | Ga0501077_0015630 | 3300049593 | Bacteria | 4780 |
| 415 | Ga0501080_0121926 | 3300049742 | Bacteria | 2415 |
| 416 | Ga0501269_000016 | 3300049766 | Bacteria | 58863 |
| 417 | Ga0501035_0000238 | 3300049822 | Bacteria | 65886 |
| 418 | Ga0501044_0002163 | 3300049823 | Bacteria | 22528 |
| 419 | Ga0501044_0029336 | 3300049823 | Bacteria | 5801 |
| 420 | Ga0501044_0176978 | 3300049823 | Bacteria | 2102 |
| 421 | Ga0501044_0199369 | 3300049823 | Bacteria | 1960 |
| 422 | nmdc:mga05p37_102488_c1 | 3300050507 | Bacteria | 3525 |
| 423 | nmdc:mga05p37_147575_c1 | 3300050507 | Bacteria | 2879 |
| 424 | nmdc:mga09592_207356_c1 | 3300050508 | Bacteria | 1698 |
| 425 | nmdc:mga0qj67_199992_c1 | 3300050509 | Bacteria | 1624 |
| 426 | nmdc:mga06r32_49844_c1 | 3300050510 | Bacteria | 4006 |
| 427 | nmdc:mga0n895_45503_c1 | 3300050512 | Archaea | 4283 |
| 428 | nmdc:mga0n895_8184_c1 | 3300050512 | Bacteria | 9038 |
| 429 | nmdc:mga0rr50_3298_c1 | 3300050513 | Bacteria | 9266 |
| 430 | nmdc:mga08x19_1479_c1 | 3300050514 | Bacteria | 14556 |
| 431 | nmdc:mga08x19_78993_c1 | 3300050514 | Bacteria | 2157 |
| 432 | nmdc:mga0a205_106095_c1 | 3300050515 | Bacteria | 2708 |
| 433 | nmdc:mga0a205_10744_c1 | 3300050515 | Bacteria | 8416 |
| 434 | nmdc:mga0a205_147596_c1 | 3300050515 | Archaea | 2252 |
| 435 | Ga0500610_0066486 | 3300053079 | Bacteria | 1880 |
| 436 | Ga0495619_0089018 | 3300053085 | Bacteria | 2088 |
| 437 | Ga0500644_0001980 | 3300053088 | Bacteria | 5222 |
| 438 | Ga0500651_0001456 | 3300053093 | Bacteria | 11910 |
| 439 | Ga0500555_001763 | 3300053103 | Bacteria | 6467 |
| 440 | Ga0500556_0000097 | 3300053104 | Bacteria | 81329 |
| 441 | Ga0500556_0021320 | 3300053104 | Bacteria | 2088 |
| 442 | Ga0500593_000169 | 3300053117 | Bacteria | 26386 |
| 443 | Ga0500595_020216 | 3300053119 | Bacteria | 2401 |
| 444 | Ga0500608_000191 | 3300053122 | Bacteria | 24609 |
| 445 | Ga0500652_108143 | 3300053131 | Unclassified | 1162 |
| 446 | Ga0500658_0032375 | 3300053134 | Bacteria | 2050 |
| 447 | Ga0500559_0093628 | 3300053136 | Bacteria | 1378 |
| 448 | Ga0500561_0012313 | 3300053137 | Bacteria | 1822 |
| 449 | Ga0500564_011335 | 3300053138 | Bacteria | 3929 |
| 450 | Ga0500568_0000514 | 3300053139 | Bacteria | 28491 |
| 451 | Ga0500568_0002443 | 3300053139 | Bacteria | 10935 |
| 452 | Ga0500568_0026664 | 3300053139 | Bacteria | 2423 |
| 453 | Ga0500577_0021776 | 3300053142 | Bacteria | 2117 |
| 454 | Ga0500590_018124 | 3300053148 | Bacteria | 3644 |
| 455 | Ga0500600_0072975 | 3300053149 | Bacteria | 1877 |
| 456 | Ga0500636_0003875 | 3300053177 | Bacteria | 8444 |
| 457 | Ga0500636_0062574 | 3300053177 | Bacteria | 2170 |
| 458 | Ga0500645_003789 | 3300053730 | Bacteria | 6014 |
| 459 | Ga0500645_043330 | 3300053730 | Bacteria | 1325 |
| 460 | Ga0500609_002688 | 3300053731 | Bacteria | 2531 |
| 461 | Ga0500661_010546 | 3300055283 | Bacteria | 1682 |
| 462 | Ga0501082_0006824 | 3300060353 | Bacteria | 9869 |
| 463 | Ga0466962_0020843 | 3300061719 | Bacteria | 3150 |
| 464 | Ga0466962_0123292 | 3300061719 | Bacteria | 1251 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100206877 | Ga0070714_1002068772 | 253 |
| 2 | 3300025929 | Ga0207664_10321674 | Ga0207664_103216741 | 253 |
| 3 | 3300037312 | Ga0395899_0425105 | Ga0395899_0425105_97_864 | 254 |
| 4 | 3300053117 | Ga0500593_000169 | Ga0500593_000169_3466_4356 | 258 |
| 5 | 3300005435 | Ga0070714_100069362 | Ga0070714_1000693622 | 261 |
| 6 | 3300028800 | Ga0265338_10006059 | Ga0265338_1000605911 | 263 |
| 7 | 3300031730 | Ga0307516_10213024 | Ga0307516_102130242 | 266 |
| 8 | 3300005841 | Ga0068863_100085213 | Ga0068863_1000852132 | 267 |
| 9 | 3300048922 | Ga0496119_0011826 | Ga0496119_0011826_5481_6401 | 267 |
| 10 | 3300053730 | Ga0500645_043330 | Ga0500645_043330_324_1265 | 267 |
| 11 | 3300044658 | Ga0466972_0000127 | Ga0466972_0000127_46915_47721 | 268 |
| 12 | iso_pu_bacteria | 2984527788 | 2984531423 | 268 |
| 13 | iso_pu_bacteria | 2984532647 | 2984532678 | 268 |
| 14 | 3300037853 | Ga0436364_1111527 | Ga0436364_1111527_532_1452 | 269 |
| 15 | 3300048918 | Ga0496115_0132725 | Ga0496115_0132725_197_1117 | 269 |
| 16 | iso_pu_bacteria | 2821111986 | 2821112462 | 269 |
| 17 | iso_pu_bacteria | 2904595352 | 2904600364 | 269 |
| 18 | iso_pu_bacteria | 8007375930 | 8007377458 | 269 |
| 19 | iso_pu_bacteria | 2946053406 | 2946055091 | 270 |
| 20 | 3300025949 | Ga0207667_10644609 | Ga0207667_106446091 | 271 |
| 21 | 3300025972 | Ga0207668_10085314 | Ga0207668_100853142 | 272 |
| 22 | 3300003841 | Ga0055541_1002029 | Ga0055541_10020293 | 273 |
| 23 | 3300005329 | Ga0070683_100079799 | Ga0070683_1000797992 | 273 |
| 24 | 3300005345 | Ga0070692_10056728 | Ga0070692_100567282 | 273 |
| 25 | 3300005458 | Ga0070681_10126869 | Ga0070681_101268692 | 273 |
| 26 | 3300005535 | Ga0070684_100061753 | Ga0070684_1000617532 | 273 |
| 27 | 3300005578 | Ga0068854_100323676 | Ga0068854_1003236761 | 273 |
| 28 | 3300005616 | Ga0068852_100074445 | Ga0068852_1000744453 | 273 |
| 29 | 3300013105 | Ga0157369_10007546 | Ga0157369_100075462 | 273 |
| 30 | 3300025225 | Ga0209566_100804 | Ga0209566_10080415 | 273 |
| 31 | 3300025912 | Ga0207707_10009640 | Ga0207707_100096405 | 273 |
| 32 | 3300026067 | Ga0207678_10371497 | Ga0207678_103714971 | 273 |
| 33 | 3300026116 | Ga0207674_10037779 | Ga0207674_100377793 | 273 |
| 34 | 3300046457 | Ga0495590_0048684 | Ga0495590_0048684_89_919 | 273 |
| 35 | 3300048923 | Ga0496120_0091987 | Ga0496120_0091987_71_904 | 273 |
| 36 | 3300048924 | Ga0496121_0032365 | Ga0496121_0032365_1627_2460 | 273 |
| 37 | 3300048929 | Ga0496126_0272543 | Ga0496126_0272543_155_988 | 273 |
| 38 | 3300002704 | JGI25155J39150_1000175 | JGI25155J39150_10001759 | 275 |
| 39 | 3300002705 | JGI25156J39149_1000379 | JGI25156J39149_10003799 | 275 |
| 40 | 3300002738 | JGI25154J39366_1000312 | JGI25154J39366_100031222 | 275 |
| 41 | 3300002741 | JGI25157J39369_1000421 | JGI25157J39369_10004219 | 275 |
| 42 | 3300025206 | Ga0209435_100010 | Ga0209435_100010440 | 275 |
| 43 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000011702 | 275 |
| 44 | 3300025250 | Ga0209026_1000001 | Ga0209026_1000001356 | 275 |
| 45 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011333 | 275 |
| 46 | 3300025898 | Ga0207692_10101262 | Ga0207692_101012622 | 275 |
| 47 | 3300006871 | Ga0075434_100024483 | Ga0075434_1000244838 | 277 |
| 48 | 3300007076 | Ga0075435_100034821 | Ga0075435_1000348213 | 277 |
| 49 | 3300007265 | Ga0099794_10088948 | Ga0099794_100889482 | 277 |
| 50 | 3300036459 | Ga0372808_005184 | Ga0372808_005184_595_1515 | 277 |
| 51 | 3300047322 | Ga0495680_0159471 | Ga0495680_0159471_99_1028 | 277 |
| 52 | 3300050512 | nmdc:mga0n895_45503_c1 | nmdc:mga0n895_45503_c1_1319_2152 | 277 |
| 53 | 3300050515 | nmdc:mga0a205_147596_c1 | nmdc:mga0a205_147596_c1_1388_2221 | 277 |
| 54 | 3300053103 | Ga0500555_001763 | Ga0500555_001763_2006_2893 | 277 |
| 55 | 3300003781 | Ga0055536_1002997 | Ga0055536_10029974 | 278 |
| 56 | 3300005262 | Ga0065165_1000907 | Ga0065165_10009078 | 278 |
| 57 | 3300025292 | Ga0209676_1001898 | Ga0209676_100189819 | 278 |
| 58 | 3300025298 | Ga0209050_1035450 | Ga0209050_10354501 | 278 |
| 59 | 3300028794 | Ga0307515_10002427 | Ga0307515_100024277 | 278 |
| 60 | 3300031456 | Ga0307513_10002593 | Ga0307513_100025936 | 278 |
| 61 | 3300053079 | Ga0500610_0066486 | Ga0500610_0066486_499_1395 | 279 |
| 62 | 3300005548 | Ga0070665_100108176 | Ga0070665_1001081762 | 280 |
| 63 | 3300053177 | Ga0500636_0003875 | Ga0500636_0003875_4366_5247 | 280 |
| 64 | 3300005328 | Ga0070676_10006900 | Ga0070676_100069003 | 282 |
| 65 | 3300005330 | Ga0070690_100032956 | Ga0070690_1000329564 | 282 |
| 66 | 3300005334 | Ga0068869_100019413 | Ga0068869_1000194134 | 282 |
| 67 | 3300005335 | Ga0070666_10004542 | Ga0070666_100045422 | 282 |
| 68 | 3300005338 | Ga0068868_100004001 | Ga0068868_1000040014 | 282 |
| 69 | 3300005347 | Ga0070668_100022968 | Ga0070668_1000229684 | 282 |
| 70 | 3300005353 | Ga0070669_100106360 | Ga0070669_1001063602 | 282 |
| 71 | 3300005354 | Ga0070675_100061455 | Ga0070675_1000614554 | 282 |
| 72 | 3300005355 | Ga0070671_100006589 | Ga0070671_1000065894 | 282 |
| 73 | 3300005367 | Ga0070667_100012524 | Ga0070667_1000125248 | 282 |
| 74 | 3300005456 | Ga0070678_100083989 | Ga0070678_1000839891 | 282 |
| 75 | 3300005457 | Ga0070662_100005630 | Ga0070662_1000056305 | 282 |
| 76 | 3300005459 | Ga0068867_100020762 | Ga0068867_1000207624 | 282 |
| 77 | 3300005548 | Ga0070665_100016899 | Ga0070665_1000168998 | 282 |
| 78 | 3300005841 | Ga0068863_100173289 | Ga0068863_1001732892 | 282 |
| 79 | 3300005842 | Ga0068858_100022548 | Ga0068858_1000225482 | 282 |
| 80 | 3300005843 | Ga0068860_100019276 | Ga0068860_1000192766 | 282 |
| 81 | 3300006237 | Ga0097621_100059554 | Ga0097621_1000595544 | 282 |
| 82 | 3300006358 | Ga0068871_100030448 | Ga0068871_1000304483 | 282 |
| 83 | 3300006881 | Ga0068865_100030435 | Ga0068865_1000304354 | 282 |
| 84 | 3300009177 | Ga0105248_10013890 | Ga0105248_100138903 | 282 |
| 85 | 3300009177 | Ga0105248_10022225 | Ga0105248_100222253 | 282 |
| 86 | 3300009553 | Ga0105249_10034580 | Ga0105249_100345803 | 282 |
| 87 | 3300009553 | Ga0105249_10128524 | Ga0105249_101285242 | 282 |
| 88 | 3300010375 | Ga0105239_10191055 | Ga0105239_101910552 | 282 |
| 89 | 3300011119 | Ga0105246_10008492 | Ga0105246_100084923 | 282 |
| 90 | 3300013296 | Ga0157374_10011419 | Ga0157374_100114199 | 282 |
| 91 | 3300013306 | Ga0163162_10017404 | Ga0163162_100174044 | 282 |
| 92 | 3300013308 | Ga0157375_10002517 | Ga0157375_100025178 | 282 |
| 93 | 3300013308 | Ga0157375_10040322 | Ga0157375_100403223 | 282 |
| 94 | 3300014325 | Ga0163163_10169228 | Ga0163163_101692281 | 282 |
| 95 | 3300014968 | Ga0157379_10657412 | Ga0157379_106574121 | 282 |
| 96 | 3300014969 | Ga0157376_10044208 | Ga0157376_100442084 | 282 |
| 97 | 3300017792 | Ga0163161_10009972 | Ga0163161_100099729 | 282 |
| 98 | 3300025899 | Ga0207642_10059203 | Ga0207642_100592032 | 282 |
| 99 | 3300025903 | Ga0207680_10008276 | Ga0207680_100082763 | 282 |
| 100 | 3300025907 | Ga0207645_10005397 | Ga0207645_100053974 | 282 |
| 101 | 3300025912 | Ga0207707_10253345 | Ga0207707_102533452 | 282 |
| 102 | 3300025920 | Ga0207649_10044907 | Ga0207649_100449073 | 282 |
| 103 | 3300025923 | Ga0207681_10380911 | Ga0207681_103809112 | 282 |
| 104 | 3300025927 | Ga0207687_10011037 | Ga0207687_100110378 | 282 |
| 105 | 3300025931 | Ga0207644_10060249 | Ga0207644_100602492 | 282 |
| 106 | 3300025933 | Ga0207706_10018087 | Ga0207706_100180875 | 282 |
| 107 | 3300025934 | Ga0207686_10186029 | Ga0207686_101860292 | 282 |
| 108 | 3300025941 | Ga0207711_10006116 | Ga0207711_100061165 | 282 |
| 109 | 3300025942 | Ga0207689_10042828 | Ga0207689_100428282 | 282 |
| 110 | 3300025961 | Ga0207712_10018179 | Ga0207712_100181793 | 282 |
| 111 | 3300025961 | Ga0207712_10324877 | Ga0207712_103248771 | 282 |
| 112 | 3300025986 | Ga0207658_10015533 | Ga0207658_100155335 | 282 |
| 113 | 3300026023 | Ga0207677_10022319 | Ga0207677_100223194 | 282 |
| 114 | 3300026035 | Ga0207703_10024365 | Ga0207703_100243656 | 282 |
| 115 | 3300026067 | Ga0207678_10085406 | Ga0207678_100854063 | 282 |
| 116 | 3300026089 | Ga0207648_10022742 | Ga0207648_100227424 | 282 |
| 117 | 3300026121 | Ga0207683_10007919 | Ga0207683_100079194 | 282 |
| 118 | 3300028379 | Ga0268266_10159817 | Ga0268266_101598173 | 282 |
| 119 | 3300028381 | Ga0268264_10072001 | Ga0268264_100720012 | 282 |
| 120 | 3300053104 | Ga0500556_0000097 | Ga0500556_0000097_11131_12018 | 282 |
| 121 | 3300053093 | Ga0500651_0001456 | Ga0500651_0001456_8592_9479 | 283 |
| 122 | 3300053104 | Ga0500556_0021320 | Ga0500556_0021320_918_1805 | 283 |
| 123 | 3300025915 | Ga0207693_10341517 | Ga0207693_103415171 | 284 |
| 124 | 3300026067 | Ga0207678_10007546 | Ga0207678_100075465 | 284 |
| 125 | 3300048918 | Ga0496115_0001891 | Ga0496115_0001891_3638_4525 | 284 |
| 126 | 3300049586 | Ga0501070_0152299 | Ga0501070_0152299_570_1463 | 284 |
| 127 | 3300005262 | Ga0065165_1050049 | Ga0065165_10500491 | 285 |
| 128 | 3300025284 | Ga0209130_1026996 | Ga0209130_10269961 | 285 |
| 129 | 3300025302 | Ga0207426_1021609 | Ga0207426_10216092 | 285 |
| 130 | 3300025941 | Ga0207711_10139428 | Ga0207711_101394282 | 285 |
| 131 | 3300048922 | Ga0496119_0174578 | Ga0496119_0174578_143_1027 | 285 |
| 132 | 3300005445 | Ga0070708_100000590 | Ga0070708_10000059014 | 286 |
| 133 | 3300005518 | Ga0070699_100105417 | Ga0070699_1001054172 | 286 |
| 134 | 3300053148 | Ga0500590_018124 | Ga0500590_018124_712_1605 | 286 |
| 135 | iso_pu_bacteria | 2599185214 | 2599625301 | 286 |
| 136 | iso_pu_bacteria | 2599185226 | 2599673247 | 286 |
| 137 | iso_pu_bacteria | 2599185227 | 2599682917 | 286 |
| 138 | iso_pu_bacteria | 2599185229 | 2599694855 | 286 |
| 139 | iso_pu_bacteria | 2838054893 | 2838060427 | 286 |
| 140 | iso_pu_bacteria | 2928070936 | 2928077798 | 286 |
| 141 | 3300005844 | Ga0068862_100304011 | Ga0068862_1003040112 | 287 |
| 142 | 3300028380 | Ga0268265_10154470 | Ga0268265_101544702 | 287 |
| 143 | 3300028794 | Ga0307515_10178602 | Ga0307515_101786023 | 287 |
| 144 | 3300046522 | Ga0495643_0102091 | Ga0495643_0102091_154_1035 | 287 |
| 145 | 3300053137 | Ga0500561_0012313 | Ga0500561_0012313_893_1774 | 287 |
| 146 | 3300053139 | Ga0500568_0000514 | Ga0500568_0000514_20921_21787 | 287 |
| 147 | 3300005434 | Ga0070709_10035927 | Ga0070709_100359271 | 288 |
| 148 | 3300005536 | Ga0070697_100296524 | Ga0070697_1002965242 | 288 |
| 149 | 3300006058 | Ga0075432_10030072 | Ga0075432_100300722 | 288 |
| 150 | 3300050507 | nmdc:mga05p37_102488_c1 | nmdc:mga05p37_102488_c1_657_1544 | 288 |
| 151 | iso_pu_bacteria | 2884791551 | 2884793882 | 288 |
| 152 | 3300007265 | Ga0099794_10052902 | Ga0099794_100529022 | 289 |
| 153 | 3300021361 | Ga0213872_10021111 | Ga0213872_100211112 | 289 |
| 154 | 3300027671 | Ga0209588_1001679 | Ga0209588_10016795 | 289 |
| 155 | 3300050514 | nmdc:mga08x19_78993_c1 | nmdc:mga08x19_78993_c1_765_1682 | 289 |
| 156 | 3300003320 | rootH2_10250409 | rootH2_102504092 | 290 |
| 157 | 3300025885 | Ga0207653_10019751 | Ga0207653_100197512 | 290 |
| 158 | 3300025922 | Ga0207646_10142106 | Ga0207646_101421062 | 290 |
| 159 | 3300031730 | Ga0307516_10088512 | Ga0307516_100885124 | 290 |
| 160 | 3300044842 | Ga0466957_0027612 | Ga0466957_0027612_2294_3169 | 290 |
| 161 | 3300045836 | Ga0466958_0002885 | Ga0466958_0002885_5858_6733 | 290 |
| 162 | 3300061719 | Ga0466962_0020843 | Ga0466962_0020843_1578_2453 | 290 |
| 163 | iso_pu_bacteria | 2508501128 | 2509151009 | 290 |
| 164 | iso_pu_bacteria | 3002141150 | 3002144215 | 290 |
| 165 | iso_pu_bacteria | 8002317523 | 8002319370 | 290 |
| 166 | iso_pu_bacteria | 8046991243 | 8046994208 | 290 |
| 167 | 3300003323 | rootH1_10176393 | rootH1_101763931 | 291 |
| 168 | 3300005471 | Ga0070698_100201667 | Ga0070698_1002016672 | 291 |
| 169 | 3300005616 | Ga0068852_100358311 | Ga0068852_1003583112 | 291 |
| 170 | 3300014326 | Ga0157380_10110424 | Ga0157380_101104242 | 291 |
| 171 | 3300025261 | Ga0209233_1018881 | Ga0209233_10188812 | 291 |
| 172 | 3300025933 | Ga0207706_10003934 | Ga0207706_1000393410 | 291 |
| 173 | 3300046524 | Ga0495648_0000230 | Ga0495648_0000230_27137_28015 | 291 |
| 174 | 3300047323 | Ga0495683_0000320 | Ga0495683_0000320_33886_34770 | 291 |
| 175 | 3300047469 | Ga0495673_0000186 | Ga0495673_0000186_15480_16358 | 291 |
| 176 | 3300053088 | Ga0500644_0001980 | Ga0500644_0001980_620_1498 | 291 |
| 177 | 3300053138 | Ga0500564_011335 | Ga0500564_011335_2458_3336 | 291 |
| 178 | iso_pu_bacteria | 2511231002 | 2511247257 | 291 |
| 179 | iso_pu_bacteria | 2818991460 | 2819678588 | 291 |
| 180 | iso_pu_bacteria | 3003930520 | 3003932260 | 291 |
| 181 | 3300009093 | Ga0105240_10548733 | Ga0105240_105487332 | 292 |
| 182 | 3300028800 | Ga0265338_10030280 | Ga0265338_100302804 | 292 |
| 183 | 3300031235 | Ga0265330_10057018 | Ga0265330_100570181 | 292 |
| 184 | 3300031241 | Ga0265325_10004468 | Ga0265325_100044687 | 292 |
| 185 | 3300031249 | Ga0265339_10000503 | Ga0265339_1000050318 | 292 |
| 186 | 3300031344 | Ga0265316_10010656 | Ga0265316_100106565 | 292 |
| 187 | 3300031595 | Ga0265313_10000099 | Ga0265313_1000009938 | 292 |
| 188 | 3300031711 | Ga0265314_10005117 | Ga0265314_100051179 | 292 |
| 189 | 3300031712 | Ga0265342_10012537 | Ga0265342_100125371 | 292 |
| 190 | 3300039447 | Ga0436361_1144974 | Ga0436361_1144974_35_919 | 292 |
| 191 | 3300044656 | Ga0466969_0012766 | Ga0466969_0012766_2810_3715 | 292 |
| 192 | 3300044683 | Ga0466965_0023867 | Ga0466965_0023867_1892_2791 | 292 |
| 193 | 3300044765 | Ga0466970_0045323 | Ga0466970_0045323_818_1723 | 292 |
| 194 | 3300044901 | Ga0466960_0001187 | Ga0466960_0001187_877_1776 | 292 |
| 195 | 3300049569 | Ga0501032_0068253 | Ga0501032_0068253_1143_2054 | 292 |
| 196 | 3300049570 | Ga0501033_0041388 | Ga0501033_0041388_820_1731 | 292 |
| 197 | 3300049571 | Ga0501034_0042703 | Ga0501034_0042703_178_1089 | 292 |
| 198 | 3300049574 | Ga0501038_0059948 | Ga0501038_0059948_1739_2650 | 292 |
| 199 | 3300049581 | Ga0501047_0240515 | Ga0501047_0240515_150_1061 | 292 |
| 200 | 3300049823 | Ga0501044_0199369 | Ga0501044_0199369_597_1508 | 292 |
| 201 | iso_pu_bacteria | 2585427594 | 2585844718 | 292 |
| 202 | iso_pu_bacteria | 2738541293 | 2738803878 | 292 |
| 203 | iso_pu_bacteria | 2862281513 | 2862285650 | 292 |
| 204 | iso_pu_bacteria | 2899803654 | 2899804085 | 292 |
| 205 | iso_pu_bacteria | 2904690495 | 2904697022 | 292 |
| 206 | iso_pu_bacteria | 2908756301 | 2908762709 | 292 |
| 207 | iso_pu_bacteria | 8024486573 | 8024489975 | 292 |
| 208 | 3300003215 | JGI25153J46596_10000117 | JGI25153J46596_1000011773 | 293 |
| 209 | 3300003316 | rootH1_10118901 | rootH1_101189013 | 293 |
| 210 | 3300003322 | rootL2_10156153 | rootL2_101561531 | 293 |
| 211 | 3300005536 | Ga0070697_100158205 | Ga0070697_1001582052 | 293 |
| 212 | 3300005614 | Ga0068856_100099785 | Ga0068856_1000997853 | 293 |
| 213 | 3300025297 | Ga0209758_1000061 | Ga0209758_1000061162 | 293 |
| 214 | 3300026078 | Ga0207702_10075722 | Ga0207702_100757221 | 293 |
| 215 | 3300028800 | Ga0265338_10083833 | Ga0265338_100838332 | 293 |
| 216 | 3300031240 | Ga0265320_10015692 | Ga0265320_100156921 | 293 |
| 217 | 3300044684 | Ga0466966_0019698 | Ga0466966_0019698_115_1020 | 293 |
| 218 | 3300044693 | Ga0466961_0040225 | Ga0466961_0040225_1239_2144 | 293 |
| 219 | 3300045049 | Ga0466959_0025887 | Ga0466959_0025887_551_1456 | 293 |
| 220 | 3300045836 | Ga0466958_0154678 | Ga0466958_0154678_259_1164 | 293 |
| 221 | 3300049581 | Ga0501047_0057377 | Ga0501047_0057377_2301_3185 | 293 |
| 222 | 3300049589 | Ga0501073_0003935 | Ga0501073_0003935_9931_10815 | 293 |
| 223 | 3300049593 | Ga0501077_0015630 | Ga0501077_0015630_1486_2373 | 293 |
| 224 | 3300053119 | Ga0500595_020216 | Ga0500595_020216_907_1788 | 293 |
| 225 | 3300055283 | Ga0500661_010546 | Ga0500661_010546_485_1402 | 293 |
| 226 | iso_pu_bacteria | 2600255286 | 2601639996 | 293 |
| 227 | iso_pu_bacteria | 2854916844 | 2854921135 | 293 |
| 228 | iso_pu_bacteria | 2856741275 | 2856746432 | 293 |
| 229 | iso_pu_bacteria | 2874123672 | 2874125582 | 293 |
| 230 | iso_pu_bacteria | 2883291878 | 2883293605 | 293 |
| 231 | iso_pu_bacteria | 2891562705 | 2891567992 | 293 |
| 232 | iso_pu_bacteria | 2904424332 | 2904428186 | 293 |
| 233 | iso_pu_bacteria | 8056689827 | 8056695063 | 293 |
| 234 | 3300003322 | rootL2_10181767 | rootL2_101817672 | 294 |
| 235 | 3300003792 | Ga0055540_1004264 | Ga0055540_10042644 | 294 |
| 236 | 3300005545 | Ga0070695_100323207 | Ga0070695_1003232071 | 294 |
| 237 | 3300005548 | Ga0070665_100146478 | Ga0070665_1001464783 | 294 |
| 238 | 3300005843 | Ga0068860_100437607 | Ga0068860_1004376072 | 294 |
| 239 | 3300006844 | Ga0075428_100019867 | Ga0075428_1000198678 | 294 |
| 240 | 3300006880 | Ga0075429_100035009 | Ga0075429_1000350092 | 294 |
| 241 | 3300006914 | Ga0075436_100009927 | Ga0075436_1000099274 | 294 |
| 242 | 3300009101 | Ga0105247_10137608 | Ga0105247_101376081 | 294 |
| 243 | 3300009148 | Ga0105243_10025042 | Ga0105243_100250423 | 294 |
| 244 | 3300009545 | Ga0105237_10602222 | Ga0105237_106022221 | 294 |
| 245 | 3300025303 | Ga0209051_1003976 | Ga0209051_10039767 | 294 |
| 246 | 3300025885 | Ga0207653_10008309 | Ga0207653_100083094 | 294 |
| 247 | 3300025910 | Ga0207684_10500741 | Ga0207684_105007411 | 294 |
| 248 | 3300025922 | Ga0207646_10215719 | Ga0207646_102157191 | 294 |
| 249 | 3300025935 | Ga0207709_10124676 | Ga0207709_101246762 | 294 |
| 250 | 3300031456 | Ga0307513_10271482 | Ga0307513_102714822 | 294 |
| 251 | 3300037312 | Ga0395899_0006184 | Ga0395899_0006184_6784_7671 | 294 |
| 252 | 3300037418 | Ga0395900_0033235 | Ga0395900_0033235_134_1021 | 294 |
| 253 | 3300037418 | Ga0395900_0406486 | Ga0395900_0406486_321_1208 | 294 |
| 254 | 3300037471 | Ga0395905_0114802 | Ga0395905_0114802_595_1482 | 294 |
| 255 | 3300037853 | Ga0436364_1455769 | Ga0436364_1455769_514_1419 | 294 |
| 256 | 3300046515 | Ga0495620_0000998 | Ga0495620_0000998_5143_6033 | 294 |
| 257 | 3300048925 | Ga0496122_0000107 | Ga0496122_0000107_68092_68985 | 294 |
| 258 | 3300048926 | Ga0496123_0000063 | Ga0496123_0000063_124124_125017 | 294 |
| 259 | 3300049574 | Ga0501038_0125475 | Ga0501038_0125475_101_988 | 294 |
| 260 | 3300049581 | Ga0501047_0083155 | Ga0501047_0083155_512_1399 | 294 |
| 261 | 3300049589 | Ga0501073_0092160 | Ga0501073_0092160_991_1878 | 294 |
| 262 | 3300049742 | Ga0501080_0121926 | Ga0501080_0121926_1434_2321 | 294 |
| 263 | 3300049823 | Ga0501044_0029336 | Ga0501044_0029336_649_1536 | 294 |
| 264 | 3300050508 | nmdc:mga09592_207356_c1 | nmdc:mga09592_207356_c1_180_1067 | 294 |
| 265 | 3300050510 | nmdc:mga06r32_49844_c1 | nmdc:mga06r32_49844_c1_2052_2939 | 294 |
| 266 | 3300050514 | nmdc:mga08x19_1479_c1 | nmdc:mga08x19_1479_c1_3292_4236 | 294 |
| 267 | 3300053139 | Ga0500568_0002443 | Ga0500568_0002443_5678_6565 | 294 |
| 268 | 3300053142 | Ga0500577_0021776 | Ga0500577_0021776_953_1837 | 294 |
| 269 | 3300053177 | Ga0500636_0062574 | Ga0500636_0062574_631_1533 | 294 |
| 270 | 3300060353 | Ga0501082_0006824 | Ga0501082_0006824_5266_6153 | 294 |
| 271 | iso_pu_bacteria | 2929921140 | 2929923644 | 294 |
| 272 | 3300002067 | JGI24735J21928_10001891 | JGI24735J21928_1000189110 | 295 |
| 273 | 3300003756 | Ga0055533_1000925 | Ga0055533_10009254 | 295 |
| 274 | 3300003794 | Ga0055531_10000030 | Ga0055531_1000003063 | 295 |
| 275 | 3300003794 | Ga0055531_10038177 | Ga0055531_100381772 | 295 |
| 276 | 3300005455 | Ga0070663_100038554 | Ga0070663_1000385543 | 295 |
| 277 | 3300005536 | Ga0070697_100037614 | Ga0070697_1000376146 | 295 |
| 278 | 3300005985 | Ga0081539_10142109 | Ga0081539_101421091 | 295 |
| 279 | 3300009765 | Ga0123341_1002866 | Ga0123341_10028665 | 295 |
| 280 | 3300009766 | Ga0123342_1019294 | Ga0123342_10192945 | 295 |
| 281 | 3300013105 | Ga0157369_10047020 | Ga0157369_100470207 | 295 |
| 282 | 3300013105 | Ga0157369_10323700 | Ga0157369_103237001 | 295 |
| 283 | 3300013307 | Ga0157372_10000042 | Ga0157372_1000004216 | 295 |
| 284 | 3300025226 | Ga0209674_100043 | Ga0209674_100043183 | 295 |
| 285 | 3300025292 | Ga0209676_1000065 | Ga0209676_1000065217 | 295 |
| 286 | 3300025298 | Ga0209050_1003257 | Ga0209050_10032574 | 295 |
| 287 | 3300025298 | Ga0209050_1025431 | Ga0209050_10254312 | 295 |
| 288 | 3300025304 | Ga0209257_1000013 | Ga0209257_1000013372 | 295 |
| 289 | 3300025304 | Ga0209257_1000504 | Ga0209257_100050437 | 295 |
| 290 | 3300025910 | Ga0207684_10494497 | Ga0207684_104944971 | 295 |
| 291 | 3300026067 | Ga0207678_10031341 | Ga0207678_100313413 | 295 |
| 292 | 3300028794 | Ga0307515_10028947 | Ga0307515_1002894712 | 295 |
| 293 | 3300030878 | Ga0265770_1000128 | Ga0265770_10001286 | 295 |
| 294 | 3300031090 | Ga0265760_10000177 | Ga0265760_100001772 | 295 |
| 295 | 3300031247 | Ga0265340_10006498 | Ga0265340_100064987 | 295 |
| 296 | 3300031247 | Ga0265340_10041787 | Ga0265340_100417872 | 295 |
| 297 | 3300031247 | Ga0265340_10044968 | Ga0265340_100449683 | 295 |
| 298 | 3300031456 | Ga0307513_10048472 | Ga0307513_100484725 | 295 |
| 299 | 3300031548 | Ga0307408_100004109 | Ga0307408_1000041097 | 295 |
| 300 | 3300031901 | Ga0307406_10017470 | Ga0307406_100174703 | 295 |
| 301 | 3300031911 | Ga0307412_10113248 | Ga0307412_101132482 | 295 |
| 302 | 3300033179 | Ga0307507_10022362 | Ga0307507_100223624 | 295 |
| 303 | 3300037312 | Ga0395899_0000401 | Ga0395899_0000401_16742_17722 | 295 |
| 304 | 3300037466 | Ga0395898_0099719 | Ga0395898_0099719_1541_2431 | 295 |
| 305 | 3300041451 | Ga0451791_0456434 | Ga0451791_0456434_64_954 | 295 |
| 306 | 3300044684 | Ga0466966_0019063 | Ga0466966_0019063_1548_2438 | 295 |
| 307 | 3300044693 | Ga0466961_0004150 | Ga0466961_0004150_5657_6547 | 295 |
| 308 | 3300044765 | Ga0466970_0000159 | Ga0466970_0000159_19700_20587 | 295 |
| 309 | 3300044901 | Ga0466960_0021917 | Ga0466960_0021917_498_1385 | 295 |
| 310 | 3300045049 | Ga0466959_0036510 | Ga0466959_0036510_2489_3379 | 295 |
| 311 | 3300046507 | Ga0495606_0001399 | Ga0495606_0001399_7690_8580 | 295 |
| 312 | 3300046512 | Ga0495610_0016675 | Ga0495610_0016675_906_1832 | 295 |
| 313 | 3300046516 | Ga0495628_0010130 | Ga0495628_0010130_5884_6774 | 295 |
| 314 | 3300048916 | Ga0496113_0082176 | Ga0496113_0082176_534_1424 | 295 |
| 315 | 3300048918 | Ga0496115_0000158 | Ga0496115_0000158_9183_10073 | 295 |
| 316 | 3300048922 | Ga0496119_0000510 | Ga0496119_0000510_22245_23147 | 295 |
| 317 | 3300048925 | Ga0496122_0020299 | Ga0496122_0020299_327_1265 | 295 |
| 318 | 3300048926 | Ga0496123_0008119 | Ga0496123_0008119_3073_4011 | 295 |
| 319 | 3300053134 | Ga0500658_0032375 | Ga0500658_0032375_522_1409 | 295 |
| 320 | 3300053730 | Ga0500645_003789 | Ga0500645_003789_2622_3560 | 295 |
| 321 | 3300053731 | Ga0500609_002688 | Ga0500609_002688_232_1119 | 295 |
| 322 | iso_pu_bacteria | 8003151029 | 8003155223 | 295 |
| 323 | 3300002774 | JGI25150J39212_1000504 | JGI25150J39212_10005044 | 296 |
| 324 | 3300003187 | JGI25151J46595_10000081 | JGI25151J46595_1000008141 | 296 |
| 325 | 3300003215 | JGI25153J46596_10010217 | JGI25153J46596_100102173 | 296 |
| 326 | 3300003316 | rootH1_10039163 | rootH1_100391639 | 296 |
| 327 | 3300003320 | rootH2_10183889 | rootH2_101838892 | 296 |
| 328 | 3300003323 | rootH1_10385647 | rootH1_103856471 | 296 |
| 329 | 3300003762 | Ga0055542_1000674 | Ga0055542_10006746 | 296 |
| 330 | 3300005262 | Ga0065165_1000636 | Ga0065165_100063646 | 296 |
| 331 | 3300005330 | Ga0070690_100373390 | Ga0070690_1003733901 | 296 |
| 332 | 3300005335 | Ga0070666_10378560 | Ga0070666_103785601 | 296 |
| 333 | 3300005434 | Ga0070709_10295045 | Ga0070709_102950451 | 296 |
| 334 | 3300005435 | Ga0070714_100265632 | Ga0070714_1002656321 | 296 |
| 335 | 3300005439 | Ga0070711_100370949 | Ga0070711_1003709492 | 296 |
| 336 | 3300005536 | Ga0070697_100015509 | Ga0070697_1000155095 | 296 |
| 337 | 3300005549 | Ga0070704_100333625 | Ga0070704_1003336251 | 296 |
| 338 | 3300005937 | Ga0081455_10156003 | Ga0081455_101560031 | 296 |
| 339 | 3300005985 | Ga0081539_10010606 | Ga0081539_100106068 | 296 |
| 340 | 3300006038 | Ga0075365_10004901 | Ga0075365_1000490112 | 296 |
| 341 | 3300006038 | Ga0075365_10105146 | Ga0075365_101051461 | 296 |
| 342 | 3300006163 | Ga0070715_10126279 | Ga0070715_101262792 | 296 |
| 343 | 3300006173 | Ga0070716_100267128 | Ga0070716_1002671282 | 296 |
| 344 | 3300006175 | Ga0070712_100402671 | Ga0070712_1004026711 | 296 |
| 345 | 3300006846 | Ga0075430_100162762 | Ga0075430_1001627622 | 296 |
| 346 | 3300007265 | Ga0099794_10136817 | Ga0099794_101368171 | 296 |
| 347 | 3300007788 | Ga0099795_10021718 | Ga0099795_100217181 | 296 |
| 348 | 3300009545 | Ga0105237_10030141 | Ga0105237_100301414 | 296 |
| 349 | 3300009545 | Ga0105237_10057781 | Ga0105237_100577811 | 296 |
| 350 | 3300010159 | Ga0099796_10004789 | Ga0099796_100047893 | 296 |
| 351 | 3300010375 | Ga0105239_10008923 | Ga0105239_100089235 | 296 |
| 352 | 3300010375 | Ga0105239_10009764 | Ga0105239_1000976410 | 296 |
| 353 | 3300010375 | Ga0105239_10531871 | Ga0105239_105318711 | 296 |
| 354 | 3300013102 | Ga0157371_10000010 | Ga0157371_10000010212 | 296 |
| 355 | 3300013306 | Ga0163162_10121598 | Ga0163162_101215982 | 296 |
| 356 | 3300014497 | Ga0182008_10047706 | Ga0182008_100477062 | 296 |
| 357 | 3300021361 | Ga0213872_10053213 | Ga0213872_100532132 | 296 |
| 358 | 3300025225 | Ga0209566_100224 | Ga0209566_10022416 | 296 |
| 359 | 3300025226 | Ga0209674_100251 | Ga0209674_10025124 | 296 |
| 360 | 3300025245 | Ga0207425_1000034 | Ga0207425_1000034183 | 296 |
| 361 | 3300025253 | Ga0209677_103747 | Ga0209677_1037474 | 296 |
| 362 | 3300025254 | Ga0209148_1000304 | Ga0209148_100030416 | 296 |
| 363 | 3300025258 | Ga0209129_1000094 | Ga0209129_1000094128 | 296 |
| 364 | 3300025273 | Ga0209673_1007651 | Ga0209673_10076514 | 296 |
| 365 | 3300025294 | Ga0209025_1000184 | Ga0209025_100018442 | 296 |
| 366 | 3300025297 | Ga0209758_1000159 | Ga0209758_100015942 | 296 |
| 367 | 3300025297 | Ga0209758_1030228 | Ga0209758_10302283 | 296 |
| 368 | 3300025303 | Ga0209051_1025340 | Ga0209051_10253402 | 296 |
| 369 | 3300025906 | Ga0207699_10008443 | Ga0207699_100084436 | 296 |
| 370 | 3300025914 | Ga0207671_10016362 | Ga0207671_100163622 | 296 |
| 371 | 3300025914 | Ga0207671_10307724 | Ga0207671_103077241 | 296 |
| 372 | 3300025915 | Ga0207693_10199443 | Ga0207693_101994432 | 296 |
| 373 | 3300025929 | Ga0207664_10293581 | Ga0207664_102935812 | 296 |
| 374 | 3300025939 | Ga0207665_10286625 | Ga0207665_102866252 | 296 |
| 375 | 3300027512 | Ga0209179_1007755 | Ga0209179_10077552 | 296 |
| 376 | 3300028381 | Ga0268264_10478415 | Ga0268264_104784151 | 296 |
| 377 | 3300031456 | Ga0307513_10000001 | Ga0307513_1000000160 | 296 |
| 378 | 3300031616 | Ga0307508_10126733 | Ga0307508_101267332 | 296 |
| 379 | 3300031731 | Ga0307405_10004876 | Ga0307405_100048764 | 296 |
| 380 | 3300033180 | Ga0307510_10165207 | Ga0307510_101652072 | 296 |
| 381 | 3300035116 | Ga0373945_0026235 | Ga0373945_0026235_697_1653 | 296 |
| 382 | 3300035725 | Ga0373947_0030872 | Ga0373947_0030872_260_1216 | 296 |
| 383 | 3300037471 | Ga0395905_0000872 | Ga0395905_0000872_27442_28389 | 296 |
| 384 | 3300037471 | Ga0395905_0022154 | Ga0395905_0022154_1309_2202 | 296 |
| 385 | 3300038698 | Ga0242419_002725 | Ga0242419_002725_174_1067 | 296 |
| 386 | 3300039447 | Ga0436361_0602027 | Ga0436361_0602027_5434_6327 | 296 |
| 387 | 3300046457 | Ga0495590_0030829 | Ga0495590_0030829_924_1817 | 296 |
| 388 | 3300046458 | Ga0495591_000537 | Ga0495591_000537_16313_17209 | 296 |
| 389 | 3300046459 | Ga0495629_0000037 | Ga0495629_0000037_86891_87784 | 296 |
| 390 | 3300046507 | Ga0495606_0001402 | Ga0495606_0001402_11077_11973 | 296 |
| 391 | 3300046512 | Ga0495610_0003212 | Ga0495610_0003212_7591_8487 | 296 |
| 392 | 3300046512 | Ga0495610_0062862 | Ga0495610_0062862_732_1628 | 296 |
| 393 | 3300046519 | Ga0495632_0000763 | Ga0495632_0000763_12296_13192 | 296 |
| 394 | 3300046522 | Ga0495643_0018942 | Ga0495643_0018942_1723_2619 | 296 |
| 395 | 3300046524 | Ga0495648_0098025 | Ga0495648_0098025_81_974 | 296 |
| 396 | 3300046530 | Ga0495654_0071984 | Ga0495654_0071984_166_1062 | 296 |
| 397 | 3300046533 | Ga0495640_0035889 | Ga0495640_0035889_1140_2096 | 296 |
| 398 | 3300046642 | Ga0495634_0065849 | Ga0495634_0065849_716_1672 | 296 |
| 399 | 3300046665 | Ga0495661_0000532 | Ga0495661_0000532_18101_18997 | 296 |
| 400 | 3300047319 | Ga0495674_0362812 | Ga0495674_0362812_58_1014 | 296 |
| 401 | 3300047470 | Ga0495681_0002727 | Ga0495681_0002727_7814_8710 | 296 |
| 402 | 3300047470 | Ga0495681_0003614 | Ga0495681_0003614_5520_6416 | 296 |
| 403 | 3300047472 | Ga0495686_0024626 | Ga0495686_0024626_1144_2037 | 296 |
| 404 | 3300047472 | Ga0495686_0075392 | Ga0495686_0075392_827_1720 | 296 |
| 405 | 3300048904 | Ga0496101_0079684 | Ga0496101_0079684_862_1758 | 296 |
| 406 | 3300048907 | Ga0496104_0310389 | Ga0496104_0310389_342_1235 | 296 |
| 407 | 3300048919 | Ga0496116_0022624 | Ga0496116_0022624_2079_2975 | 296 |
| 408 | 3300048919 | Ga0496116_0029040 | Ga0496116_0029040_1678_2574 | 296 |
| 409 | 3300048919 | Ga0496116_0030233 | Ga0496116_0030233_565_1461 | 296 |
| 410 | 3300048920 | Ga0496117_0034192 | Ga0496117_0034192_1387_2283 | 296 |
| 411 | 3300048920 | Ga0496117_0174525 | Ga0496117_0174525_56_952 | 296 |
| 412 | 3300048921 | Ga0496118_0032001 | Ga0496118_0032001_1996_2892 | 296 |
| 413 | 3300048921 | Ga0496118_0088683 | Ga0496118_0088683_84_980 | 296 |
| 414 | 3300048924 | Ga0496121_0019649 | Ga0496121_0019649_3778_4674 | 296 |
| 415 | 3300048924 | Ga0496121_0047233 | Ga0496121_0047233_1608_2504 | 296 |
| 416 | 3300048925 | Ga0496122_0008719 | Ga0496122_0008719_1590_2486 | 296 |
| 417 | 3300048925 | Ga0496122_0036949 | Ga0496122_0036949_1455_2351 | 296 |
| 418 | 3300048925 | Ga0496122_0038100 | Ga0496122_0038100_1591_2487 | 296 |
| 419 | 3300048926 | Ga0496123_0021416 | Ga0496123_0021416_1172_2068 | 296 |
| 420 | 3300048926 | Ga0496123_0035166 | Ga0496123_0035166_1508_2404 | 296 |
| 421 | 3300048927 | Ga0496124_0019735 | Ga0496124_0019735_3266_4162 | 296 |
| 422 | 3300048927 | Ga0496124_0020417 | Ga0496124_0020417_3143_4039 | 296 |
| 423 | 3300048927 | Ga0496124_0045289 | Ga0496124_0045289_1981_2877 | 296 |
| 424 | 3300048927 | Ga0496124_0051399 | Ga0496124_0051399_1440_2336 | 296 |
| 425 | 3300048928 | Ga0496125_0005448 | Ga0496125_0005448_10773_11669 | 296 |
| 426 | 3300048929 | Ga0496126_0043949 | Ga0496126_0043949_1095_1988 | 296 |
| 427 | 3300049569 | Ga0501032_0040524 | Ga0501032_0040524_229_1125 | 296 |
| 428 | 3300049571 | Ga0501034_0132759 | Ga0501034_0132759_146_1039 | 296 |
| 429 | 3300049579 | Ga0501043_0227844 | Ga0501043_0227844_481_1377 | 296 |
| 430 | 3300049581 | Ga0501047_0000850 | Ga0501047_0000850_8836_9732 | 296 |
| 431 | 3300049766 | Ga0501269_000016 | Ga0501269_000016_7217_8110 | 296 |
| 432 | 3300049822 | Ga0501035_0000238 | Ga0501035_0000238_41399_42295 | 296 |
| 433 | 3300049823 | Ga0501044_0002163 | Ga0501044_0002163_15529_16425 | 296 |
| 434 | 3300050507 | nmdc:mga05p37_147575_c1 | nmdc:mga05p37_147575_c1_1638_2531 | 296 |
| 435 | 3300050509 | nmdc:mga0qj67_199992_c1 | nmdc:mga0qj67_199992_c1_432_1325 | 296 |
| 436 | 3300050515 | nmdc:mga0a205_106095_c1 | nmdc:mga0a205_106095_c1_1636_2529 | 296 |
| 437 | 3300053085 | Ga0495619_0089018 | Ga0495619_0089018_429_1346 | 296 |
| 438 | 3300053122 | Ga0500608_000191 | Ga0500608_000191_8907_9824 | 296 |
| 439 | 3300053136 | Ga0500559_0093628 | Ga0500559_0093628_353_1243 | 296 |
| 440 | 3300053149 | Ga0500600_0072975 | Ga0500600_0072975_624_1562 | 296 |
| 441 | iso_pu_bacteria | 2874123672 | 2874126210 | 296 |
| 442 | 3300003316 | rootH1_10169498 | rootH1_101694984 | 297 |
| 443 | 3300003322 | rootL2_10061303 | rootL2_100613031 | 297 |
| 444 | 3300003323 | rootH1_10193019 | rootH1_101930192 | 297 |
| 445 | 3300005536 | Ga0070697_100039730 | Ga0070697_1000397303 | 297 |
| 446 | 3300005536 | Ga0070697_100095081 | Ga0070697_1000950813 | 297 |
| 447 | 3300005617 | Ga0068859_100088653 | Ga0068859_1000886532 | 297 |
| 448 | 3300006163 | Ga0070715_10018843 | Ga0070715_100188433 | 297 |
| 449 | 3300006847 | Ga0075431_100209930 | Ga0075431_1002099302 | 297 |
| 450 | 3300006931 | Ga0097620_100088655 | Ga0097620_1000886552 | 297 |
| 451 | 3300009147 | Ga0114129_10466847 | Ga0114129_104668472 | 297 |
| 452 | 3300009545 | Ga0105237_10019832 | Ga0105237_100198327 | 297 |
| 453 | 3300021361 | Ga0213872_10001762 | Ga0213872_100017628 | 297 |
| 454 | 3300021377 | Ga0213874_10013408 | Ga0213874_100134082 | 297 |
| 455 | 3300025905 | Ga0207685_10010530 | Ga0207685_100105302 | 297 |
| 456 | 3300025914 | Ga0207671_10011927 | Ga0207671_100119277 | 297 |
| 457 | 3300025949 | Ga0207667_10112612 | Ga0207667_101126121 | 297 |
| 458 | 3300030744 | Ga0316181_1013750 | Ga0316181_10137508 | 297 |
| 459 | 3300032126 | Ga0307415_100007992 | Ga0307415_1000079924 | 297 |
| 460 | 3300037853 | Ga0436364_0178301 | Ga0436364_0178301_805_1701 | 297 |
| 461 | 3300039447 | Ga0436361_0093651 | Ga0436361_0093651_237_1133 | 297 |
| 462 | 3300039447 | Ga0436361_0576920 | Ga0436361_0576920_37698_38597 | 297 |
| 463 | 3300039447 | Ga0436361_1068692 | Ga0436361_1068692_63_956 | 297 |
| 464 | 3300039450 | Ga0436363_0064738 | Ga0436363_0064738_2481_3422 | 297 |
| 465 | 3300046506 | Ga0495583_0002496 | Ga0495583_0002496_13814_14755 | 297 |
| 466 | 3300046512 | Ga0495610_0010882 | Ga0495610_0010882_3123_4019 | 297 |
| 467 | 3300046558 | Ga0495633_0027160 | Ga0495633_0027160_1525_2427 | 297 |
| 468 | 3300048904 | Ga0496101_0084564 | Ga0496101_0084564_1252_2184 | 297 |
| 469 | 3300048906 | Ga0496103_0001512 | Ga0496103_0001512_385_1287 | 297 |
| 470 | 3300048924 | Ga0496121_0002329 | Ga0496121_0002329_15434_16330 | 297 |
| 471 | 3300048929 | Ga0496126_0007322 | Ga0496126_0007322_6951_7883 | 297 |
| 472 | 3300049571 | Ga0501034_0400263 | Ga0501034_0400263_65_976 | 297 |
| 473 | 3300049581 | Ga0501047_0013929 | Ga0501047_0013929_1276_2175 | 297 |
| 474 | 3300049823 | Ga0501044_0176978 | Ga0501044_0176978_500_1399 | 297 |
| 475 | 3300005614 | Ga0068856_100192685 | Ga0068856_1001926852 | 298 |
| 476 | 3300007076 | Ga0075435_100004917 | Ga0075435_10000491710 | 298 |
| 477 | 3300021361 | Ga0213872_10017616 | Ga0213872_100176162 | 298 |
| 478 | 3300026078 | Ga0207702_10162980 | Ga0207702_101629802 | 298 |
| 479 | 3300026095 | Ga0207676_10363510 | Ga0207676_103635101 | 298 |
| 480 | 3300039447 | Ga0436361_0654582 | Ga0436361_0654582_446_1351 | 298 |
| 481 | 3300044656 | Ga0466969_0083979 | Ga0466969_0083979_527_1432 | 298 |
| 482 | 3300044672 | Ga0466982_0000004 | Ga0466982_0000004_145324_146232 | 298 |
| 483 | 3300044684 | Ga0466966_0002115 | Ga0466966_0002115_8603_9511 | 298 |
| 484 | 3300044684 | Ga0466966_0233442 | Ga0466966_0233442_44_1021 | 298 |
| 485 | 3300044842 | Ga0466957_0044781 | Ga0466957_0044781_79_1083 | 298 |
| 486 | 3300044901 | Ga0466960_0045939 | Ga0466960_0045939_673_1581 | 298 |
| 487 | 3300045049 | Ga0466959_0096267 | Ga0466959_0096267_760_1788 | 298 |
| 488 | 3300045836 | Ga0466958_0168764 | Ga0466958_0168764_114_1142 | 298 |
| 489 | 3300046513 | Ga0495616_0073892 | Ga0495616_0073892_290_1207 | 298 |
| 490 | 3300046530 | Ga0495654_0006138 | Ga0495654_0006138_3316_4224 | 298 |
| 491 | 3300046810 | Ga0495660_0052171 | Ga0495660_0052171_286_1203 | 298 |
| 492 | 3300048907 | Ga0496104_0373279 | Ga0496104_0373279_105_1010 | 298 |
| 493 | 3300050512 | nmdc:mga0n895_8184_c1 | nmdc:mga0n895_8184_c1_6986_7945 | 298 |
| 494 | 3300050513 | nmdc:mga0rr50_3298_c1 | nmdc:mga0rr50_3298_c1_1075_2034 | 298 |
| 495 | 3300050515 | nmdc:mga0a205_10744_c1 | nmdc:mga0a205_10744_c1_5394_6353 | 298 |
| 496 | 3300053131 | Ga0500652_108143 | Ga0500652_108143_80_1114 | 298 |
| 497 | 3300053139 | Ga0500568_0026664 | Ga0500568_0026664_1157_2092 | 298 |
| 498 | 3300061719 | Ga0466962_0123292 | Ga0466962_0123292_20_1048 | 298 |
| 499 | 3300001979 | JGI24740J21852_10000667 | JGI24740J21852_100006678 | 299 |
| 500 | 3300002738 | JGI25154J39366_1000014 | JGI25154J39366_1000014163 | 299 |
| 501 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002961 | 299 |
| 502 | 3300025250 | Ga0209026_1000178 | Ga0209026_100017846 | 299 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6s2j-assembly1.cif.gz_A | square conformation of ktra r16k mutant ring with bound atp | 0.841 | 2 | 109 |
| 4j91-assembly1.cif.gz_A-2 | diamond-shaped octameric structure of ktra with adp bound | 0.8361 | 3 | 109 |
| 4j91-assembly1.cif.gz_C-2 | diamond-shaped octameric structure of ktra with adp bound | 0.8357 | 3 | 109 |
| 4j91-assembly1.cif.gz_B-2 | diamond-shaped octameric structure of ktra with adp bound | 0.8355 | 3 | 109 |
| 4j91-assembly1.cif.gz_D-2 | diamond-shaped octameric structure of ktra with adp bound | 0.8352 | 3 | 109 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9Y7K4_1_260_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9823 | 1 | 261 | 3.40.50.720 |
| af_Q9Y7K4_1_260_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9786 | 1 | 261 | 3.40.50.720 |
| af_Q12177_1_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9762 | 1 | 259 | 3.40.50.720 |
| af_Q12177_1_262_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9616 | 1 | 259 | 3.40.50.720 |
| 5nahA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8901 | 2 | 32 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y3TQQ8-F1-model_v4 | NAD-dependent dehydratase | 0.9796 | 1 | 291 |
GO:0004029
GO:0005737 |
| AF-A0A254Q6J3-F1-model_v4 | SDR family oxidoreductase | 0.979 | 1 | 292 |
GO:0004029
GO:0005737 |
| AF-A0A7V3MJ56-F1-model_v4 | 3-beta hydroxysteroid dehydrogenase | 0.9773 | 161 | 298 |
GO:0004029
GO:0005737 |
| AF-B6HC03-F1-model_v4 | Pc18g00870 protein | 0.9771 | 1 | 298 |
GO:0004029
GO:0005737 |
| AF-A0A4Q6CMB8-F1-model_v4 | deleted | 0.9771 | 1 | 83 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar