F455845

General Info

Members Datasets Scaffolds Average Seq Length
502 269 1004 134

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_12540884|Ga0157378_125408841
Length 137
Sequence MARVTGIGGVFFKSRKDHQALAAWYEKNLGIKLEPWGGAILRWPDDHGEDKAEDKGVTVWCTAAANTDWFSPSESSFMINYRVDDMAGLLAKLRGADVKIVKGPESHENGKFAWILDPEGNKVELWEPMNWDEKNKG

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
189 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
235 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
236 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
237 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
238 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
239 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
240 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
241 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
242 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
243 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
244 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
248 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
249 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
250 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
268 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.98
Nodule 0
Rhizoplane 2.79
Rhizosphere 90.04
Stem 0
Stem Tuber 0
Unclassified 7.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_12540884 3300013297 Bacteria 564
2 rootH2_10062662 3300003320 Bacteria 2250
3 Ga0055531_10027319 3300003794 Bacteria 2006
4 Ga0058863_11441775 3300004799 Bacteria 500
5 Ga0065714_10148579 3300005288 Bacteria 1119
6 Ga0065704_10035083 3300005289 Bacteria 952
7 Ga0065704_10355072 3300005289 Unclassified 805
8 Ga0065712_10068047 3300005290 Bacteria 16179
9 Ga0065712_10239804 3300005290 Bacteria 982
10 Ga0065715_10099278 3300005293 Bacteria 3433
11 Ga0065715_10217048 3300005293 Bacteria 1288
12 Ga0065707_10088575 3300005295 Bacteria 4619
13 Ga0070658_10004673 3300005327 Bacteria 11133
14 Ga0070658_10061896 3300005327 Unclassified 3049
15 Ga0070658_10134783 3300005327 Bacteria 2059
16 Ga0070676_11067136 3300005328 Bacteria 609
17 Ga0070690_100005509 3300005330 Bacteria 7118
18 Ga0070690_100007704 3300005330 Bacteria 6174
19 Ga0070690_100461592 3300005330 Bacteria 943
20 Ga0070670_100025220 3300005331 Bacteria 5117
21 Ga0070670_101106628 3300005331 Bacteria 722
22 Ga0070677_10469521 3300005333 Bacteria 676
23 Ga0068869_100014103 3300005334 Bacteria 5333
24 Ga0068869_100080243 3300005334 Bacteria 2434
25 Ga0068869_100744253 3300005334 Bacteria 839
26 Ga0070666_10000767 3300005335 Bacteria 19409
27 Ga0070666_10002699 3300005335 Bacteria 10708
28 Ga0070666_10601297 3300005335 Bacteria 803
29 Ga0068868_100002891 3300005338 Bacteria 11918
30 Ga0068868_100578712 3300005338 Bacteria 992
31 Ga0070660_100000214 3300005339 Bacteria 38727
32 Ga0070689_100003324 3300005340 Bacteria 10680
33 Ga0070689_100016977 3300005340 Bacteria 5339
34 Ga0070689_100638925 3300005340 Bacteria 925
35 Ga0070691_10018421 3300005341 Bacteria 3219
36 Ga0070687_100000241 3300005343 Bacteria 18833
37 Ga0070661_100291351 3300005344 Bacteria 1268
38 Ga0070661_100954738 3300005344 Bacteria 710
39 Ga0070692_10290024 3300005345 Bacteria 995
40 Ga0070692_11162073 3300005345 Bacteria 548
41 Ga0070669_100013220 3300005353 Bacteria 5868
42 Ga0070669_100085492 3300005353 Bacteria 2355
43 Ga0070669_100354866 3300005353 Bacteria 1191
44 Ga0070675_100003764 3300005354 Bacteria 11517
45 Ga0070675_100388693 3300005354 Bacteria 1243
46 Ga0070671_100001794 3300005355 Bacteria 16314
47 Ga0070671_100001940 3300005355 Bacteria 15865
48 Ga0070671_101499379 3300005355 Bacteria 597
49 Ga0070673_100043700 3300005364 Bacteria 3464
50 Ga0070673_100512093 3300005364 Bacteria 1086
51 Ga0070673_100572870 3300005364 Bacteria 1027
52 Ga0070673_100801891 3300005364 Bacteria 869
53 Ga0070673_101273217 3300005364 Bacteria 690
54 Ga0070688_100000389 3300005365 Bacteria 22221
55 Ga0070688_100002574 3300005365 Bacteria 9188
56 Ga0070659_100001202 3300005366 Bacteria 18849
57 Ga0070659_100282771 3300005366 Bacteria 1380
58 Ga0070667_100216359 3300005367 Bacteria 1704
59 Ga0070667_101422651 3300005367 Bacteria 650
60 Ga0070667_101493685 3300005367 Bacteria 634
61 Ga0070705_100014731 3300005440 Bacteria 4031
62 Ga0070700_100000056 3300005441 Bacteria 83455
63 Ga0070700_100384520 3300005441 Bacteria 1051
64 Ga0070678_100050133 3300005456 Bacteria 3018
65 Ga0070662_100001196 3300005457 Bacteria 15947
66 Ga0070662_100007301 3300005457 Bacteria 7159
67 Ga0070662_100669477 3300005457 Bacteria 876
68 Ga0070662_101301249 3300005457 Unclassified 626
69 Ga0070681_10237887 3300005458 Bacteria 1735
70 Ga0068867_100007657 3300005459 Bacteria 7642
71 Ga0068867_100011658 3300005459 Bacteria 6207
72 Ga0070685_10354947 3300005466 Bacteria 1003
73 Ga0070707_100009815 3300005468 Bacteria 8905
74 Ga0070699_100408909 3300005518 Bacteria 1227
75 Ga0070679_101537795 3300005530 Bacteria 612
76 Ga0070684_100045803 3300005535 Bacteria 3788
77 Ga0070684_100063589 3300005535 Bacteria 3235
78 Ga0070697_100006709 3300005536 Bacteria 8933
79 Ga0068853_100603510 3300005539 Bacteria 1042
80 Ga0070672_100051268 3300005543 Bacteria 3217
81 Ga0070672_100707880 3300005543 Unclassified 882
82 Ga0070686_100019907 3300005544 Bacteria 3965
83 Ga0070695_100090724 3300005545 Unclassified 2040
84 Ga0070695_100120119 3300005545 Bacteria 1797
85 Ga0070696_100294029 3300005546 Bacteria 1242
86 Ga0070693_100000641 3300005547 Bacteria 15412
87 Ga0070665_100001521 3300005548 Bacteria 26874
88 Ga0070665_100038653 3300005548 Bacteria 4797
89 Ga0070665_101114833 3300005548 Bacteria 800
90 Ga0070664_100005842 3300005564 Bacteria 9926
91 Ga0070664_100011822 3300005564 Bacteria 7086
92 Ga0070664_101330394 3300005564 Bacteria 679
93 Ga0068857_100001753 3300005577 Bacteria 17438
94 Ga0068857_100436290 3300005577 Unclassified 1223
95 Ga0068857_100672004 3300005577 Bacteria 983
96 Ga0068854_100011914 3300005578 Bacteria 5681
97 Ga0070702_100111708 3300005615 Bacteria 1695
98 Ga0070702_100646871 3300005615 Bacteria 799
99 Ga0070702_100754426 3300005615 Bacteria 748
100 Ga0068852_100112794 3300005616 Bacteria 2474
101 Ga0068852_100227558 3300005616 Bacteria 1776
102 Ga0068859_100019498 3300005617 Bacteria 6813
103 Ga0068859_100245698 3300005617 Bacteria 1879
104 Ga0068859_101049271 3300005617 Unclassified 896
105 Ga0068859_101968757 3300005617 Bacteria 645
106 Ga0068864_100004004 3300005618 Bacteria 12133
107 Ga0068864_100107192 3300005618 Bacteria 2485
108 Ga0068864_100657637 3300005618 Bacteria 1021
109 Ga0068864_101223437 3300005618 Bacteria 750
110 Ga0068866_10006018 3300005718 Bacteria 5048
111 Ga0068866_10090536 3300005718 Bacteria 1665
112 Ga0068861_100000562 3300005719 Bacteria 22006
113 Ga0068861_100000577 3300005719 Bacteria 21668
114 Ga0068861_100032990 3300005719 Bacteria 3817
115 Ga0068861_100095663 3300005719 Bacteria 2353
116 Ga0068861_101011232 3300005719 Bacteria 794
117 Ga0068851_10001093 3300005834 Bacteria 11764
118 Ga0068851_10613007 3300005834 Unclassified 663
119 Ga0068870_10011516 3300005840 Bacteria 4103
120 Ga0068870_10363494 3300005840 Bacteria 932
121 Ga0068870_10413006 3300005840 Bacteria 881
122 Ga0068863_100003717 3300005841 Bacteria 15093
123 Ga0068863_100007517 3300005841 Bacteria 10656
124 Ga0068863_100053869 3300005841 Bacteria 3813
125 Ga0068863_100233295 3300005841 Bacteria 1775
126 Ga0068863_100621813 3300005841 Bacteria 1070
127 Ga0068863_100749024 3300005841 Bacteria 973
128 Ga0068863_100783729 3300005841 Unclassified 950
129 Ga0068858_100006090 3300005842 Bacteria 11767
130 Ga0068858_100072795 3300005842 Bacteria 3189
131 Ga0068860_100174934 3300005843 Bacteria 2075
132 Ga0068860_100307078 3300005843 Bacteria 1555
133 Ga0068860_100554758 3300005843 Bacteria 1151
134 Ga0068860_101092584 3300005843 Unclassified 817
135 Ga0068862_100029895 3300005844 Bacteria 4590
136 Ga0068862_100046498 3300005844 Bacteria 3703
137 Ga0068862_100073311 3300005844 Bacteria 2959
138 Ga0068862_100359943 3300005844 Bacteria 1352
139 Ga0068862_100547847 3300005844 Bacteria 1104
140 Ga0068862_101207915 3300005844 Bacteria 755
141 Ga0081539_10035507 3300005985 Bacteria 2995
142 Ga0075368_10037190 3300006042 Bacteria 1903
143 Ga0075368_10184516 3300006042 Bacteria 880
144 Ga0075364_10002052 3300006051 Bacteria 11243
145 Ga0075362_10020965 3300006177 Bacteria 2736
146 Ga0075367_10024806 3300006178 Bacteria 3383
147 Ga0075367_10312786 3300006178 Unclassified 989
148 Ga0075366_10000302 3300006195 Bacteria 22298
149 Ga0075366_10979768 3300006195 Bacteria 527
150 Ga0097621_100010243 3300006237 Bacteria 6848
151 Ga0097621_100229527 3300006237 Bacteria 1620
152 Ga0075370_10397198 3300006353 Unclassified 827
153 Ga0075428_100018514 3300006844 Bacteria 7700
154 Ga0075428_100959448 3300006844 Bacteria 906
155 Ga0075430_100010623 3300006846 Bacteria 7800
156 Ga0075430_100217121 3300006846 Bacteria 1587
157 Ga0075430_100316383 3300006846 Bacteria 1290
158 Ga0075430_100494073 3300006846 Unclassified 1010
159 Ga0075431_100225523 3300006847 Bacteria 1911
160 Ga0075433_10502713 3300006852 Bacteria 1067
161 Ga0075433_10568376 3300006852 Unclassified 996
162 Ga0075433_10611119 3300006852 Bacteria 957
163 Ga0075429_100036497 3300006880 Bacteria 4275
164 Ga0075429_100587891 3300006880 Bacteria 975
165 Ga0068865_100261583 3300006881 Bacteria 1370
166 Ga0068865_100938012 3300006881 Bacteria 755
167 Ga0097620_100019499 3300006931 Bacteria 6813
168 Ga0097620_100245694 3300006931 Bacteria 1879
169 Ga0097620_101049334 3300006931 Unclassified 896
170 Ga0097620_101969479 3300006931 Bacteria 645
171 Ga0075435_100496256 3300007076 Bacteria 1055
172 Ga0105240_10040933 3300009093 Bacteria 5920
173 Ga0105240_10965091 3300009093 Bacteria 913
174 Ga0111539_10000099 3300009094 Bacteria 91525
175 Ga0111539_10116058 3300009094 Bacteria 3139
176 Ga0111539_10117917 3300009094 Bacteria 3111
177 Ga0105245_10000641 3300009098 Bacteria 31814
178 Ga0105245_12073518 3300009098 Bacteria 622
179 Ga0105247_10018198 3300009101 Bacteria 4214
180 Ga0114129_10488508 3300009147 Bacteria 1610
181 Ga0105243_10077148 3300009148 Bacteria 2709
182 Ga0105243_10413777 3300009148 Bacteria 1255
183 Ga0105243_10899161 3300009148 Bacteria 880
184 Ga0105241_10006878 3300009174 Bacteria 8369
185 Ga0105241_10250572 3300009174 Bacteria 1501
186 Ga0105241_10341937 3300009174 Bacteria 1297
187 Ga0105241_10834505 3300009174 Bacteria 851
188 Ga0105242_10080633 3300009176 Unclassified 2720
189 Ga0105242_10106875 3300009176 Bacteria 2379
190 Ga0105242_10425444 3300009176 Bacteria 1245
191 Ga0105248_10005072 3300009177 Bacteria 14536
192 Ga0105237_10626263 3300009545 Bacteria 1083
193 Ga0105238_10060496 3300009551 Bacteria 3792
194 Ga0105249_10001405 3300009553 Bacteria 21079
195 Ga0105249_10015546 3300009553 Bacteria 6737
196 Ga0105249_10049294 3300009553 Bacteria 3840
197 Ga0105249_10067053 3300009553 Bacteria 3305
198 Ga0105249_10102115 3300009553 Bacteria 2698
199 Ga0105249_13332304 3300009553 Bacteria 517
200 Ga0105239_10613032 3300010375 Bacteria 1242
201 Ga0105239_12748558 3300010375 Bacteria 574
202 Ga0105239_13427710 3300010375 Bacteria 516
203 Ga0105246_10069060 3300011119 Bacteria 2480
204 Ga0157371_10557383 3300013102 Bacteria 850
205 Ga0157369_10002451 3300013105 Bacteria 22260
206 Ga0157369_10490476 3300013105 Bacteria 1271
207 Ga0157369_10630962 3300013105 Bacteria 1105
208 Ga0157374_10233982 3300013296 Bacteria 1805
209 Ga0157374_10456119 3300013296 Bacteria 1280
210 Ga0157378_10002122 3300013297 Bacteria 17643
211 Ga0157378_10302074 3300013297 Bacteria 1549
212 Ga0163162_10205427 3300013306 Bacteria 2099
213 Ga0157372_10012458 3300013307 Bacteria 9064
214 Ga0157372_10681806 3300013307 Bacteria 1196
215 Ga0163163_10009152 3300014325 Bacteria 8826
216 Ga0157380_10028565 3300014326 Bacteria 4254
217 Ga0157380_10048913 3300014326 Bacteria 3332
218 Ga0157380_11168861 3300014326 Bacteria 812
219 Ga0157377_10003883 3300014745 Bacteria 6810
220 Ga0157379_10007314 3300014968 Bacteria 9555
221 Ga0157379_10127139 3300014968 Bacteria 2293
222 Ga0157379_10836552 3300014968 Bacteria 870
223 Ga0157376_10210208 3300014969 Bacteria 1796
224 Ga0163161_11202889 3300017792 Bacteria 655
225 Ga0213876_10000024 3300021384 Bacteria 237488
226 Ga0209257_1000437 3300025304 Bacteria 80060
227 Ga0207697_10001765 3300025315 Bacteria 11610
228 Ga0207656_10045092 3300025321 Bacteria 1885
229 Ga0207642_10036617 3300025899 Bacteria 2107
230 Ga0207710_10781921 3300025900 Bacteria 502
231 Ga0207688_10000450 3300025901 Bacteria 19483
232 Ga0207688_10014280 3300025901 Bacteria 4321
233 Ga0207680_10005230 3300025903 Bacteria 6191
234 Ga0207680_10578044 3300025903 Bacteria 803
235 Ga0207647_10000019 3300025904 Bacteria 123924
236 Ga0207647_10597039 3300025904 Bacteria 609
237 Ga0207645_10001166 3300025907 Bacteria 21674
238 Ga0207645_10192595 3300025907 Bacteria 1340
239 Ga0207645_10720596 3300025907 Bacteria 678
240 Ga0207643_10000113 3300025908 Bacteria 55446
241 Ga0207643_10088663 3300025908 Bacteria 1801
242 Ga0207643_10667954 3300025908 Unclassified 671
243 Ga0207705_10006527 3300025909 Bacteria 8639
244 Ga0207705_10027757 3300025909 Bacteria 4037
245 Ga0207705_10078343 3300025909 Bacteria 2405
246 Ga0207705_11196320 3300025909 Bacteria 583
247 Ga0207654_10625146 3300025911 Bacteria 770
248 Ga0207654_10794695 3300025911 Bacteria 683
249 Ga0207695_10030334 3300025913 Bacteria 5954
250 Ga0207695_10067526 3300025913 Bacteria 3668
251 Ga0207671_10497768 3300025914 Bacteria 972
252 Ga0207657_10000059 3300025919 Bacteria 103782
253 Ga0207649_10031191 3300025920 Bacteria 3166
254 Ga0207649_10663316 3300025920 Bacteria 807
255 Ga0207652_10030302 3300025921 Bacteria 4529
256 Ga0207681_10031477 3300025923 Bacteria 3465
257 Ga0207694_10001535 3300025924 Bacteria 19628
258 Ga0207650_10000514 3300025925 Bacteria 32086
259 Ga0207650_10034298 3300025925 Bacteria 3680
260 Ga0207650_10319660 3300025925 Unclassified 1271
261 Ga0207659_10212343 3300025926 Bacteria 1552
262 Ga0207644_10005866 3300025931 Bacteria 8005
263 Ga0207644_10377148 3300025931 Bacteria 1156
264 Ga0207644_10599656 3300025931 Bacteria 914
265 Ga0207690_10214456 3300025932 Bacteria 1469
266 Ga0207706_10001171 3300025933 Bacteria 26598
267 Ga0207706_10003006 3300025933 Bacteria 16254
268 Ga0207706_10027587 3300025933 Bacteria 5076
269 Ga0207686_10088922 3300025934 Bacteria 2034
270 Ga0207709_10005185 3300025935 Bacteria 7422
271 Ga0207670_10137445 3300025936 Bacteria 1798
272 Ga0207670_10188726 3300025936 Bacteria 1558
273 Ga0207669_10094347 3300025937 Bacteria 1958
274 Ga0207704_10000136 3300025938 Bacteria 39545
275 Ga0207704_10105773 3300025938 Bacteria 1888
276 Ga0207704_10489492 3300025938 Bacteria 989
277 Ga0207665_10785704 3300025939 Bacteria 752
278 Ga0207691_10243695 3300025940 Bacteria 1553
279 Ga0207691_10590868 3300025940 Bacteria 940
280 Ga0207711_10002981 3300025941 Bacteria 14789
281 Ga0207711_10149157 3300025941 Bacteria 2109
282 Ga0207711_11103579 3300025941 Bacteria 734
283 Ga0207689_10000009 3300025942 Bacteria 127375
284 Ga0207689_10081879 3300025942 Bacteria 2654
285 Ga0207661_11169489 3300025944 Bacteria 708
286 Ga0207679_10001112 3300025945 Bacteria 17128
287 Ga0207679_10001337 3300025945 Bacteria 15592
288 Ga0207679_10044140 3300025945 Bacteria 3215
289 Ga0207651_10160275 3300025960 Bacteria 1763
290 Ga0207651_11026635 3300025960 Bacteria 737
291 Ga0207651_11378682 3300025960 Unclassified 634
292 Ga0207651_11622355 3300025960 Bacteria 583
293 Ga0207712_10000601 3300025961 Bacteria 28655
294 Ga0207712_10000977 3300025961 Bacteria 20523
295 Ga0207712_10596962 3300025961 Bacteria 955
296 Ga0207668_10370134 3300025972 Bacteria 1203
297 Ga0207640_10006300 3300025981 Bacteria 6506
298 Ga0207640_10196049 3300025981 Bacteria 1526
299 Ga0207658_10462108 3300025986 Bacteria 1125
300 Ga0207658_11278002 3300025986 Bacteria 671
301 Ga0207677_10092834 3300026023 Bacteria 2199
302 Ga0207703_10000632 3300026035 Bacteria 35396
303 Ga0207703_10056820 3300026035 Bacteria 3189
304 Ga0207703_10146389 3300026035 Bacteria 2055
305 Ga0207703_10348106 3300026035 Bacteria 1363
306 Ga0207703_10982188 3300026035 Bacteria 810
307 Ga0207639_10000117 3300026041 Bacteria 61185
308 Ga0207678_10013247 3300026067 Bacteria 7236
309 Ga0207708_10000089 3300026075 Bacteria 72013
310 Ga0207708_10469712 3300026075 Bacteria 1050
311 Ga0207708_10641688 3300026075 Bacteria 903
312 Ga0207702_10068161 3300026078 Bacteria 3056
313 Ga0207641_10001506 3300026088 Bacteria 22808
314 Ga0207641_10082030 3300026088 Bacteria 2801
315 Ga0207641_10206474 3300026088 Bacteria 1814
316 Ga0207641_10605499 3300026088 Bacteria 1073
317 Ga0207648_10007978 3300026089 Bacteria 10327
318 Ga0207648_10059561 3300026089 Bacteria 3330
319 Ga0207676_10006786 3300026095 Bacteria 8104
320 Ga0207676_10429802 3300026095 Bacteria 1240
321 Ga0207674_10000858 3300026116 Bacteria 39727
322 Ga0207674_10112976 3300026116 Bacteria 2689
323 Ga0207675_100000005 3300026118 Bacteria 199965
324 Ga0207675_100003665 3300026118 Bacteria 14982
325 Ga0207675_100015382 3300026118 Bacteria 7136
326 Ga0207675_100168584 3300026118 Bacteria 2092
327 Ga0207683_10001342 3300026121 Bacteria 22223
328 Ga0207683_10697643 3300026121 Bacteria 941
329 Ga0207698_10055343 3300026142 Bacteria 3057
330 Ga0209813_10009972 3300027866 Unclassified 2445
331 Ga0209813_10082454 3300027866 Bacteria 1066
332 Ga0207428_10000201 3300027907 Bacteria 83434
333 Ga0207428_10016879 3300027907 Bacteria 6274
334 Ga0268266_10000007 3300028379 Bacteria 1372921
335 Ga0268266_10522972 3300028379 Bacteria 1134
336 Ga0268265_10030100 3300028380 Bacteria 3905
337 Ga0268265_10101793 3300028380 Bacteria 2321
338 Ga0268265_10222728 3300028380 Bacteria 1652
339 Ga0268265_10344458 3300028380 Bacteria 1358
340 Ga0268265_11312082 3300028380 Unclassified 724
341 Ga0268264_10001536 3300028381 Bacteria 21495
342 Ga0268264_10189775 3300028381 Bacteria 1872
343 Ga0268264_11420083 3300028381 Bacteria 705
344 Ga0265760_10036224 3300031090 Bacteria 1463
345 Ga0307513_10147147 3300031456 Bacteria 2271
346 Ga0307513_10919903 3300031456 Bacteria 582
347 Ga0307408_101463953 3300031548 Bacteria 645
348 Ga0307516_10029632 3300031730 Bacteria 5532
349 Ga0307405_10019518 3300031731 Bacteria 3767
350 Ga0307405_10058067 3300031731 Bacteria 2433
351 Ga0307405_10059360 3300031731 Unclassified 2410
352 Ga0316577_10020123 3300031733 Bacteria 3699
353 Ga0307413_10000482 3300031824 Bacteria 13035
354 Ga0307413_10073191 3300031824 Bacteria 2165
355 Ga0307413_10170852 3300031824 Bacteria 1538
356 Ga0307413_10919382 3300031824 Unclassified 744
357 Ga0307410_10001582 3300031852 Bacteria 10425
358 Ga0307410_10019234 3300031852 Bacteria 4149
359 Ga0307410_10073529 3300031852 Bacteria 2377
360 Ga0307410_10608632 3300031852 Bacteria 912
361 Ga0307406_10012030 3300031901 Bacteria 4923
362 Ga0307406_10263352 3300031901 Bacteria 1306
363 Ga0307406_10803779 3300031901 Bacteria 794
364 Ga0307406_10999681 3300031901 Bacteria 717
365 Ga0307407_10001104 3300031903 Bacteria 9423
366 Ga0307407_10149132 3300031903 Bacteria 1517
367 Ga0307412_10295751 3300031911 Unclassified 1277
368 Ga0307409_100001611 3300031995 Bacteria 11291
369 Ga0307409_100017862 3300031995 Bacteria 4744
370 Ga0307409_100459574 3300031995 Bacteria 1230
371 Ga0307416_100194876 3300032002 Unclassified 1915
372 Ga0307416_100239706 3300032002 Bacteria 1756
373 Ga0307416_100549192 3300032002 Unclassified 1228
374 Ga0307416_101615747 3300032002 Bacteria 753
375 Ga0307414_10020614 3300032004 Bacteria 4113
376 Ga0307414_10045985 3300032004 Bacteria 2993
377 Ga0307414_10084730 3300032004 Bacteria 2332
378 Ga0307414_10088793 3300032004 Bacteria 2289
379 Ga0307411_10003392 3300032005 Bacteria 7380
380 Ga0307411_10874392 3300032005 Bacteria 797
381 Ga0307415_100007314 3300032126 Bacteria 6030
382 Ga0307415_100035794 3300032126 Bacteria 3246
383 Ga0307415_100139544 3300032126 Bacteria 1849
384 Ga0307415_100266116 3300032126 Unclassified 1402
385 Ga0307415_100509266 3300032126 Bacteria 1054
386 Ga0373955_0412676 3300035172 Bacteria 821
387 Ga0395900_0041747 3300037418 Bacteria 4728
388 Ga0395905_0015900 3300037471 Bacteria 7149
389 Ga0395901_1458318 3300038443 Bacteria 641
390 Ga0436365_0861406 3300039437 Bacteria 61112
391 Ga0436365_0947596 3300039437 Bacteria 3628
392 Ga0436365_1839233 3300039437 Bacteria 2872
393 Ga0436365_1926687 3300039437 Bacteria 2586
394 Ga0436360_1040944 3300039438 Unclassified 554
395 Ga0436363_1307533 3300039450 Bacteria 637
396 Ga0451804_1119475 3300041463 Bacteria 618
397 Ga0451843_0715407 3300041509 Bacteria 728
398 Ga0439441_104615 3300042001 Bacteria 638
399 Ga0451577_0022276 3300042876 Bacteria 5785
400 Ga0451577_0279088 3300042876 Bacteria 1513
401 Ga0451577_0335525 3300042876 Bacteria 1371
402 Ga0466972_0001665 3300044658 Bacteria 10868
403 Ga0466965_0186806 3300044683 Bacteria 1095
404 Ga0453684_0035312 3300044712 Bacteria 6913
405 Ga0453684_0764850 3300044712 Bacteria 1044
406 Ga0466970_0005725 3300044765 Bacteria 6175
407 Ga0466960_0002003 3300044901 Bacteria 7561
408 Ga0451576_1011184 3300045051 Bacteria 871
409 Ga0495607_0019656 3300046501 Bacteria 4286
410 Ga0495628_0007266 3300046516 Bacteria 9595
411 Ga0495630_0061512 3300046517 Bacteria 2819
412 Ga0495663_0000453 3300046525 Bacteria 15016
413 Ga0495586_0008975 3300046535 Bacteria 5321
414 Ga0495598_0000091 3300046537 Bacteria 14636
415 Ga0495621_0000163 3300046539 Bacteria 14912
416 Ga0495634_0088614 3300046642 Bacteria 2012
417 Ga0495599_0070158 3300046678 Bacteria 2187
418 Ga0495670_0390107 3300046691 Bacteria 752
419 Ga0495636_0004660 3300047318 Bacteria 5378
420 Ga0495674_0005575 3300047319 Bacteria 12067
421 Ga0495672_0006846 3300047320 Bacteria 8704
422 Ga0495684_0021130 3300047471 Bacteria 5015
423 Ga0495684_0267135 3300047471 Bacteria 1239
424 Ga0495615_0162996 3300048090 Bacteria 670
425 Ga0496101_0120527 3300048904 Unclassified 1983
426 Ga0496103_0266791 3300048906 Bacteria 1101
427 Ga0496104_0570473 3300048907 Bacteria 1042
428 Ga0496107_0532032 3300048910 Bacteria 871
429 Ga0496108_0185944 3300048911 Bacteria 1800
430 Ga0496109_0015254 3300048912 Bacteria 6690
431 Ga0496109_0122696 3300048912 Bacteria 2421
432 Ga0496109_0238027 3300048912 Bacteria 1713
433 Ga0496110_0067624 3300048913 Bacteria 3162
434 Ga0496110_0182458 3300048913 Bacteria 1906
435 Ga0496112_0486006 3300048915 Bacteria 1171
436 Ga0496113_0259178 3300048916 Bacteria 1389
437 Ga0496113_0283461 3300048916 Bacteria 1325
438 Ga0501292_043533 3300049515 Bacteria 781
439 Ga0501292_059774 3300049515 Bacteria 690
440 Ga0501036_0044709 3300049572 Bacteria 3752
441 Ga0501040_0103368 3300049576 Bacteria 1989
442 Ga0501041_0042731 3300049577 Bacteria 2755
443 Ga0501042_0245760 3300049578 Bacteria 1291
444 Ga0501048_0025190 3300049582 Bacteria 4336
445 Ga0501067_0000953 3300049583 Bacteria 15496
446 Ga0501072_0293392 3300049588 Bacteria 1293
447 Ga0501072_1499401 3300049588 Bacteria 521
448 Ga0501073_0015295 3300049589 Bacteria 5564
449 Ga0501075_0440401 3300049591 Unclassified 994
450 Ga0501076_0005699 3300049592 Bacteria 8982
451 Ga0501077_0826578 3300049593 Bacteria 596
452 Ga0501209_124033 3300049656 Bacteria 768
453 Ga0501224_013541 3300049664 Bacteria 1205
454 Ga0501224_085191 3300049664 Bacteria 507
455 Ga0501233_050989 3300049668 Bacteria 1002
456 Ga0501235_073882 3300049669 Bacteria 809
457 Ga0501235_132271 3300049669 Bacteria 632
458 Ga0501235_162646 3300049669 Bacteria 585
459 Ga0501243_135385 3300049675 Unclassified 517
460 Ga0501248_005350 3300049678 Bacteria 1007
461 Ga0501249_003610 3300049679 Bacteria 3114
462 Ga0501257_007050 3300049686 Bacteria 2505
463 Ga0501259_054134 3300049688 Bacteria 822
464 Ga0501219_008541 3300049703 Bacteria 750
465 Ga0501221_009345 3300049704 Bacteria 1720
466 Ga0501079_0629964 3300049741 Bacteria 844
467 Ga0501083_1073306 3300049744 Unclassified 524
468 Ga0501270_000837 3300049767 Bacteria 2781
469 Ga0501272_002131 3300049769 Bacteria 1947
470 Ga0501273_001165 3300049770 Bacteria 2424
471 nmdc:mga03683_2448_c1 3300050489 Bacteria 5765
472 nmdc:mga03n38_30403_c1 3300050490 Bacteria 2270
473 nmdc:mga0yw44_339809_c1 3300050492 Bacteria 1010
474 nmdc:mga0k408_1673_c1 3300050493 Bacteria 11970
475 nmdc:mga06z11_2949_c1 3300050494 Bacteria 6552
476 nmdc:mga04h51_96103_c1 3300050495 Bacteria 1073
477 nmdc:mga04h51_9615_c1 3300050495 Unclassified 2629
478 nmdc:mga07m45_373662_c1 3300050496 Unclassified 828
479 nmdc:mga05p37_693918_c1 3300050507 Bacteria 1132
480 nmdc:mga09592_409997_c1 3300050508 Bacteria 1171
481 nmdc:mga09592_948080_c1 3300050508 Unclassified 721
482 nmdc:mga0qj67_26271_c1 3300050509 Bacteria 4507
483 nmdc:mga0qj67_673843_c1 3300050509 Bacteria 824
484 nmdc:mga0qj67_80814_c1 3300050509 Bacteria 2605
485 nmdc:mga06r32_51065_c1 3300050510 Bacteria 3957
486 nmdc:mga08y16_122_c1 3300050511 Bacteria 67305
487 nmdc:mga08y16_5289_c1 3300050511 Bacteria 13497
488 nmdc:mga08y16_781514_c1 3300050511 Bacteria 949
489 nmdc:mga0n895_2041112_c1 3300050512 Unclassified 531
490 nmdc:mga0rr50_736205_c1 3300050513 Bacteria 841
491 nmdc:mga0a205_360479_c1 3300050515 Bacteria 1320
492 nmdc:mga0a205_455565_c1 3300050515 Bacteria 1139
493 nmdc:mga0a205_607789_c1 3300050515 Unclassified 946
494 nmdc:mga0a205_659341_c1 3300050515 Bacteria 897
495 nmdc:mga0a205_801438_c1 3300050515 Bacteria 790
496 Ga0495601_0046681 3300053077 Bacteria 2726
497 Ga0500658_0093189 3300053134 Bacteria 1306
498 Ga0500622_0005971 3300053156 Bacteria 7166
499 Ga0500622_0093379 3300053156 Bacteria 1490
500 Ga0500637_0002574 3300053178 Bacteria 8104
501 Ga0501084_0279871 3300054114 Bacteria 1409
502 Ga0501084_0400088 3300054114 Bacteria 1161
503 Ga0157378_12540884
504 rootH2_10062662
505 Ga0055531_10027319
506 Ga0058863_11441775
507 Ga0065714_10148579
508 Ga0065704_10035083
509 Ga0065704_10355072
510 Ga0065712_10068047
511 Ga0065712_10239804
512 Ga0065715_10099278
513 Ga0065715_10217048
514 Ga0065707_10088575
515 Ga0070658_10004673
516 Ga0070658_10061896
517 Ga0070658_10134783
518 Ga0070676_11067136
519 Ga0070690_100005509
520 Ga0070690_100007704
521 Ga0070690_100461592
522 Ga0070670_100025220
523 Ga0070670_101106628
524 Ga0070677_10469521
525 Ga0068869_100014103
526 Ga0068869_100080243
527 Ga0068869_100744253
528 Ga0070666_10000767
529 Ga0070666_10002699
530 Ga0070666_10601297
531 Ga0068868_100002891
532 Ga0068868_100578712
533 Ga0070660_100000214
534 Ga0070689_100003324
535 Ga0070689_100016977
536 Ga0070689_100638925
537 Ga0070691_10018421
538 Ga0070687_100000241
539 Ga0070661_100291351
540 Ga0070661_100954738
541 Ga0070692_10290024
542 Ga0070692_11162073
543 Ga0070669_100013220
544 Ga0070669_100085492
545 Ga0070669_100354866
546 Ga0070675_100003764
547 Ga0070675_100388693
548 Ga0070671_100001794
549 Ga0070671_100001940
550 Ga0070671_101499379
551 Ga0070673_100043700
552 Ga0070673_100512093
553 Ga0070673_100572870
554 Ga0070673_100801891
555 Ga0070673_101273217
556 Ga0070688_100000389
557 Ga0070688_100002574
558 Ga0070659_100001202
559 Ga0070659_100282771
560 Ga0070667_100216359
561 Ga0070667_101422651
562 Ga0070667_101493685
563 Ga0070705_100014731
564 Ga0070700_100000056
565 Ga0070700_100384520
566 Ga0070678_100050133
567 Ga0070662_100001196
568 Ga0070662_100007301
569 Ga0070662_100669477
570 Ga0070662_101301249
571 Ga0070681_10237887
572 Ga0068867_100007657
573 Ga0068867_100011658
574 Ga0070685_10354947
575 Ga0070707_100009815
576 Ga0070699_100408909
577 Ga0070679_101537795
578 Ga0070684_100045803
579 Ga0070684_100063589
580 Ga0070697_100006709
581 Ga0068853_100603510
582 Ga0070672_100051268
583 Ga0070672_100707880
584 Ga0070686_100019907
585 Ga0070695_100090724
586 Ga0070695_100120119
587 Ga0070696_100294029
588 Ga0070693_100000641
589 Ga0070665_100001521
590 Ga0070665_100038653
591 Ga0070665_101114833
592 Ga0070664_100005842
593 Ga0070664_100011822
594 Ga0070664_101330394
595 Ga0068857_100001753
596 Ga0068857_100436290
597 Ga0068857_100672004
598 Ga0068854_100011914
599 Ga0070702_100111708
600 Ga0070702_100646871
601 Ga0070702_100754426
602 Ga0068852_100112794
603 Ga0068852_100227558
604 Ga0068859_100019498
605 Ga0068859_100245698
606 Ga0068859_101049271
607 Ga0068859_101968757
608 Ga0068864_100004004
609 Ga0068864_100107192
610 Ga0068864_100657637
611 Ga0068864_101223437
612 Ga0068866_10006018
613 Ga0068866_10090536
614 Ga0068861_100000562
615 Ga0068861_100000577
616 Ga0068861_100032990
617 Ga0068861_100095663
618 Ga0068861_101011232
619 Ga0068851_10001093
620 Ga0068851_10613007
621 Ga0068870_10011516
622 Ga0068870_10363494
623 Ga0068870_10413006
624 Ga0068863_100003717
625 Ga0068863_100007517
626 Ga0068863_100053869
627 Ga0068863_100233295
628 Ga0068863_100621813
629 Ga0068863_100749024
630 Ga0068863_100783729
631 Ga0068858_100006090
632 Ga0068858_100072795
633 Ga0068860_100174934
634 Ga0068860_100307078
635 Ga0068860_100554758
636 Ga0068860_101092584
637 Ga0068862_100029895
638 Ga0068862_100046498
639 Ga0068862_100073311
640 Ga0068862_100359943
641 Ga0068862_100547847
642 Ga0068862_101207915
643 Ga0081539_10035507
644 Ga0075368_10037190
645 Ga0075368_10184516
646 Ga0075364_10002052
647 Ga0075362_10020965
648 Ga0075367_10024806
649 Ga0075367_10312786
650 Ga0075366_10000302
651 Ga0075366_10979768
652 Ga0097621_100010243
653 Ga0097621_100229527
654 Ga0075370_10397198
655 Ga0075428_100018514
656 Ga0075428_100959448
657 Ga0075430_100010623
658 Ga0075430_100217121
659 Ga0075430_100316383
660 Ga0075430_100494073
661 Ga0075431_100225523
662 Ga0075433_10502713
663 Ga0075433_10568376
664 Ga0075433_10611119
665 Ga0075429_100036497
666 Ga0075429_100587891
667 Ga0068865_100261583
668 Ga0068865_100938012
669 Ga0097620_100019499
670 Ga0097620_100245694
671 Ga0097620_101049334
672 Ga0097620_101969479
673 Ga0075435_100496256
674 Ga0105240_10040933
675 Ga0105240_10965091
676 Ga0111539_10000099
677 Ga0111539_10116058
678 Ga0111539_10117917
679 Ga0105245_10000641
680 Ga0105245_12073518
681 Ga0105247_10018198
682 Ga0114129_10488508
683 Ga0105243_10077148
684 Ga0105243_10413777
685 Ga0105243_10899161
686 Ga0105241_10006878
687 Ga0105241_10250572
688 Ga0105241_10341937
689 Ga0105241_10834505
690 Ga0105242_10080633
691 Ga0105242_10106875
692 Ga0105242_10425444
693 Ga0105248_10005072
694 Ga0105237_10626263
695 Ga0105238_10060496
696 Ga0105249_10001405
697 Ga0105249_10015546
698 Ga0105249_10049294
699 Ga0105249_10067053
700 Ga0105249_10102115
701 Ga0105249_13332304
702 Ga0105239_10613032
703 Ga0105239_12748558
704 Ga0105239_13427710
705 Ga0105246_10069060
706 Ga0157371_10557383
707 Ga0157369_10002451
708 Ga0157369_10490476
709 Ga0157369_10630962
710 Ga0157374_10233982
711 Ga0157374_10456119
712 Ga0157378_10002122
713 Ga0157378_10302074
714 Ga0163162_10205427
715 Ga0157372_10012458
716 Ga0157372_10681806
717 Ga0163163_10009152
718 Ga0157380_10028565
719 Ga0157380_10048913
720 Ga0157380_11168861
721 Ga0157377_10003883
722 Ga0157379_10007314
723 Ga0157379_10127139
724 Ga0157379_10836552
725 Ga0157376_10210208
726 Ga0163161_11202889
727 Ga0213876_10000024
728 Ga0209257_1000437
729 Ga0207697_10001765
730 Ga0207656_10045092
731 Ga0207642_10036617
732 Ga0207710_10781921
733 Ga0207688_10000450
734 Ga0207688_10014280
735 Ga0207680_10005230
736 Ga0207680_10578044
737 Ga0207647_10000019
738 Ga0207647_10597039
739 Ga0207645_10001166
740 Ga0207645_10192595
741 Ga0207645_10720596
742 Ga0207643_10000113
743 Ga0207643_10088663
744 Ga0207643_10667954
745 Ga0207705_10006527
746 Ga0207705_10027757
747 Ga0207705_10078343
748 Ga0207705_11196320
749 Ga0207654_10625146
750 Ga0207654_10794695
751 Ga0207695_10030334
752 Ga0207695_10067526
753 Ga0207671_10497768
754 Ga0207657_10000059
755 Ga0207649_10031191
756 Ga0207649_10663316
757 Ga0207652_10030302
758 Ga0207681_10031477
759 Ga0207694_10001535
760 Ga0207650_10000514
761 Ga0207650_10034298
762 Ga0207650_10319660
763 Ga0207659_10212343
764 Ga0207644_10005866
765 Ga0207644_10377148
766 Ga0207644_10599656
767 Ga0207690_10214456
768 Ga0207706_10001171
769 Ga0207706_10003006
770 Ga0207706_10027587
771 Ga0207686_10088922
772 Ga0207709_10005185
773 Ga0207670_10137445
774 Ga0207670_10188726
775 Ga0207669_10094347
776 Ga0207704_10000136
777 Ga0207704_10105773
778 Ga0207704_10489492
779 Ga0207665_10785704
780 Ga0207691_10243695
781 Ga0207691_10590868
782 Ga0207711_10002981
783 Ga0207711_10149157
784 Ga0207711_11103579
785 Ga0207689_10000009
786 Ga0207689_10081879
787 Ga0207661_11169489
788 Ga0207679_10001112
789 Ga0207679_10001337
790 Ga0207679_10044140
791 Ga0207651_10160275
792 Ga0207651_11026635
793 Ga0207651_11378682
794 Ga0207651_11622355
795 Ga0207712_10000601
796 Ga0207712_10000977
797 Ga0207712_10596962
798 Ga0207668_10370134
799 Ga0207640_10006300
800 Ga0207640_10196049
801 Ga0207658_10462108
802 Ga0207658_11278002
803 Ga0207677_10092834
804 Ga0207703_10000632
805 Ga0207703_10056820
806 Ga0207703_10146389
807 Ga0207703_10348106
808 Ga0207703_10982188
809 Ga0207639_10000117
810 Ga0207678_10013247
811 Ga0207708_10000089
812 Ga0207708_10469712
813 Ga0207708_10641688
814 Ga0207702_10068161
815 Ga0207641_10001506
816 Ga0207641_10082030
817 Ga0207641_10206474
818 Ga0207641_10605499
819 Ga0207648_10007978
820 Ga0207648_10059561
821 Ga0207676_10006786
822 Ga0207676_10429802
823 Ga0207674_10000858
824 Ga0207674_10112976
825 Ga0207675_100000005
826 Ga0207675_100003665
827 Ga0207675_100015382
828 Ga0207675_100168584
829 Ga0207683_10001342
830 Ga0207683_10697643
831 Ga0207698_10055343
832 Ga0209813_10009972
833 Ga0209813_10082454
834 Ga0207428_10000201
835 Ga0207428_10016879
836 Ga0268266_10000007
837 Ga0268266_10522972
838 Ga0268265_10030100
839 Ga0268265_10101793
840 Ga0268265_10222728
841 Ga0268265_10344458
842 Ga0268265_11312082
843 Ga0268264_10001536
844 Ga0268264_10189775
845 Ga0268264_11420083
846 Ga0265760_10036224
847 Ga0307513_10147147
848 Ga0307513_10919903
849 Ga0307408_101463953
850 Ga0307516_10029632
851 Ga0307405_10019518
852 Ga0307405_10058067
853 Ga0307405_10059360
854 Ga0316577_10020123
855 Ga0307413_10000482
856 Ga0307413_10073191
857 Ga0307413_10170852
858 Ga0307413_10919382
859 Ga0307410_10001582
860 Ga0307410_10019234
861 Ga0307410_10073529
862 Ga0307410_10608632
863 Ga0307406_10012030
864 Ga0307406_10263352
865 Ga0307406_10803779
866 Ga0307406_10999681
867 Ga0307407_10001104
868 Ga0307407_10149132
869 Ga0307412_10295751
870 Ga0307409_100001611
871 Ga0307409_100017862
872 Ga0307409_100459574
873 Ga0307416_100194876
874 Ga0307416_100239706
875 Ga0307416_100549192
876 Ga0307416_101615747
877 Ga0307414_10020614
878 Ga0307414_10045985
879 Ga0307414_10084730
880 Ga0307414_10088793
881 Ga0307411_10003392
882 Ga0307411_10874392
883 Ga0307415_100007314
884 Ga0307415_100035794
885 Ga0307415_100139544
886 Ga0307415_100266116
887 Ga0307415_100509266
888 Ga0373955_0412676
889 Ga0395900_0041747
890 Ga0395905_0015900
891 Ga0395901_1458318
892 Ga0436365_0861406
893 Ga0436365_0947596
894 Ga0436365_1839233
895 Ga0436365_1926687
896 Ga0436360_1040944
897 Ga0436363_1307533
898 Ga0451804_1119475
899 Ga0451843_0715407
900 Ga0439441_104615
901 Ga0451577_0022276
902 Ga0451577_0279088
903 Ga0451577_0335525
904 Ga0466972_0001665
905 Ga0466965_0186806
906 Ga0453684_0035312
907 Ga0453684_0764850
908 Ga0466970_0005725
909 Ga0466960_0002003
910 Ga0451576_1011184
911 Ga0495607_0019656
912 Ga0495628_0007266
913 Ga0495630_0061512
914 Ga0495663_0000453
915 Ga0495586_0008975
916 Ga0495598_0000091
917 Ga0495621_0000163
918 Ga0495634_0088614
919 Ga0495599_0070158
920 Ga0495670_0390107
921 Ga0495636_0004660
922 Ga0495674_0005575
923 Ga0495672_0006846
924 Ga0495684_0021130
925 Ga0495684_0267135
926 Ga0495615_0162996
927 Ga0496101_0120527
928 Ga0496103_0266791
929 Ga0496104_0570473
930 Ga0496107_0532032
931 Ga0496108_0185944
932 Ga0496109_0015254
933 Ga0496109_0122696
934 Ga0496109_0238027
935 Ga0496110_0067624
936 Ga0496110_0182458
937 Ga0496112_0486006
938 Ga0496113_0259178
939 Ga0496113_0283461
940 Ga0501292_043533
941 Ga0501292_059774
942 Ga0501036_0044709
943 Ga0501040_0103368
944 Ga0501041_0042731
945 Ga0501042_0245760
946 Ga0501048_0025190
947 Ga0501067_0000953
948 Ga0501072_0293392
949 Ga0501072_1499401
950 Ga0501073_0015295
951 Ga0501075_0440401
952 Ga0501076_0005699
953 Ga0501077_0826578
954 Ga0501209_124033
955 Ga0501224_013541
956 Ga0501224_085191
957 Ga0501233_050989
958 Ga0501235_073882
959 Ga0501235_132271
960 Ga0501235_162646
961 Ga0501243_135385
962 Ga0501248_005350
963 Ga0501249_003610
964 Ga0501257_007050
965 Ga0501259_054134
966 Ga0501219_008541
967 Ga0501221_009345
968 Ga0501079_0629964
969 Ga0501083_1073306
970 Ga0501270_000837
971 Ga0501272_002131
972 Ga0501273_001165
973 nmdc:mga03683_2448_c1
974 nmdc:mga03n38_30403_c1
975 nmdc:mga0yw44_339809_c1
976 nmdc:mga0k408_1673_c1
977 nmdc:mga06z11_2949_c1
978 nmdc:mga04h51_96103_c1
979 nmdc:mga04h51_9615_c1
980 nmdc:mga07m45_373662_c1
981 nmdc:mga05p37_693918_c1
982 nmdc:mga09592_409997_c1
983 nmdc:mga09592_948080_c1
984 nmdc:mga0qj67_26271_c1
985 nmdc:mga0qj67_673843_c1
986 nmdc:mga0qj67_80814_c1
987 nmdc:mga06r32_51065_c1
988 nmdc:mga08y16_122_c1
989 nmdc:mga08y16_5289_c1
990 nmdc:mga08y16_781514_c1
991 nmdc:mga0n895_2041112_c1
992 nmdc:mga0rr50_736205_c1
993 nmdc:mga0a205_360479_c1
994 nmdc:mga0a205_455565_c1
995 nmdc:mga0a205_607789_c1
996 nmdc:mga0a205_659341_c1
997 nmdc:mga0a205_801438_c1
998 Ga0495601_0046681
999 Ga0500658_0093189
1000 Ga0500622_0005971
1001 Ga0500622_0093379
1002 Ga0500637_0002574
1003 Ga0501084_0279871
1004 Ga0501084_0400088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

9

126

0.91

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

125

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gus-assembly1.cif.gz_B mopii from clostridium pasteurianum (apo1) 0.7163 94 124
4z25-assembly4.cif.gz_J mimivirus r135 (residues 51-702) 0.7146 94 123
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.7063 3 126
3ic8-assembly2.cif.gz_A the crystal structure of a gst-like protein from pseudomonas syringae to 2.4a 0.7031 101 124
6wf7-assembly1.cif.gz_A methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ 0.6998 3 128
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9123 74 121 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8907 74 125 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8307 74 121 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8254 76 126 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8202 74 125 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A090E412-F1-model_v4 Glyoxalase-like domain-containing protein 0.9768 74 125
AF-A0A850JMV8-F1-model_v4 VOC family protein 0.9745 74 125
AF-A0A7W5TGB5-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9737 76 125 GO:0016829
AF-A0A136MF62-F1-model_v4 deleted 0.9735 74 125
AF-A0A1H2S8F6-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9718 76 125

Map