F455588

General Info

Members Datasets Scaffolds Average Seq Length
500 262 1000 82

Family's Representative Sequence

Representative Sequence 3300046463|Ga0495653_0551617|Ga0495653_0551617_267_515
Length 82
Sequence MSTASEIHIDREIDARGSFCPGPLMELIRGIKALPVGGVVAVLSSDPGSAKDIPAWIAKAGHEFMGAFQEAGYTRFIARKLR

Samples

Sample ID Description Type Environment
1 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
155 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
177 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
178 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
179 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
180 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
183 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 7.2
Rhizosphere 91.6
Stem 0
Stem Tuber 0
Unclassified 33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495653_0551617 3300046463 Unclassified 713
2 JGI24746J21847_1071757 3300001977 Unclassified 505
3 rootH1_10137305 3300003316 Bacteria 1548
4 rootH2_10302983 3300003320 Bacteria 1144
5 rootH2_10308316 3300003320 Bacteria 1171
6 rootL2_10198934 3300003322 Bacteria 1772
7 Ga0065707_10487993 3300005295 Unclassified 768
8 Ga0070676_11012557 3300005328 Unclassified 624
9 Ga0070676_11484455 3300005328 Unclassified 522
10 Ga0070683_100117808 3300005329 Unclassified 2508
11 Ga0070683_100358644 3300005329 Bacteria 1388
12 Ga0070683_101555627 3300005329 Bacteria 636
13 Ga0070677_10433949 3300005333 Bacteria 699
14 Ga0070666_11078504 3300005335 Bacteria 597
15 Ga0070660_100467992 3300005339 Unclassified 1047
16 Ga0070689_100222232 3300005340 Unclassified 1549
17 Ga0070691_10864624 3300005341 Unclassified 555
18 Ga0070687_100157599 3300005343 Bacteria 1339
19 Ga0070687_100240734 3300005343 Bacteria 1119
20 Ga0070661_100150090 3300005344 Bacteria 1761
21 Ga0070692_10134084 3300005345 Unclassified 1395
22 Ga0070692_10567792 3300005345 Unclassified 746
23 Ga0070669_101617418 3300005353 Archaea 564
24 Ga0070675_100333729 3300005354 Unclassified 1342
25 Ga0070675_100496269 3300005354 Unclassified 1099
26 Ga0070671_100527802 3300005355 Bacteria 1017
27 Ga0070674_100145846 3300005356 Bacteria 1781
28 Ga0070673_100190780 3300005364 Bacteria 1760
29 Ga0070673_100776401 3300005364 Bacteria 884
30 Ga0070688_100113206 3300005365 Bacteria 1807
31 Ga0070688_100213034 3300005365 Bacteria 1357
32 Ga0070688_101084870 3300005365 Bacteria 639
33 Ga0070659_100182939 3300005366 Bacteria 1720
34 Ga0070714_101275517 3300005435 Bacteria 717
35 Ga0070713_101142915 3300005436 Unclassified 753
36 Ga0070701_10493618 3300005438 Bacteria 793
37 Ga0070701_11182909 3300005438 Bacteria 542
38 Ga0070711_100444612 3300005439 Unclassified 1060
39 Ga0070705_101517591 3300005440 Bacteria 562
40 Ga0070700_100322383 3300005441 Bacteria 1136
41 Ga0070700_101479569 3300005441 Bacteria 577
42 Ga0070694_100368026 3300005444 Bacteria 1118
43 Ga0070678_100351942 3300005456 Unclassified 1267
44 Ga0070662_100252336 3300005457 Bacteria 1419
45 Ga0070662_100883422 3300005457 Bacteria 762
46 Ga0070681_10091928 3300005458 Bacteria 2984
47 Ga0068867_101176481 3300005459 Bacteria 703
48 Ga0070685_10069477 3300005466 Bacteria 2083
49 Ga0070685_10123209 3300005466 Unclassified 1612
50 Ga0070685_10453125 3300005466 Unclassified 899
51 Ga0070706_101061404 3300005467 Unclassified 746
52 Ga0070707_100046795 3300005468 Unclassified 4140
53 Ga0070698_100038976 3300005471 Bacteria 4895
54 Ga0070698_100448988 3300005471 Bacteria 1225
55 Ga0070699_100013137 3300005518 Bacteria 7140
56 Ga0070699_101693995 3300005518 Unclassified 579
57 Ga0070684_100152121 3300005535 Bacteria 2096
58 Ga0070684_100312087 3300005535 Unclassified 1444
59 Ga0068853_101292514 3300005539 Unclassified 705
60 Ga0070672_101484481 3300005543 Unclassified 607
61 Ga0070686_100010945 3300005544 Bacteria 5135
62 Ga0070695_100512168 3300005545 Unclassified 930
63 Ga0070695_100604547 3300005545 Bacteria 861
64 Ga0070696_101123557 3300005546 Bacteria 661
65 Ga0070696_101231481 3300005546 Bacteria 633
66 Ga0070693_100105368 3300005547 Unclassified 1725
67 Ga0070693_101326524 3300005547 Unclassified 557
68 Ga0070665_101489520 3300005548 Bacteria 685
69 Ga0070704_100156437 3300005549 Bacteria 1798
70 Ga0070664_100353324 3300005564 Unclassified 1337
71 Ga0068857_100062594 3300005577 Bacteria 3308
72 Ga0068857_101749041 3300005577 Unclassified 608
73 Ga0068857_101901306 3300005577 Unclassified 583
74 Ga0068854_100469755 3300005578 Bacteria 1054
75 Ga0068856_101460605 3300005614 Bacteria 698
76 Ga0068856_101939216 3300005614 Bacteria 600
77 Ga0070702_100783282 3300005615 Bacteria 736
78 Ga0068859_101723744 3300005617 Bacteria 692
79 Ga0068864_100035416 3300005618 Bacteria 4249
80 Ga0068864_100571259 3300005618 Bacteria 1095
81 Ga0068864_100649880 3300005618 Bacteria 1027
82 Ga0068864_101796146 3300005618 Unclassified 618
83 Ga0068866_10812111 3300005718 Bacteria 651
84 Ga0068861_100536551 3300005719 Bacteria 1064
85 Ga0068870_10280273 3300005840 Unclassified 1045
86 Ga0068863_100570147 3300005841 Bacteria 1119
87 Ga0068858_100481326 3300005842 Bacteria 1198
88 Ga0068858_100485228 3300005842 Bacteria 1193
89 Ga0068858_101288084 3300005842 Unclassified 719
90 Ga0068858_102447269 3300005842 Unclassified 516
91 Ga0068860_100498940 3300005843 Unclassified 1215
92 Ga0068860_101529897 3300005843 Bacteria 689
93 Ga0068862_100900679 3300005844 Bacteria 869
94 Ga0070715_10831867 3300006163 Bacteria 563
95 Ga0075427_10057079 3300006194 Bacteria 679
96 Ga0097621_101248560 3300006237 Bacteria 701
97 Ga0068871_102063421 3300006358 Bacteria 543
98 Ga0075428_100013622 3300006844 Bacteria 9055
99 Ga0075430_100602520 3300006846 Bacteria 906
100 Ga0075431_100582624 3300006847 Bacteria 1104
101 Ga0075433_10051692 3300006852 Bacteria 3579
102 Ga0075433_10107013 3300006852 Bacteria 2479
103 Ga0075434_100086236 3300006871 Bacteria 3140
104 Ga0075434_100336900 3300006871 Bacteria 1529
105 Ga0075429_100168680 3300006880 Bacteria 1917
106 Ga0068865_100053367 3300006881 Bacteria 2805
107 Ga0068865_100121472 3300006881 Bacteria 1943
108 Ga0068865_100178732 3300006881 Bacteria 1633
109 Ga0075436_101534471 3300006914 Unclassified 506
110 Ga0097620_101724304 3300006931 Bacteria 692
111 Ga0075435_100032533 3300007076 Unclassified 4120
112 Ga0105250_10560751 3300009092 Unclassified 525
113 Ga0111539_10015824 3300009094 Bacteria 9369
114 Ga0105245_10110394 3300009098 Bacteria 2557
115 Ga0105245_10535360 3300009098 Bacteria 1192
116 Ga0105245_10665574 3300009098 Bacteria 1072
117 Ga0105245_12544950 3300009098 Unclassified 565
118 Ga0105247_10508032 3300009101 Unclassified 879
119 Ga0114129_10000286 3300009147 Bacteria 58249
120 Ga0105243_10016596 3300009148 Bacteria 5568
121 Ga0105243_10018123 3300009148 Bacteria 5328
122 Ga0105243_10844755 3300009148 Bacteria 906
123 Ga0105242_10288558 3300009176 Bacteria 1493
124 Ga0105248_11840715 3300009177 Unclassified 687
125 Ga0105238_10764906 3300009551 Bacteria 980
126 Ga0105249_10026689 3300009553 Bacteria 5207
127 Ga0105249_10147857 3300009553 Bacteria 2259
128 Ga0105239_10324028 3300010375 Unclassified 1738
129 Ga0105239_10327314 3300010375 Bacteria 1728
130 Ga0105239_12031382 3300010375 Bacteria 668
131 Ga0105246_10023349 3300011119 Bacteria 4001
132 Ga0105246_10025408 3300011119 Bacteria 3860
133 Ga0105246_10049495 3300011119 Bacteria 2878
134 Ga0105246_10609636 3300011119 Bacteria 944
135 Ga0105246_10712341 3300011119 Bacteria 881
136 Ga0157373_10426728 3300013100 Bacteria 952
137 Ga0157373_10630186 3300013100 Bacteria 782
138 Ga0157374_12052440 3300013296 Unclassified 598
139 Ga0157378_10199257 3300013297 Bacteria 1893
140 Ga0157378_10220323 3300013297 Unclassified 1803
141 Ga0157378_10878849 3300013297 Unclassified 926
142 Ga0163162_10736583 3300013306 Bacteria 1106
143 Ga0163162_12700759 3300013306 Unclassified 571
144 Ga0157375_10431628 3300013308 Bacteria 1483
145 Ga0157375_10499089 3300013308 Bacteria 1381
146 Ga0163163_10255451 3300014325 Bacteria 1803
147 Ga0163163_10305754 3300014325 Bacteria 1643
148 Ga0163163_10447307 3300014325 Bacteria 1352
149 Ga0163163_10453453 3300014325 Unclassified 1343
150 Ga0163163_10662666 3300014325 Bacteria 1107
151 Ga0163163_11874133 3300014325 Bacteria 660
152 Ga0163163_13306808 3300014325 Bacteria 503
153 Ga0157380_10190708 3300014326 Unclassified 1809
154 Ga0157379_10027724 3300014968 Bacteria 5042
155 Ga0157379_10113749 3300014968 Bacteria 2432
156 Ga0157379_10160279 3300014968 Bacteria 2031
157 Ga0157379_10808647 3300014968 Bacteria 885
158 Ga0157379_11167903 3300014968 Bacteria 739
159 Ga0182005_1085520 3300015265 Bacteria 874
160 Ga0163161_10106319 3300017792 Unclassified 2094
161 Ga0163161_10778999 3300017792 Bacteria 802
162 Ga0207653_10015351 3300025885 Bacteria 2403
163 Ga0207680_10792220 3300025903 Bacteria 679
164 Ga0207645_11113599 3300025907 Unclassified 532
165 Ga0207643_10026166 3300025908 Unclassified 3228
166 Ga0207684_10065853 3300025910 Bacteria 3077
167 Ga0207663_10310855 3300025916 Bacteria 1181
168 Ga0207662_10216870 3300025918 Bacteria 1244
169 Ga0207657_10748872 3300025919 Unclassified 757
170 Ga0207649_10877937 3300025920 Bacteria 702
171 Ga0207646_10013021 3300025922 Bacteria 7967
172 Ga0207694_10625286 3300025924 Bacteria 906
173 Ga0207659_10810627 3300025926 Bacteria 804
174 Ga0207687_10062689 3300025927 Bacteria 2630
175 Ga0207687_10136072 3300025927 Bacteria 1858
176 Ga0207687_10558754 3300025927 Bacteria 961
177 Ga0207644_10482435 3300025931 Bacteria 1021
178 Ga0207690_10238768 3300025932 Bacteria 1399
179 Ga0207706_10287468 3300025933 Bacteria 1433
180 Ga0207709_10148486 3300025935 Bacteria 1621
181 Ga0207709_10575943 3300025935 Bacteria 888
182 Ga0207709_10638569 3300025935 Bacteria 846
183 Ga0207709_11751344 3300025935 Bacteria 517
184 Ga0207669_10063804 3300025937 Archaea 2276
185 Ga0207669_10068893 3300025937 Bacteria 2212
186 Ga0207669_10380079 3300025937 Bacteria 1100
187 Ga0207704_10044761 3300025938 Bacteria 2625
188 Ga0207704_10226674 3300025938 Bacteria 1387
189 Ga0207704_10516005 3300025938 Bacteria 966
190 Ga0207691_11295128 3300025940 Bacteria 602
191 Ga0207661_10162152 3300025944 Unclassified 1941
192 Ga0207661_11177290 3300025944 Unclassified 705
193 Ga0207679_10042742 3300025945 Bacteria 3259
194 Ga0207651_10156995 3300025960 Unclassified 1779
195 Ga0207651_12154465 3300025960 Unclassified 500
196 Ga0207712_10118924 3300025961 Unclassified 1996
197 Ga0207712_10605705 3300025961 Unclassified 948
198 Ga0207703_10948472 3300026035 Bacteria 825
199 Ga0207703_11035712 3300026035 Unclassified 788
200 Ga0207703_11226578 3300026035 Unclassified 721
201 Ga0207703_11477246 3300026035 Bacteria 654
202 Ga0207639_10129952 3300026041 Unclassified 2083
203 Ga0207639_11983541 3300026041 Bacteria 543
204 Ga0207708_10214167 3300026075 Bacteria 1541
205 Ga0207708_10927090 3300026075 Bacteria 755
206 Ga0207702_11591670 3300026078 Unclassified 647
207 Ga0207641_10106456 3300026088 Bacteria 2479
208 Ga0207641_10891555 3300026088 Bacteria 883
209 Ga0207648_10030522 3300026089 Bacteria 4773
210 Ga0207648_11275250 3300026089 Bacteria 690
211 Ga0207648_11555546 3300026089 Unclassified 622
212 Ga0207676_10120228 3300026095 Bacteria 2214
213 Ga0207676_10132470 3300026095 Bacteria 2122
214 Ga0207676_11323211 3300026095 Bacteria 715
215 Ga0207676_12595653 3300026095 Unclassified 503
216 Ga0207674_10062328 3300026116 Bacteria 3766
217 Ga0207674_10341437 3300026116 Bacteria 1448
218 Ga0207674_11377711 3300026116 Bacteria 675
219 Ga0207675_100435146 3300026118 Bacteria 1297
220 Ga0207675_101325943 3300026118 Unclassified 740
221 Ga0207683_10350397 3300026121 Unclassified 1355
222 Ga0207698_10213543 3300026142 Unclassified 1738
223 Ga0209999_1107984 3300027543 Bacteria 543
224 Ga0209974_10221450 3300027876 Bacteria 704
225 Ga0207428_10070341 3300027907 Bacteria 2750
226 Ga0268266_11155813 3300028379 Bacteria 749
227 Ga0268266_11355094 3300028379 Bacteria 687
228 Ga0268265_10830568 3300028380 Unclassified 903
229 Ga0268265_11090051 3300028380 Bacteria 792
230 Ga0268265_11225274 3300028380 Unclassified 749
231 Ga0268264_10423497 3300028381 Unclassified 1284
232 Ga0268264_10692574 3300028381 Bacteria 1012
233 Ga0268264_11568278 3300028381 Bacteria 669
234 Ga0268264_11584419 3300028381 Bacteria 666
235 Ga0265319_1277631 3300028563 Bacteria 510
236 Ga0265318_10003654 3300028577 Bacteria 7680
237 Ga0265325_10056488 3300031241 Bacteria 2005
238 Ga0307408_100250216 3300031548 Bacteria 1461
239 Ga0307405_10144741 3300031731 Bacteria 1663
240 Ga0307410_11206497 3300031852 Archaea 659
241 Ga0307406_10118272 3300031901 Bacteria 1837
242 Ga0307407_10663365 3300031903 Bacteria 782
243 Ga0307407_10996504 3300031903 Bacteria 647
244 Ga0307412_10223849 3300031911 Bacteria 1444
245 Ga0307409_100322491 3300031995 Bacteria 1446
246 Ga0307409_100731956 3300031995 Unclassified 991
247 Ga0307416_100009750 3300032002 Bacteria 6309
248 Ga0307416_100168619 3300032002 Bacteria 2035
249 Ga0307416_100318507 3300032002 Bacteria 1556
250 Ga0307416_102788669 3300032002 Bacteria 584
251 Ga0307414_11895292 3300032004 Bacteria 556
252 Ga0307411_10116737 3300032005 Bacteria 1922
253 Ga0307411_10258536 3300032005 Bacteria 1374
254 Ga0307411_10771129 3300032005 Bacteria 844
255 Ga0307411_10895206 3300032005 Unclassified 788
256 Ga0307415_100049572 3300032126 Unclassified 2840
257 Ga0307415_100194555 3300032126 Bacteria 1603
258 Ga0316583_10292092 3300032133 Bacteria 564
259 Ga0316586_1068072 3300033527 Unclassified 653
260 Ga0316596_1035392 3300033541 Unclassified 1306
261 Ga0316596_1118719 3300033541 Unclassified 719
262 Ga0373959_0209885 3300034820 Bacteria 518
263 Ga0373944_0104652 3300035089 Bacteria 960
264 Ga0373944_0118822 3300035089 Bacteria 909
265 Ga0373932_0212271 3300035112 Bacteria 692
266 Ga0373939_0423515 3300035114 Unclassified 556
267 Ga0373943_0475257 3300035170 Unclassified 728
268 Ga0373946_0426966 3300035171 Bacteria 672
269 Ga0316574_0621375 3300035398 Unclassified 666
270 Ga0316574_0624116 3300035398 Unclassified 665
271 Ga0373931_0328277 3300035691 Bacteria 952
272 Ga0373931_0524743 3300035691 Bacteria 767
273 Ga0373935_0150161 3300035692 Bacteria 1581
274 Ga0373927_0181243 3300035695 Unclassified 1382
275 Ga0373947_0132589 3300035725 Bacteria 1592
276 Ga0373947_0447818 3300035725 Bacteria 874
277 Ga0373937_0401014 3300036401 Unclassified 1301
278 Ga0316584_0525250 3300036712 Viruses 829
279 Ga0373925_0375481 3300037068 Bacteria 1157
280 Ga0373925_0709903 3300037068 Unclassified 829
281 Ga0439453_0068059 3300041408 Unclassified 749
282 Ga0439466_0094321 3300041411 Bacteria 937
283 Ga0439466_0249106 3300041411 Bacteria 538
284 Ga0451787_470658 3300041441 Bacteria 635
285 Ga0451853_3498283 3300041512 Unclassified 1217
286 Ga0439431_0191816 3300041997 Bacteria 593
287 Ga0439441_033435 3300042001 Unclassified 1006
288 Ga0439455_0212881 3300042012 Bacteria 561
289 Ga0450915_016434 3300042119 Bacteria 564
290 Ga0450910_002633 3300042147 Bacteria 2358
291 Ga0439446_0177039 3300042156 Bacteria 712
292 Ga0439434_0163474 3300042435 Unclassified 741
293 Ga0450916_025686 3300042530 Unclassified 833
294 Ga0450893_0048375 3300042532 Bacteria 793
295 Ga0451577_0234678 3300042876 Unclassified 1659
296 Ga0451577_1093527 3300042876 Bacteria 714
297 Ga0453683_0045268 3300044673 Bacteria 2759
298 Ga0453684_0865862 3300044712 Unclassified 970
299 Ga0451576_0071187 3300045051 Bacteria 3619
300 Ga0451576_0697703 3300045051 Bacteria 1066
301 Ga0495592_0439109 3300046454 Bacteria 820
302 Ga0495641_0514478 3300046461 Bacteria 546
303 Ga0495653_0858598 3300046463 Bacteria 543
304 Ga0495662_0068237 3300046476 Bacteria 1722
305 Ga0495628_0330806 3300046516 Bacteria 1123
306 Ga0495628_0542381 3300046516 Bacteria 836
307 Ga0495640_0663739 3300046533 Unclassified 627
308 Ga0495586_0347575 3300046535 Bacteria 852
309 Ga0495645_0376570 3300046543 Unclassified 909
310 Ga0495635_0784401 3300046663 Unclassified 615
311 Ga0495658_0362545 3300046683 Bacteria 922
312 Ga0495624_0233143 3300046690 Bacteria 1115
313 Ga0495589_0341172 3300046794 Bacteria 691
314 Ga0495676_0127759 3300047321 Bacteria 1840
315 Ga0495676_1044729 3300047321 Unclassified 520
316 Ga0495593_0127719 3300047673 Bacteria 1292
317 Ga0496101_0181331 3300048904 Bacteria 1622
318 Ga0496101_0441449 3300048904 Bacteria 1027
319 Ga0496102_0357425 3300048905 Unclassified 1375
320 Ga0496102_0806855 3300048905 Unclassified 861
321 Ga0496103_0427746 3300048906 Unclassified 850
322 Ga0496104_0073010 3300048907 Bacteria 3264
323 Ga0496104_0274281 3300048907 Unclassified 1599
324 Ga0496104_0666853 3300048907 Bacteria 949
325 Ga0496106_0153546 3300048909 Unclassified 1817
326 Ga0496106_1050351 3300048909 Bacteria 639
327 Ga0496107_0130792 3300048910 Unclassified 1853
328 Ga0496107_0154625 3300048910 Bacteria 1698
329 Ga0496108_0020957 3300048911 Bacteria 5374
330 Ga0496108_0093726 3300048911 Bacteria 2555
331 Ga0496108_0276771 3300048911 Bacteria 1461
332 Ga0496108_0511600 3300048911 Unclassified 1048
333 Ga0496109_0014248 3300048912 Bacteria 6917
334 Ga0496109_0202936 3300048912 Bacteria 1864
335 Ga0496109_0251559 3300048912 Unclassified 1664
336 Ga0496109_1326870 3300048912 Bacteria 655
337 Ga0496109_1831069 3300048912 Unclassified 540
338 Ga0496110_0008234 3300048913 Bacteria 8380
339 Ga0496111_0049409 3300048914 Unclassified 3033
340 Ga0496111_0615523 3300048914 Unclassified 794
341 Ga0496112_0293690 3300048915 Unclassified 1571
342 Ga0496112_0335435 3300048915 Unclassified 1456
343 Ga0496112_0442901 3300048915 Bacteria 1237
344 Ga0496113_0143658 3300048916 Unclassified 1879
345 Ga0496113_0986512 3300048916 Unclassified 664
346 Ga0496113_1253112 3300048916 Bacteria 578
347 Ga0496113_1375374 3300048916 Bacteria 547
348 Ga0496114_0370273 3300048917 Unclassified 1268
349 Ga0496114_0408903 3300048917 Bacteria 1202
350 Ga0496114_1190534 3300048917 Bacteria 648
351 Ga0496115_1029951 3300048918 Unclassified 628
352 Ga0501298_148086 3300049521 Unclassified 572
353 Ga0501031_0002020 3300049568 Bacteria 12777
354 Ga0501031_0129822 3300049568 Unclassified 1646
355 Ga0501031_1077067 3300049568 Bacteria 513
356 Ga0501032_0080185 3300049569 Bacteria 2172
357 Ga0501033_0014111 3300049570 Bacteria 6075
358 Ga0501033_0378663 3300049570 Unclassified 989
359 Ga0501033_0601472 3300049570 Unclassified 754
360 Ga0501034_0134418 3300049571 Bacteria 2455
361 Ga0501034_1263417 3300049571 Unclassified 616
362 Ga0501036_0006726 3300049572 Bacteria 9345
363 Ga0501036_0075284 3300049572 Bacteria 2855
364 Ga0501036_0316658 3300049572 Bacteria 1304
365 Ga0501036_0433353 3300049572 Bacteria 1096
366 Ga0501036_1000039 3300049572 Unclassified 685
367 Ga0501037_0099383 3300049573 Bacteria 2101
368 Ga0501037_0682886 3300049573 Unclassified 684
369 Ga0501038_0361540 3300049574 Archaea 1129
370 Ga0501038_0375345 3300049574 Unclassified 1104
371 Ga0501039_0036539 3300049575 Bacteria 3791
372 Ga0501039_0047952 3300049575 Bacteria 3302
373 Ga0501039_0156605 3300049575 Bacteria 1790
374 Ga0501039_0672234 3300049575 Bacteria 810
375 Ga0501039_0869215 3300049575 Unclassified 702
376 Ga0501039_0881786 3300049575 Unclassified 697
377 Ga0501039_1285409 3300049575 Bacteria 565
378 Ga0501040_0375996 3300049576 Bacteria 1019
379 Ga0501040_0788430 3300049576 Unclassified 687
380 Ga0501041_0024305 3300049577 Bacteria 3636
381 Ga0501041_0576795 3300049577 Bacteria 717
382 Ga0501042_0111255 3300049578 Unclassified 1972
383 Ga0501042_0147905 3300049578 Bacteria 1693
384 Ga0501042_0315500 3300049578 Bacteria 1129
385 Ga0501043_0026684 3300049579 Bacteria 4531
386 Ga0501043_0749664 3300049579 Bacteria 710
387 Ga0501046_0025797 3300049580 Bacteria 4805
388 Ga0501046_0079218 3300049580 Unclassified 2540
389 Ga0501046_0874433 3300049580 Unclassified 628
390 Ga0501048_0018516 3300049582 Bacteria 5119
391 Ga0501048_0048742 3300049582 Bacteria 3021
392 Ga0501048_0204199 3300049582 Unclassified 1401
393 Ga0501048_0736320 3300049582 Bacteria 708
394 Ga0501048_0883006 3300049582 Unclassified 643
395 Ga0501067_0492969 3300049583 Bacteria 685
396 Ga0501068_0014796 3300049584 Bacteria 4465
397 Ga0501068_0074306 3300049584 Unclassified 2078
398 Ga0501068_0108890 3300049584 Unclassified 1721
399 Ga0501068_0297959 3300049584 Unclassified 1032
400 Ga0501068_0759335 3300049584 Bacteria 635
401 Ga0501068_0779432 3300049584 Bacteria 627
402 Ga0501069_0015264 3300049585 Bacteria 4116
403 Ga0501069_0285281 3300049585 Unclassified 967
404 Ga0501070_0011535 3300049586 Bacteria 7459
405 Ga0501070_0809006 3300049586 Bacteria 735
406 Ga0501071_0024012 3300049587 Bacteria 4261
407 Ga0501071_0051534 3300049587 Unclassified 2966
408 Ga0501071_0082465 3300049587 Bacteria 2355
409 Ga0501071_0134703 3300049587 Bacteria 1837
410 Ga0501071_0346232 3300049587 Unclassified 1131
411 Ga0501071_0651167 3300049587 Bacteria 811
412 Ga0501071_1064729 3300049587 Unclassified 625
413 Ga0501071_1491566 3300049587 Unclassified 522
414 Ga0501072_0034022 3300049588 Bacteria 3992
415 Ga0501072_0042649 3300049588 Unclassified 3564
416 Ga0501072_0202319 3300049588 Unclassified 1583
417 Ga0501072_0458274 3300049588 Unclassified 1009
418 Ga0501072_0883425 3300049588 Archaea 698
419 Ga0501073_0021050 3300049589 Bacteria 4705
420 Ga0501074_0003913 3300049590 Bacteria 10610
421 Ga0501074_0056918 3300049590 Unclassified 2817
422 Ga0501074_0123611 3300049590 Bacteria 1851
423 Ga0501074_0146795 3300049590 Unclassified 1687
424 Ga0501074_0610886 3300049590 Bacteria 771
425 Ga0501075_0004911 3300049591 Bacteria 9115
426 Ga0501075_0023869 3300049591 Bacteria 4478
427 Ga0501075_0242369 3300049591 Unclassified 1374
428 Ga0501075_0610738 3300049591 Bacteria 832
429 Ga0501075_0627395 3300049591 Bacteria 820
430 Ga0501075_0721798 3300049591 Bacteria 759
431 Ga0501075_1355008 3300049591 Bacteria 539
432 Ga0501076_0232951 3300049592 Bacteria 1505
433 Ga0501076_0497502 3300049592 Unclassified 1005
434 Ga0501076_0523686 3300049592 Bacteria 977
435 Ga0501076_0823840 3300049592 Bacteria 766
436 Ga0501076_1005451 3300049592 Unclassified 687
437 Ga0501076_1178917 3300049592 Unclassified 630
438 Ga0501077_0006742 3300049593 Bacteria 7067
439 Ga0501077_0014205 3300049593 Bacteria 4999
440 Ga0501077_0061890 3300049593 Bacteria 2375
441 Ga0501077_0099264 3300049593 Unclassified 1845
442 Ga0501077_0275128 3300049593 Unclassified 1071
443 Ga0501077_0391832 3300049593 Bacteria 888
444 Ga0501077_0439310 3300049593 Bacteria 835
445 Ga0501077_0965286 3300049593 Unclassified 548
446 Ga0501079_0029782 3300049741 Bacteria 4192
447 Ga0501079_0089117 3300049741 Bacteria 2389
448 Ga0501079_0126372 3300049741 Unclassified 1989
449 Ga0501079_1388426 3300049741 Bacteria 553
450 Ga0501080_0049582 3300049742 Bacteria 3907
451 Ga0501080_0153825 3300049742 Unclassified 2125
452 Ga0501080_0391022 3300049742 Unclassified 1252
453 Ga0501080_1540118 3300049742 Unclassified 564
454 Ga0501081_0019175 3300049743 Bacteria 4550
455 Ga0501081_0058135 3300049743 Unclassified 2675
456 Ga0501081_0186842 3300049743 Bacteria 1500
457 Ga0501081_1507820 3300049743 Unclassified 511
458 Ga0501083_0079371 3300049744 Bacteria 2176
459 Ga0501035_0004781 3300049822 Bacteria 12857
460 Ga0501035_0974224 3300049822 Unclassified 668
461 Ga0501035_0990912 3300049822 Archaea 661
462 Ga0501035_1123597 3300049822 Bacteria 613
463 Ga0501044_0616080 3300049823 Bacteria 977
464 Ga0501044_0912833 3300049823 Bacteria 753
465 Ga0501045_0028141 3300049824 Bacteria 4053
466 Ga0501045_0048440 3300049824 Unclassified 3098
467 Ga0501045_0234386 3300049824 Bacteria 1366
468 Ga0501045_0957774 3300049824 Unclassified 628
469 nmdc:mga05p37_1968_c1 3300050507 Bacteria 23961
470 nmdc:mga09592_164275_c1 3300050508 Bacteria 1918
471 nmdc:mga0qj67_868435_c1 3300050509 Bacteria 712
472 nmdc:mga06r32_48607_c1 3300050510 Bacteria 4055
473 nmdc:mga08y16_37726_c1 3300050511 Bacteria 5072
474 nmdc:mga0n895_289441_c1 3300050512 Unclassified 1661
475 nmdc:mga0n895_691079_c1 3300050512 Bacteria 1017
476 nmdc:mga0a205_120463_c1 3300050515 Bacteria 2523
477 nmdc:mga0a205_28552_c1 3300050515 Bacteria 5335
478 Ga0495601_0090860 3300053077 Bacteria 1965
479 Ga0495601_0425702 3300053077 Bacteria 860
480 Ga0495601_0462831 3300053077 Bacteria 820
481 Ga0495612_0000203 3300053078 Bacteria 25447
482 Ga0495595_0372954 3300053084 Unclassified 722
483 Ga0495619_0216797 3300053085 Bacteria 1326
484 Ga0495619_0309115 3300053085 Bacteria 1095
485 Ga0495619_0423188 3300053085 Unclassified 919
486 Ga0500628_062582 3300053129 Bacteria 913
487 Ga0501084_0014654 3300054114 Bacteria 6499
488 Ga0501084_0048616 3300054114 Bacteria 3550
489 Ga0501084_0402688 3300054114 Unclassified 1157
490 Ga0501084_1074935 3300054114 Unclassified 676
491 Ga0501084_1271648 3300054114 Bacteria 617
492 Ga0501082_0076013 3300060353 Bacteria 2894
493 Ga0501082_0192179 3300060353 Unclassified 1775
494 Ga0501082_0211437 3300060353 Bacteria 1687
495 Ga0501082_2017247 3300060353 Unclassified 503
496 Ga0530510_0003811 3300061734 Bacteria 10392
497 Ga0530510_0049072 3300061734 Bacteria 3050
498 Ga0530510_0225550 3300061734 Bacteria 1393
499 Ga0530510_0513423 3300061734 Unclassified 909
500 Ga0530510_0578570 3300061734 Unclassified 854
501 Ga0495653_0551617
502 JGI24746J21847_1071757
503 rootH1_10137305
504 rootH2_10302983
505 rootH2_10308316
506 rootL2_10198934
507 Ga0065707_10487993
508 Ga0070676_11012557
509 Ga0070676_11484455
510 Ga0070683_100117808
511 Ga0070683_100358644
512 Ga0070683_101555627
513 Ga0070677_10433949
514 Ga0070666_11078504
515 Ga0070660_100467992
516 Ga0070689_100222232
517 Ga0070691_10864624
518 Ga0070687_100157599
519 Ga0070687_100240734
520 Ga0070661_100150090
521 Ga0070692_10134084
522 Ga0070692_10567792
523 Ga0070669_101617418
524 Ga0070675_100333729
525 Ga0070675_100496269
526 Ga0070671_100527802
527 Ga0070674_100145846
528 Ga0070673_100190780
529 Ga0070673_100776401
530 Ga0070688_100113206
531 Ga0070688_100213034
532 Ga0070688_101084870
533 Ga0070659_100182939
534 Ga0070714_101275517
535 Ga0070713_101142915
536 Ga0070701_10493618
537 Ga0070701_11182909
538 Ga0070711_100444612
539 Ga0070705_101517591
540 Ga0070700_100322383
541 Ga0070700_101479569
542 Ga0070694_100368026
543 Ga0070678_100351942
544 Ga0070662_100252336
545 Ga0070662_100883422
546 Ga0070681_10091928
547 Ga0068867_101176481
548 Ga0070685_10069477
549 Ga0070685_10123209
550 Ga0070685_10453125
551 Ga0070706_101061404
552 Ga0070707_100046795
553 Ga0070698_100038976
554 Ga0070698_100448988
555 Ga0070699_100013137
556 Ga0070699_101693995
557 Ga0070684_100152121
558 Ga0070684_100312087
559 Ga0068853_101292514
560 Ga0070672_101484481
561 Ga0070686_100010945
562 Ga0070695_100512168
563 Ga0070695_100604547
564 Ga0070696_101123557
565 Ga0070696_101231481
566 Ga0070693_100105368
567 Ga0070693_101326524
568 Ga0070665_101489520
569 Ga0070704_100156437
570 Ga0070664_100353324
571 Ga0068857_100062594
572 Ga0068857_101749041
573 Ga0068857_101901306
574 Ga0068854_100469755
575 Ga0068856_101460605
576 Ga0068856_101939216
577 Ga0070702_100783282
578 Ga0068859_101723744
579 Ga0068864_100035416
580 Ga0068864_100571259
581 Ga0068864_100649880
582 Ga0068864_101796146
583 Ga0068866_10812111
584 Ga0068861_100536551
585 Ga0068870_10280273
586 Ga0068863_100570147
587 Ga0068858_100481326
588 Ga0068858_100485228
589 Ga0068858_101288084
590 Ga0068858_102447269
591 Ga0068860_100498940
592 Ga0068860_101529897
593 Ga0068862_100900679
594 Ga0070715_10831867
595 Ga0075427_10057079
596 Ga0097621_101248560
597 Ga0068871_102063421
598 Ga0075428_100013622
599 Ga0075430_100602520
600 Ga0075431_100582624
601 Ga0075433_10051692
602 Ga0075433_10107013
603 Ga0075434_100086236
604 Ga0075434_100336900
605 Ga0075429_100168680
606 Ga0068865_100053367
607 Ga0068865_100121472
608 Ga0068865_100178732
609 Ga0075436_101534471
610 Ga0097620_101724304
611 Ga0075435_100032533
612 Ga0105250_10560751
613 Ga0111539_10015824
614 Ga0105245_10110394
615 Ga0105245_10535360
616 Ga0105245_10665574
617 Ga0105245_12544950
618 Ga0105247_10508032
619 Ga0114129_10000286
620 Ga0105243_10016596
621 Ga0105243_10018123
622 Ga0105243_10844755
623 Ga0105242_10288558
624 Ga0105248_11840715
625 Ga0105238_10764906
626 Ga0105249_10026689
627 Ga0105249_10147857
628 Ga0105239_10324028
629 Ga0105239_10327314
630 Ga0105239_12031382
631 Ga0105246_10023349
632 Ga0105246_10025408
633 Ga0105246_10049495
634 Ga0105246_10609636
635 Ga0105246_10712341
636 Ga0157373_10426728
637 Ga0157373_10630186
638 Ga0157374_12052440
639 Ga0157378_10199257
640 Ga0157378_10220323
641 Ga0157378_10878849
642 Ga0163162_10736583
643 Ga0163162_12700759
644 Ga0157375_10431628
645 Ga0157375_10499089
646 Ga0163163_10255451
647 Ga0163163_10305754
648 Ga0163163_10447307
649 Ga0163163_10453453
650 Ga0163163_10662666
651 Ga0163163_11874133
652 Ga0163163_13306808
653 Ga0157380_10190708
654 Ga0157379_10027724
655 Ga0157379_10113749
656 Ga0157379_10160279
657 Ga0157379_10808647
658 Ga0157379_11167903
659 Ga0182005_1085520
660 Ga0163161_10106319
661 Ga0163161_10778999
662 Ga0207653_10015351
663 Ga0207680_10792220
664 Ga0207645_11113599
665 Ga0207643_10026166
666 Ga0207684_10065853
667 Ga0207663_10310855
668 Ga0207662_10216870
669 Ga0207657_10748872
670 Ga0207649_10877937
671 Ga0207646_10013021
672 Ga0207694_10625286
673 Ga0207659_10810627
674 Ga0207687_10062689
675 Ga0207687_10136072
676 Ga0207687_10558754
677 Ga0207644_10482435
678 Ga0207690_10238768
679 Ga0207706_10287468
680 Ga0207709_10148486
681 Ga0207709_10575943
682 Ga0207709_10638569
683 Ga0207709_11751344
684 Ga0207669_10063804
685 Ga0207669_10068893
686 Ga0207669_10380079
687 Ga0207704_10044761
688 Ga0207704_10226674
689 Ga0207704_10516005
690 Ga0207691_11295128
691 Ga0207661_10162152
692 Ga0207661_11177290
693 Ga0207679_10042742
694 Ga0207651_10156995
695 Ga0207651_12154465
696 Ga0207712_10118924
697 Ga0207712_10605705
698 Ga0207703_10948472
699 Ga0207703_11035712
700 Ga0207703_11226578
701 Ga0207703_11477246
702 Ga0207639_10129952
703 Ga0207639_11983541
704 Ga0207708_10214167
705 Ga0207708_10927090
706 Ga0207702_11591670
707 Ga0207641_10106456
708 Ga0207641_10891555
709 Ga0207648_10030522
710 Ga0207648_11275250
711 Ga0207648_11555546
712 Ga0207676_10120228
713 Ga0207676_10132470
714 Ga0207676_11323211
715 Ga0207676_12595653
716 Ga0207674_10062328
717 Ga0207674_10341437
718 Ga0207674_11377711
719 Ga0207675_100435146
720 Ga0207675_101325943
721 Ga0207683_10350397
722 Ga0207698_10213543
723 Ga0209999_1107984
724 Ga0209974_10221450
725 Ga0207428_10070341
726 Ga0268266_11155813
727 Ga0268266_11355094
728 Ga0268265_10830568
729 Ga0268265_11090051
730 Ga0268265_11225274
731 Ga0268264_10423497
732 Ga0268264_10692574
733 Ga0268264_11568278
734 Ga0268264_11584419
735 Ga0265319_1277631
736 Ga0265318_10003654
737 Ga0265325_10056488
738 Ga0307408_100250216
739 Ga0307405_10144741
740 Ga0307410_11206497
741 Ga0307406_10118272
742 Ga0307407_10663365
743 Ga0307407_10996504
744 Ga0307412_10223849
745 Ga0307409_100322491
746 Ga0307409_100731956
747 Ga0307416_100009750
748 Ga0307416_100168619
749 Ga0307416_100318507
750 Ga0307416_102788669
751 Ga0307414_11895292
752 Ga0307411_10116737
753 Ga0307411_10258536
754 Ga0307411_10771129
755 Ga0307411_10895206
756 Ga0307415_100049572
757 Ga0307415_100194555
758 Ga0316583_10292092
759 Ga0316586_1068072
760 Ga0316596_1035392
761 Ga0316596_1118719
762 Ga0373959_0209885
763 Ga0373944_0104652
764 Ga0373944_0118822
765 Ga0373932_0212271
766 Ga0373939_0423515
767 Ga0373943_0475257
768 Ga0373946_0426966
769 Ga0316574_0621375
770 Ga0316574_0624116
771 Ga0373931_0328277
772 Ga0373931_0524743
773 Ga0373935_0150161
774 Ga0373927_0181243
775 Ga0373947_0132589
776 Ga0373947_0447818
777 Ga0373937_0401014
778 Ga0316584_0525250
779 Ga0373925_0375481
780 Ga0373925_0709903
781 Ga0439453_0068059
782 Ga0439466_0094321
783 Ga0439466_0249106
784 Ga0451787_470658
785 Ga0451853_3498283
786 Ga0439431_0191816
787 Ga0439441_033435
788 Ga0439455_0212881
789 Ga0450915_016434
790 Ga0450910_002633
791 Ga0439446_0177039
792 Ga0439434_0163474
793 Ga0450916_025686
794 Ga0450893_0048375
795 Ga0451577_0234678
796 Ga0451577_1093527
797 Ga0453683_0045268
798 Ga0453684_0865862
799 Ga0451576_0071187
800 Ga0451576_0697703
801 Ga0495592_0439109
802 Ga0495641_0514478
803 Ga0495653_0858598
804 Ga0495662_0068237
805 Ga0495628_0330806
806 Ga0495628_0542381
807 Ga0495640_0663739
808 Ga0495586_0347575
809 Ga0495645_0376570
810 Ga0495635_0784401
811 Ga0495658_0362545
812 Ga0495624_0233143
813 Ga0495589_0341172
814 Ga0495676_0127759
815 Ga0495676_1044729
816 Ga0495593_0127719
817 Ga0496101_0181331
818 Ga0496101_0441449
819 Ga0496102_0357425
820 Ga0496102_0806855
821 Ga0496103_0427746
822 Ga0496104_0073010
823 Ga0496104_0274281
824 Ga0496104_0666853
825 Ga0496106_0153546
826 Ga0496106_1050351
827 Ga0496107_0130792
828 Ga0496107_0154625
829 Ga0496108_0020957
830 Ga0496108_0093726
831 Ga0496108_0276771
832 Ga0496108_0511600
833 Ga0496109_0014248
834 Ga0496109_0202936
835 Ga0496109_0251559
836 Ga0496109_1326870
837 Ga0496109_1831069
838 Ga0496110_0008234
839 Ga0496111_0049409
840 Ga0496111_0615523
841 Ga0496112_0293690
842 Ga0496112_0335435
843 Ga0496112_0442901
844 Ga0496113_0143658
845 Ga0496113_0986512
846 Ga0496113_1253112
847 Ga0496113_1375374
848 Ga0496114_0370273
849 Ga0496114_0408903
850 Ga0496114_1190534
851 Ga0496115_1029951
852 Ga0501298_148086
853 Ga0501031_0002020
854 Ga0501031_0129822
855 Ga0501031_1077067
856 Ga0501032_0080185
857 Ga0501033_0014111
858 Ga0501033_0378663
859 Ga0501033_0601472
860 Ga0501034_0134418
861 Ga0501034_1263417
862 Ga0501036_0006726
863 Ga0501036_0075284
864 Ga0501036_0316658
865 Ga0501036_0433353
866 Ga0501036_1000039
867 Ga0501037_0099383
868 Ga0501037_0682886
869 Ga0501038_0361540
870 Ga0501038_0375345
871 Ga0501039_0036539
872 Ga0501039_0047952
873 Ga0501039_0156605
874 Ga0501039_0672234
875 Ga0501039_0869215
876 Ga0501039_0881786
877 Ga0501039_1285409
878 Ga0501040_0375996
879 Ga0501040_0788430
880 Ga0501041_0024305
881 Ga0501041_0576795
882 Ga0501042_0111255
883 Ga0501042_0147905
884 Ga0501042_0315500
885 Ga0501043_0026684
886 Ga0501043_0749664
887 Ga0501046_0025797
888 Ga0501046_0079218
889 Ga0501046_0874433
890 Ga0501048_0018516
891 Ga0501048_0048742
892 Ga0501048_0204199
893 Ga0501048_0736320
894 Ga0501048_0883006
895 Ga0501067_0492969
896 Ga0501068_0014796
897 Ga0501068_0074306
898 Ga0501068_0108890
899 Ga0501068_0297959
900 Ga0501068_0759335
901 Ga0501068_0779432
902 Ga0501069_0015264
903 Ga0501069_0285281
904 Ga0501070_0011535
905 Ga0501070_0809006
906 Ga0501071_0024012
907 Ga0501071_0051534
908 Ga0501071_0082465
909 Ga0501071_0134703
910 Ga0501071_0346232
911 Ga0501071_0651167
912 Ga0501071_1064729
913 Ga0501071_1491566
914 Ga0501072_0034022
915 Ga0501072_0042649
916 Ga0501072_0202319
917 Ga0501072_0458274
918 Ga0501072_0883425
919 Ga0501073_0021050
920 Ga0501074_0003913
921 Ga0501074_0056918
922 Ga0501074_0123611
923 Ga0501074_0146795
924 Ga0501074_0610886
925 Ga0501075_0004911
926 Ga0501075_0023869
927 Ga0501075_0242369
928 Ga0501075_0610738
929 Ga0501075_0627395
930 Ga0501075_0721798
931 Ga0501075_1355008
932 Ga0501076_0232951
933 Ga0501076_0497502
934 Ga0501076_0523686
935 Ga0501076_0823840
936 Ga0501076_1005451
937 Ga0501076_1178917
938 Ga0501077_0006742
939 Ga0501077_0014205
940 Ga0501077_0061890
941 Ga0501077_0099264
942 Ga0501077_0275128
943 Ga0501077_0391832
944 Ga0501077_0439310
945 Ga0501077_0965286
946 Ga0501079_0029782
947 Ga0501079_0089117
948 Ga0501079_0126372
949 Ga0501079_1388426
950 Ga0501080_0049582
951 Ga0501080_0153825
952 Ga0501080_0391022
953 Ga0501080_1540118
954 Ga0501081_0019175
955 Ga0501081_0058135
956 Ga0501081_0186842
957 Ga0501081_1507820
958 Ga0501083_0079371
959 Ga0501035_0004781
960 Ga0501035_0974224
961 Ga0501035_0990912
962 Ga0501035_1123597
963 Ga0501044_0616080
964 Ga0501044_0912833
965 Ga0501045_0028141
966 Ga0501045_0048440
967 Ga0501045_0234386
968 Ga0501045_0957774
969 nmdc:mga05p37_1968_c1
970 nmdc:mga09592_164275_c1
971 nmdc:mga0qj67_868435_c1
972 nmdc:mga06r32_48607_c1
973 nmdc:mga08y16_37726_c1
974 nmdc:mga0n895_289441_c1
975 nmdc:mga0n895_691079_c1
976 nmdc:mga0a205_120463_c1
977 nmdc:mga0a205_28552_c1
978 Ga0495601_0090860
979 Ga0495601_0425702
980 Ga0495601_0462831
981 Ga0495612_0000203
982 Ga0495595_0372954
983 Ga0495619_0216797
984 Ga0495619_0309115
985 Ga0495619_0423188
986 Ga0500628_062582
987 Ga0501084_0014654
988 Ga0501084_0048616
989 Ga0501084_0402688
990 Ga0501084_1074935
991 Ga0501084_1271648
992 Ga0501082_0076013
993 Ga0501082_0192179
994 Ga0501082_0211437
995 Ga0501082_2017247
996 Ga0530510_0003811
997 Ga0530510_0049072
998 Ga0530510_0225550
999 Ga0530510_0513423
1000 Ga0530510_0578570

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01206

TusA

Sulfurtransferase TusA

11

80

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lvk-assembly1.cif.gz_B-2 crystal structure of e.coli iscs-tusa complex (form 2) 0.8926 11 80
3hz7-assembly1.cif.gz_A crystal structure of the sira-like protein (dsy4693) from desulfitobacterium hafniense, northeast structural genomics consortium target dhr2a 0.8409 10 82
3hz7-assembly1.cif.gz_A crystal structure of the sira-like protein (dsy4693) from desulfitobacterium hafniense, northeast structural genomics consortium target dhr2a 0.8209 10 82
3lvk-assembly1.cif.gz_B-2 crystal structure of e.coli iscs-tusa complex (form 2) 0.8159 11 80
7cdw-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis elongation factor g1 0.8078 47 80
ID Description Score Start End Superfamily
af_Q2G1R7_113_189_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9389 10 80 3.30.110.40
af_Q2FWL8_3_73_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9355 11 80 3.30.110.40
af_Q58397_3_75_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.918 10 80 3.30.110.40
af_Q2FWL8_3_73_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.9107 11 80 3.30.110.40
af_Q58397_3_75_3.30.110.40 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;TusA-like domain 0.883 10 80 3.30.110.40
ID Description Score Start End GO Terms
AF-T1BV06-F1-model_v4 SirA family protein 0.9768 12 82
AF-A0A7C4HDL6-F1-model_v4 Sulfurtransferase TusA family protein 0.9729 12 82 GO:0016740
AF-A0A2M7FAT5-F1-model_v4 UPF0033 domain-containing protein 0.9724 12 81
AF-A0A2W4N2D3-F1-model_v4 UPF0033 domain-containing protein 0.9701 11 82
AF-A0A4R2RNC9-F1-model_v4 tRNA 2-thiouridine synthesizing protein A 0.9674 9 81

Map