F455546

General Info

Members Datasets Scaffolds Average Seq Length
500 294 1000 125

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10881040|Ga0207646_108810401
Length 140
Sequence LDIQLTDREADVMQVLWDHGPSVVNEVKEKLVDELAYTTVLTILRTLETKGYVGHEEEGRVHRYFPTVKEDAARKSALQHLTGKLFKGSSELLFTHLVTDRKLAAIAYIDDRAVRFTNWADALTAVDIEPLVTGERTEAP

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
98 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
158 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
159 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
181 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
184 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
185 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
186 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
189 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
192 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
219 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
270 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
271 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
272 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
273 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
274 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
275 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
276 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
277 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
280 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
281 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
284 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
285 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
286 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
287 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
288 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
289 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
290 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
291 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
292 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
293 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
294 2919404418 Luteibacter sp. 3190 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.2
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17
Nodule 0
Rhizoplane 1.4
Rhizosphere 72
Stem 0
Stem Tuber 0
Unclassified 15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10881040 3300025922 Unclassified 795
2 JGI25156J39149_1011123 3300002705 Bacteria 2060
3 JGI25162J39368_1002426 3300002737 Bacteria 7286
4 JGI25162J39368_1009812 3300002737 Bacteria 1253
5 JGI25154J39366_1002856 3300002738 Unclassified 4057
6 JGI25157J39369_1006704 3300002741 Bacteria 1726
7 JGI25164J39214_1000154 3300002772 Bacteria 64762
8 JGI25152J39213_1026070 3300002773 Bacteria 960
9 JGI25165J46597_1000212 3300003214 Bacteria 82334
10 rootL2_10056726 3300003322 Bacteria 5189
11 rootL2_10056727 3300003322 Bacteria 4653
12 Ga0055527_1000190 3300003760 Bacteria 40884
13 Ga0055527_1000338 3300003760 Bacteria 23934
14 Ga0055535_1000397 3300003761 Bacteria 40876
15 Ga0055535_1001139 3300003761 Bacteria 15774
16 Ga0055535_1002251 3300003761 Bacteria 7200
17 Ga0055542_1000043 3300003762 Bacteria 207531
18 Ga0055542_1000141 3300003762 Bacteria 90014
19 Ga0055542_1000640 3300003762 Bacteria 29300
20 Ga0055542_1000878 3300003762 Bacteria 20838
21 Ga0055529_1000164 3300003763 Bacteria 91966
22 Ga0055529_1000380 3300003763 Bacteria 48083
23 Ga0055529_1001750 3300003763 Bacteria 5423
24 JGI25405J52794_10111194 3300003911 Unclassified 615
25 Ga0065165_1000399 3300005262 Bacteria 70029
26 Ga0070676_10045526 3300005328 Bacteria 2556
27 Ga0070676_10238595 3300005328 Bacteria 1208
28 Ga0070690_100018381 3300005330 Bacteria 4222
29 Ga0070670_100093737 3300005331 Bacteria 2583
30 Ga0070670_100268601 3300005331 Bacteria 1488
31 Ga0070677_10007039 3300005333 Bacteria 3743
32 Ga0070677_10070800 3300005333 Bacteria 1466
33 Ga0068869_100102068 3300005334 Bacteria 2171
34 Ga0068869_100114759 3300005334 Bacteria 2053
35 Ga0068869_100571486 3300005334 Bacteria 952
36 Ga0070682_100051076 3300005337 Bacteria 2583
37 Ga0070682_100535125 3300005337 Bacteria 914
38 Ga0068868_100554832 3300005338 Bacteria 1013
39 Ga0068868_100777269 3300005338 Bacteria 862
40 Ga0070660_100893072 3300005339 Bacteria 749
41 Ga0070689_100085594 3300005340 Bacteria 2479
42 Ga0070689_100087122 3300005340 Bacteria 2456
43 Ga0070689_101372535 3300005340 Unclassified 638
44 Ga0070668_100109680 3300005347 Bacteria 2196
45 Ga0070669_100034186 3300005353 Bacteria 3681
46 Ga0070669_100869622 3300005353 Bacteria 769
47 Ga0070669_100962995 3300005353 Bacteria 731
48 Ga0070675_100005733 3300005354 Bacteria 9498
49 Ga0070675_100311679 3300005354 Bacteria 1388
50 Ga0070675_101094153 3300005354 Bacteria 733
51 Ga0070671_100446011 3300005355 Bacteria 1110
52 Ga0070674_100071614 3300005356 Bacteria 2452
53 Ga0070674_100152256 3300005356 Bacteria 1746
54 Ga0070674_100339235 3300005356 Bacteria 1210
55 Ga0070674_101975827 3300005356 Bacteria 531
56 Ga0070673_100082844 3300005364 Bacteria 2605
57 Ga0070688_100347573 3300005365 Bacteria 1085
58 Ga0070667_100158004 3300005367 Unclassified 1995
59 Ga0070667_102086541 3300005367 Unclassified 534
60 Ga0070701_10899854 3300005438 Bacteria 611
61 Ga0070711_101204600 3300005439 Bacteria 655
62 Ga0070705_100129763 3300005440 Bacteria 1642
63 Ga0070694_100074077 3300005444 Bacteria 2353
64 Ga0070663_100209942 3300005455 Bacteria 1524
65 Ga0070678_100055977 3300005456 Bacteria 2882
66 Ga0070678_100444681 3300005456 Bacteria 1134
67 Ga0070662_100280562 3300005457 Bacteria 1348
68 Ga0068867_100023833 3300005459 Bacteria 4384
69 Ga0068867_100085418 3300005459 Bacteria 2386
70 Ga0068867_100613694 3300005459 Bacteria 950
71 Ga0068853_101510293 3300005539 Bacteria 650
72 Ga0070672_100024873 3300005543 Bacteria 4433
73 Ga0070672_100031800 3300005543 Bacteria 3977
74 Ga0070672_100128623 3300005543 Bacteria 2080
75 Ga0070672_100607723 3300005543 Bacteria 953
76 Ga0070686_100029883 3300005544 Bacteria 3320
77 Ga0070686_101832692 3300005544 Bacteria 517
78 Ga0070665_100002609 3300005548 Bacteria 19675
79 Ga0068855_100291621 3300005563 Bacteria 1809
80 Ga0070664_100059307 3300005564 Bacteria 3256
81 Ga0068856_100014428 3300005614 Bacteria 7632
82 Ga0070702_100013478 3300005615 Bacteria 4128
83 Ga0070702_100955413 3300005615 Bacteria 675
84 Ga0068852_102667601 3300005616 Bacteria 519
85 Ga0068859_100058587 3300005617 Bacteria 3879
86 Ga0068859_100202116 3300005617 Bacteria 2072
87 Ga0068859_100493463 3300005617 Bacteria 1320
88 Ga0068859_101544825 3300005617 Bacteria 733
89 Ga0068864_100122582 3300005618 Bacteria 2326
90 Ga0068864_101130862 3300005618 Unclassified 780
91 Ga0068861_100055755 3300005719 Bacteria 3015
92 Ga0068861_101047393 3300005719 Bacteria 781
93 Ga0068861_101202780 3300005719 Bacteria 733
94 Ga0068851_10288050 3300005834 Bacteria 941
95 Ga0068870_10282583 3300005840 Unclassified 1041
96 Ga0068870_10432245 3300005840 Bacteria 864
97 Ga0068863_100073500 3300005841 Bacteria 3234
98 Ga0068863_100709782 3300005841 Unclassified 1000
99 Ga0068858_100010563 3300005842 Bacteria 8744
100 Ga0068860_100534844 3300005843 Bacteria 1173
101 Ga0068862_100010197 3300005844 Bacteria 7753
102 Ga0068862_100026234 3300005844 Bacteria 4897
103 Ga0068862_100079534 3300005844 Bacteria 2842
104 Ga0068862_100161939 3300005844 Bacteria 1998
105 Ga0068862_102078484 3300005844 Bacteria 579
106 Ga0081540_1014229 3300005983 Bacteria 5112
107 Ga0075365_10004402 3300006038 Bacteria 7459
108 Ga0075368_10180511 3300006042 Bacteria 890
109 Ga0075363_100318905 3300006048 Bacteria 904
110 Ga0075364_10141253 3300006051 Bacteria 1620
111 Ga0075364_10362698 3300006051 Bacteria 988
112 Ga0070715_10888174 3300006163 Bacteria 548
113 Ga0070716_100328468 3300006173 Bacteria 1074
114 Ga0075362_10096583 3300006177 Bacteria 1377
115 Ga0075367_10142938 3300006178 Bacteria 1483
116 Ga0097621_100022364 3300006237 Bacteria 4908
117 Ga0097621_100372828 3300006237 Bacteria 1273
118 Ga0075370_10138954 3300006353 Bacteria 1420
119 Ga0068871_100003635 3300006358 Bacteria 10596
120 Ga0068871_100023027 3300006358 Bacteria 4810
121 Ga0068871_100031947 3300006358 Bacteria 4153
122 Ga0068871_100133452 3300006358 Bacteria 2107
123 Ga0068871_100208909 3300006358 Unclassified 1688
124 Ga0068871_100768045 3300006358 Bacteria 887
125 Ga0068871_101579314 3300006358 Bacteria 621
126 Ga0075430_101202648 3300006846 Bacteria 624
127 Ga0068865_100504597 3300006881 Bacteria 1009
128 Ga0068865_100565208 3300006881 Unclassified 957
129 Ga0068865_100992176 3300006881 Unclassified 735
130 Ga0097620_100058588 3300006931 Bacteria 3879
131 Ga0097620_100202112 3300006931 Bacteria 2072
132 Ga0097620_100493476 3300006931 Bacteria 1320
133 Ga0097620_101544612 3300006931 Bacteria 733
134 Ga0099795_10100351 3300007788 Bacteria 1135
135 Ga0105240_10018394 3300009093 Bacteria 9382
136 Ga0105240_10023512 3300009093 Bacteria 8147
137 Ga0105240_10061047 3300009093 Unclassified 4698
138 Ga0111539_10028681 3300009094 Bacteria 6788
139 Ga0111539_11945904 3300009094 Unclassified 682
140 Ga0111539_12641472 3300009094 Bacteria 582
141 Ga0105247_10028577 3300009101 Bacteria 3375
142 Ga0105243_10313047 3300009148 Bacteria 1427
143 Ga0105241_10090111 3300009174 Bacteria 2418
144 Ga0105248_10317323 3300009177 Bacteria 1755
145 Ga0105248_10560569 3300009177 Bacteria 1289
146 Ga0105248_12492381 3300009177 Unclassified 589
147 Ga0105237_10161141 3300009545 Bacteria 2242
148 Ga0105237_10991223 3300009545 Unclassified 847
149 Ga0105237_11532278 3300009545 Bacteria 673
150 Ga0105238_10011012 3300009551 Bacteria 9095
151 Ga0105238_10127361 3300009551 Unclassified 2525
152 Ga0105238_10151283 3300009551 Bacteria 2296
153 Ga0105238_10726118 3300009551 Bacteria 1006
154 Ga0105249_10110968 3300009553 Unclassified 2592
155 Ga0105249_10154634 3300009553 Unclassified 2211
156 Ga0105239_10028365 3300010375 Bacteria 6158
157 Ga0105239_11344426 3300010375 Unclassified 824
158 Ga0105239_11399264 3300010375 Bacteria 807
159 Ga0157373_10112561 3300013100 Bacteria 1913
160 Ga0157370_11021135 3300013104 Bacteria 748
161 Ga0157369_11837281 3300013105 Bacteria 615
162 Ga0157374_11373133 3300013296 Unclassified 729
163 Ga0163162_10270915 3300013306 Bacteria 1829
164 Ga0163162_12603694 3300013306 Bacteria 582
165 Ga0157375_10085770 3300013308 Bacteria 3199
166 Ga0157375_10466403 3300013308 Unclassified 1428
167 Ga0163163_10045218 3300014325 Bacteria 4321
168 Ga0163163_11272225 3300014325 Unclassified 798
169 Ga0163163_11774441 3300014325 Archaea 677
170 Ga0163163_12594626 3300014325 Unclassified 564
171 Ga0157380_10006415 3300014326 Bacteria 8281
172 Ga0157380_10080380 3300014326 Bacteria 2664
173 Ga0157380_10088189 3300014326 Bacteria 2552
174 Ga0157380_10229870 3300014326 Bacteria 1665
175 Ga0157380_10514263 3300014326 Bacteria 1166
176 Ga0157380_12986404 3300014326 Bacteria 539
177 Ga0182008_10153544 3300014497 Bacteria 1156
178 Ga0157377_10568211 3300014745 Bacteria 804
179 Ga0157379_10051353 3300014968 Bacteria 3683
180 Ga0157379_10058551 3300014968 Bacteria 3445
181 Ga0157379_11241355 3300014968 Bacteria 718
182 Ga0157376_10011326 3300014969 Bacteria 6570
183 Ga0157376_10052626 3300014969 Bacteria 3386
184 Ga0157376_10383731 3300014969 Unclassified 1354
185 Ga0157376_11246095 3300014969 Unclassified 773
186 Ga0183369_1003 3300015685 Bacteria 726443
187 Ga0183360_10195 3300015689 Bacteria 1371
188 Ga0163161_10044724 3300017792 Bacteria 3190
189 Ga0163161_10641067 3300017792 Bacteria 879
190 Ga0163161_10835896 3300017792 Bacteria 776
191 Ga0163161_11047326 3300017792 Unclassified 699
192 Ga0163161_12011831 3300017792 Bacteria 514
193 Ga0209672_100005 3300025228 Bacteria 1069303
194 Ga0209672_100009 3300025228 Bacteria 883623
195 Ga0209672_100176 3300025228 Bacteria 53116
196 Ga0209672_100177 3300025228 Bacteria 52900
197 Ga0209672_102275 3300025228 Bacteria 4928
198 Ga0207427_100062 3300025231 Bacteria 178598
199 Ga0209437_100258 3300025233 Bacteria 82547
200 Ga0209437_101225 3300025233 Bacteria 7315
201 Ga0209258_100006 3300025242 Bacteria 1069303
202 Ga0209258_100011 3300025242 Bacteria 867542
203 Ga0209258_100088 3300025242 Bacteria 237738
204 Ga0209258_100265 3300025242 Bacteria 90172
205 Ga0209646_1007280 3300025246 Bacteria 1813
206 Ga0209026_1000519 3300025250 Bacteria 27158
207 Ga0209148_1000012 3300025254 Bacteria 1069303
208 Ga0209148_1000013 3300025254 Bacteria 956684
209 Ga0209148_1000024 3300025254 Bacteria 669890
210 Ga0209148_1000065 3300025254 Bacteria 344489
211 Ga0209759_1001333 3300025256 Bacteria 14483
212 Ga0209129_1000549 3300025258 Bacteria 25987
213 Ga0209233_1000023 3300025261 Bacteria 738870
214 Ga0209455_1000008 3300025272 Bacteria 1069303
215 Ga0209455_1000012 3300025272 Bacteria 867234
216 Ga0209455_1000025 3300025272 Bacteria 670673
217 Ga0209455_1007824 3300025272 Bacteria 2972
218 Ga0209564_1001290 3300025295 Bacteria 27322
219 Ga0209758_1021743 3300025297 Bacteria 2977
220 Ga0209256_1003089 3300025299 Bacteria 12222
221 Ga0207426_1022091 3300025302 Bacteria 2190
222 Ga0207682_10010980 3300025893 Bacteria 3547
223 Ga0207682_10179854 3300025893 Bacteria 966
224 Ga0207692_10659922 3300025898 Bacteria 676
225 Ga0207642_10309962 3300025899 Unclassified 918
226 Ga0207642_10848358 3300025899 Bacteria 583
227 Ga0207645_10141843 3300025907 Bacteria 1566
228 Ga0207645_10255552 3300025907 Bacteria 1160
229 Ga0207643_10248378 3300025908 Unclassified 1095
230 Ga0207654_10694604 3300025911 Unclassified 731
231 Ga0207695_10038300 3300025913 Bacteria 5164
232 Ga0207695_10041340 3300025913 Unclassified 4935
233 Ga0207695_10119265 3300025913 Bacteria 2608
234 Ga0207695_11388610 3300025913 Bacteria 583
235 Ga0207671_10255432 3300025914 Bacteria 1378
236 Ga0207662_10289227 3300025918 Bacteria 1086
237 Ga0207657_11169675 3300025919 Unclassified 586
238 Ga0207681_10117244 3300025923 Bacteria 1947
239 Ga0207681_10599332 3300025923 Bacteria 910
240 Ga0207694_10133986 3300025924 Unclassified 1988
241 Ga0207694_10150228 3300025924 Bacteria 1876
242 Ga0207694_10509964 3300025924 Unclassified 1007
243 Ga0207659_10014256 3300025926 Bacteria 5118
244 Ga0207659_10179365 3300025926 Bacteria 1677
245 Ga0207659_10336287 3300025926 Unclassified 1249
246 Ga0207659_10611425 3300025926 Bacteria 930
247 Ga0207659_11441282 3300025926 Bacteria 590
248 Ga0207686_10155387 3300025934 Bacteria 1597
249 Ga0207686_10344587 3300025934 Bacteria 1120
250 Ga0207709_10103761 3300025935 Bacteria 1885
251 Ga0207670_10130490 3300025936 Bacteria 1840
252 Ga0207670_11163672 3300025936 Bacteria 652
253 Ga0207669_10024349 3300025937 Bacteria 3252
254 Ga0207669_11845976 3300025937 Bacteria 516
255 Ga0207704_10008544 3300025938 Bacteria 4902
256 Ga0207704_11179053 3300025938 Bacteria 653
257 Ga0207691_10028308 3300025940 Bacteria 5248
258 Ga0207691_10072623 3300025940 Unclassified 3103
259 Ga0207691_10095156 3300025940 Bacteria 2664
260 Ga0207691_10258733 3300025940 Bacteria 1500
261 Ga0207711_10413206 3300025941 Bacteria 1254
262 Ga0207711_10966391 3300025941 Unclassified 791
263 Ga0207689_10133759 3300025942 Bacteria 2041
264 Ga0207689_10549438 3300025942 Bacteria 970
265 Ga0207689_11081699 3300025942 Unclassified 676
266 Ga0207679_10019188 3300025945 Bacteria 4591
267 Ga0207667_10316566 3300025949 Unclassified 1594
268 Ga0207651_10073670 3300025960 Bacteria 2429
269 Ga0207651_10124926 3300025960 Bacteria 1959
270 Ga0207651_10913214 3300025960 Bacteria 782
271 Ga0207651_11276121 3300025960 Bacteria 660
272 Ga0207712_10585593 3300025961 Unclassified 963
273 Ga0207712_11084901 3300025961 Unclassified 712
274 Ga0207712_11226823 3300025961 Bacteria 669
275 Ga0207668_12071724 3300025972 Unclassified 512
276 Ga0207640_10407653 3300025981 Bacteria 1109
277 Ga0207658_10496681 3300025986 Unclassified 1086
278 Ga0207703_10031106 3300026035 Bacteria 4218
279 Ga0207678_10040716 3300026067 Bacteria 4028
280 Ga0207678_10105298 3300026067 Bacteria 2407
281 Ga0207678_10240048 3300026067 Bacteria 1552
282 Ga0207708_10103383 3300026075 Bacteria 2207
283 Ga0207702_10001005 3300026078 Bacteria 28936
284 Ga0207641_10017637 3300026088 Bacteria 5846
285 Ga0207641_10033923 3300026088 Bacteria 4243
286 Ga0207641_11118678 3300026088 Unclassified 786
287 Ga0207648_10022217 3300026089 Bacteria 5700
288 Ga0207648_10115706 3300026089 Bacteria 2356
289 Ga0207648_10586887 3300026089 Bacteria 1026
290 Ga0207676_10084332 3300026095 Bacteria 2590
291 Ga0207676_10711085 3300026095 Bacteria 974
292 Ga0207676_11470600 3300026095 Unclassified 678
293 Ga0207674_10745751 3300026116 Bacteria 945
294 Ga0207675_100059109 3300026118 Bacteria 3578
295 Ga0207675_100646220 3300026118 Bacteria 1064
296 Ga0207675_102166102 3300026118 Bacteria 572
297 Ga0207683_10083942 3300026121 Bacteria 2831
298 Ga0207683_10751693 3300026121 Unclassified 905
299 Ga0207698_12000842 3300026142 Unclassified 594
300 Ga0207428_10478220 3300027907 Bacteria 906
301 Ga0268266_10010478 3300028379 Bacteria 8100
302 Ga0268266_10121328 3300028379 Bacteria 2326
303 Ga0268266_11955110 3300028379 Unclassified 560
304 Ga0268265_10018615 3300028380 Bacteria 4815
305 Ga0268265_10085063 3300028380 Bacteria 2509
306 Ga0268265_10094073 3300028380 Bacteria 2403
307 Ga0268265_10424175 3300028380 Bacteria 1236
308 Ga0268265_11457772 3300028380 Bacteria 687
309 Ga0307511_10040305 3300030521 Bacteria 3970
310 Ga0316177_1118659 3300030731 Bacteria 3091
311 Ga0265760_10028293 3300031090 Bacteria 1644
312 Ga0265340_10093391 3300031247 Bacteria 1404
313 Ga0265340_10263986 3300031247 Unclassified 766
314 Ga0307513_10019740 3300031456 Bacteria 8011
315 Ga0307509_10000034 3300031507 Bacteria 193380
316 Ga0307509_10130713 3300031507 Bacteria 2467
317 Ga0307509_10408178 3300031507 Bacteria 1063
318 Ga0307408_100551609 3300031548 Bacteria 1017
319 Ga0307413_10129278 3300031824 Bacteria 1726
320 Ga0307409_100005140 3300031995 Bacteria 7474
321 Ga0307409_100292238 3300031995 Unclassified 1512
322 Ga0307409_101216184 3300031995 Unclassified 777
323 Ga0307411_10959430 3300032005 Bacteria 763
324 Ga0307415_100441620 3300032126 Bacteria 1122
325 Ga0307415_100642347 3300032126 Unclassified 950
326 Ga0373939_0544148 3300035114 Unclassified 501
327 Ga0373955_0644804 3300035172 Unclassified 649
328 Ga0373961_0439304 3300035241 Archaea 507
329 Ga0373924_0349791 3300035410 Bacteria 659
330 Ga0373927_0558702 3300035695 Bacteria 756
331 Ga0373937_0240414 3300036401 Unclassified 1706
332 Ga0395899_0000047 3300037312 Bacteria 233482
333 Ga0395900_0000011 3300037418 Bacteria 421926
334 Ga0395898_0000058 3300037466 Bacteria 277701
335 Ga0395901_0057247 3300038443 Bacteria 4054
336 Ga0436365_0405789 3300039437 Bacteria 566
337 Ga0436363_1599567 3300039450 Bacteria 1081
338 Ga0451791_0755794 3300041451 Bacteria 6419
339 Ga0451797_0897525 3300041453 Bacteria 1812
340 Ga0451807_0304169 3300041486 Bacteria 10131
341 Ga0451807_1192782 3300041486 Bacteria 3715
342 Ga0451833_0959168 3300041491 Bacteria 974
343 Ga0451833_1457381 3300041491 Unclassified 665
344 Ga0451837_0089762 3300041494 Bacteria 2734
345 Ga0451839_1232280 3300041496 Unclassified 599
346 Ga0451843_0679747 3300041509 Bacteria 772
347 Ga0451843_1386714 3300041509 Bacteria 733
348 Ga0451853_0573422 3300041512 Bacteria 582
349 Ga0451853_3708608 3300041512 Bacteria 1329
350 Ga0450908_000288 3300042184 Bacteria 9998
351 Ga0450908_001484 3300042184 Bacteria 4550
352 Ga0450916_094300 3300042530 Bacteria 524
353 Ga0466969_0017930 3300044656 Bacteria 3692
354 Ga0466975_0254749 3300044661 Bacteria 1156
355 Ga0466982_0000038 3300044672 Bacteria 41498
356 Ga0466965_0011522 3300044683 Bacteria 4148
357 Ga0466965_0335003 3300044683 Bacteria 826
358 Ga0466966_0002250 3300044684 Bacteria 12569
359 Ga0466966_0100554 3300044684 Bacteria 1788
360 Ga0466961_0000993 3300044693 Bacteria 17503
361 Ga0466961_0008197 3300044693 Bacteria 6656
362 Ga0466961_0029662 3300044693 Bacteria 3514
363 Ga0466961_0356751 3300044693 Bacteria 889
364 Ga0466963_0286877 3300044694 Bacteria 1157
365 Ga0466964_0001057 3300044706 Bacteria 9200
366 Ga0466971_0007459 3300044719 Bacteria 4763
367 Ga0466971_0133184 3300044719 Bacteria 1155
368 Ga0466970_0000388 3300044765 Bacteria 21306
369 Ga0466957_0046459 3300044842 Bacteria 2636
370 Ga0466959_0000336 3300045049 Bacteria 27718
371 Ga0466959_0047656 3300045049 Bacteria 3151
372 Ga0466959_0112187 3300045049 Bacteria 1945
373 Ga0466958_0315038 3300045836 Bacteria 1005
374 Ga0466958_0375159 3300045836 Bacteria 917
375 Ga0466967_0106526 3300045976 Bacteria 2570
376 Ga0495617_240622 3300046452 Unclassified 559
377 Ga0495603_0747470 3300046455 Bacteria 559
378 Ga0495590_0013805 3300046457 Bacteria 2962
379 Ga0495638_0003825 3300046460 Bacteria 11683
380 Ga0495638_0004403 3300046460 Bacteria 10660
381 Ga0495641_0277810 3300046461 Unclassified 754
382 Ga0495585_0593319 3300046492 Unclassified 521
383 Ga0495606_0000093 3300046507 Bacteria 152281
384 Ga0495606_0360481 3300046507 Unclassified 769
385 Ga0495616_0126679 3300046513 Bacteria 1174
386 Ga0495631_0037542 3300046518 Bacteria 2158
387 Ga0495643_0064560 3300046522 Unclassified 1934
388 Ga0495668_0268648 3300046616 Bacteria 934
389 Ga0495634_0755137 3300046642 Unclassified 557
390 Ga0495625_0010426 3300046660 Bacteria 7691
391 Ga0495625_0032187 3300046660 Bacteria 3893
392 Ga0495625_0150788 3300046660 Bacteria 1563
393 Ga0495649_0002890 3300046694 Bacteria 11907
394 Ga0495649_0305889 3300046694 Bacteria 809
395 Ga0495683_0427007 3300047323 Bacteria 547
396 Ga0495687_162582 3300047443 Bacteria 749
397 Ga0495686_0304117 3300047472 Bacteria 879
398 Ga0495626_0229718 3300048091 Bacteria 751
399 Ga0496100_0084148 3300048903 Unclassified 2156
400 Ga0496102_0004065 3300048905 Bacteria 12406
401 Ga0496114_0126477 3300048917 Bacteria 2204
402 Ga0496116_0207665 3300048919 Bacteria 1018
403 Ga0496117_0000573 3300048920 Bacteria 60369
404 Ga0496118_0000170 3300048921 Bacteria 117661
405 Ga0496118_0086554 3300048921 Bacteria 2177
406 Ga0496118_0094768 3300048921 Bacteria 2040
407 Ga0496119_0001086 3300048922 Bacteria 34364
408 Ga0496119_0016829 3300048922 Bacteria 5535
409 Ga0496119_0156455 3300048922 Unclassified 1216
410 Ga0496119_0304172 3300048922 Unclassified 785
411 Ga0496120_0000018 3300048923 Bacteria 263952
412 Ga0496121_0044999 3300048924 Bacteria 3799
413 Ga0496121_0057046 3300048924 Unclassified 3239
414 Ga0496121_0278147 3300048924 Bacteria 1146
415 Ga0496124_0010939 3300048927 Bacteria 9127
416 Ga0496124_0384158 3300048927 Bacteria 981
417 Ga0496125_0042706 3300048928 Bacteria 3857
418 Ga0496125_0053927 3300048928 Unclassified 3291
419 Ga0496126_0061688 3300048929 Bacteria 3367
420 Ga0496126_0126987 3300048929 Bacteria 2207
421 Ga0496126_0155775 3300048929 Bacteria 1955
422 Ga0495678_147344 3300049459 Bacteria 763
423 Ga0501033_0668750 3300049570 Bacteria 708
424 Ga0501037_0201137 3300049573 Archaea 1408
425 Ga0501037_0876844 3300049573 Bacteria 589
426 Ga0501038_0844722 3300049574 Bacteria 678
427 Ga0501039_0371594 3300049575 Bacteria 1123
428 Ga0501039_1279710 3300049575 Unclassified 566
429 Ga0501040_1004530 3300049576 Bacteria 605
430 Ga0501041_0625518 3300049577 Bacteria 688
431 Ga0501042_0055568 3300049578 Bacteria 2826
432 Ga0501043_0875531 3300049579 Bacteria 645
433 Ga0501043_1140734 3300049579 Bacteria 549
434 Ga0501047_0055466 3300049581 Bacteria 3832
435 Ga0501067_0345498 3300049583 Bacteria 829
436 Ga0501068_0003685 3300049584 Bacteria 8289
437 Ga0501068_0190147 3300049584 Unclassified 1300
438 Ga0501069_0368471 3300049585 Bacteria 848
439 Ga0501070_0030392 3300049586 Bacteria 4526
440 Ga0501070_0621839 3300049586 Bacteria 860
441 Ga0501071_0007729 3300049587 Bacteria 7089
442 Ga0501072_0138685 3300049588 Bacteria 1939
443 Ga0501073_0015737 3300049589 Bacteria 5481
444 Ga0501074_0008337 3300049590 Bacteria 7517
445 Ga0501075_0208149 3300049591 Bacteria 1492
446 Ga0501076_0070625 3300049592 Bacteria 2792
447 Ga0501077_0025172 3300049593 Bacteria 3780
448 Ga0501217_255045 3300049661 Bacteria 566
449 Ga0501079_0016663 3300049741 Bacteria 5611
450 Ga0501080_0040189 3300049742 Bacteria 4363
451 Ga0501083_0028494 3300049744 Bacteria 3847
452 Ga0501035_0020907 3300049822 Bacteria 6014
453 Ga0501035_0126959 3300049822 Bacteria 2226
454 Ga0501035_1571368 3300049822 Bacteria 500
455 Ga0501044_0030202 3300049823 Bacteria 5712
456 Ga0501044_0061612 3300049823 Bacteria 3838
457 Ga0501044_1061899 3300049823 Archaea 680
458 nmdc:mga03683_577931_c1 3300050489 Bacteria 549
459 nmdc:mga03n38_235226_c1 3300050490 Bacteria 962
460 nmdc:mga00v17_322431_c1 3300050491 Bacteria 1004
461 nmdc:mga0yw44_955402_c1 3300050492 Unclassified 581
462 nmdc:mga06z11_192353_c1 3300050494 Bacteria 1182
463 nmdc:mga06z11_45177_c1 3300050494 Bacteria 2226
464 nmdc:mga07m45_9620_c1 3300050496 Bacteria 5023
465 nmdc:mga0qj67_575115_c1 3300050509 Bacteria 902
466 nmdc:mga08y16_1810771_c1 3300050511 Bacteria 563
467 nmdc:mga08y16_191220_c1 3300050511 Bacteria 2123
468 nmdc:mga0sz30_323964_c1 3300050516 Bacteria 688
469 Ga0500646_0293098 3300053090 Bacteria 582
470 Ga0500566_0001294 3300053094 Bacteria 14607
471 Ga0500640_000222 3300053095 Bacteria 12336
472 Ga0500555_000833 3300053103 Bacteria 11011
473 Ga0500572_000587 3300053111 Bacteria 12254
474 Ga0500591_008675 3300053115 Bacteria 4753
475 Ga0500608_006391 3300053122 Bacteria 4793
476 Ga0500614_000645 3300053123 Bacteria 8908
477 Ga0500614_304544 3300053123 Bacteria 500
478 Ga0500559_0001717 3300053136 Bacteria 12021
479 Ga0500577_0000208 3300053142 Bacteria 15602
480 Ga0500577_0373555 3300053142 Bacteria 624
481 Ga0500590_208468 3300053148 Unclassified 819
482 Ga0500590_208526 3300053148 Unclassified 819
483 Ga0500603_001194 3300053150 Bacteria 6026
484 Ga0500616_0276633 3300053153 Bacteria 706
485 Ga0500630_000775 3300053159 Bacteria 14701
486 Ga0500638_242506 3300053162 Bacteria 731
487 Ga0500639_000008 3300053163 Bacteria 143238
488 Ga0500637_0002973 3300053178 Bacteria 7683
489 Ga0500637_0505391 3300053178 Unclassified 598
490 Ga0500637_0539826 3300053178 Bacteria 567
491 Ga0500596_000337 3300053735 Bacteria 8449
492 Ga0500601_025556 3300053737 Bacteria 689
493 Ga0500601_031864 3300053737 Bacteria 627
494 Ga0501084_0041767 3300054114 Bacteria 3836
495 Ga0501082_0251328 3300060353 Bacteria 1538
496 Ga0466962_0014677 3300061719 Bacteria 3775
497 Ga0466962_0021455 3300061719 Bacteria 3101
498 Ga0530510_1078335 3300061734 Unclassified 615
499 2687581960 2687453130 Bacteria 4227172
500 2919407099 2919404418 Bacteria 4232372
501 Ga0207646_10881040
502 JGI25156J39149_1011123
503 JGI25162J39368_1002426
504 JGI25162J39368_1009812
505 JGI25154J39366_1002856
506 JGI25157J39369_1006704
507 JGI25164J39214_1000154
508 JGI25152J39213_1026070
509 JGI25165J46597_1000212
510 rootL2_10056726
511 rootL2_10056727
512 Ga0055527_1000190
513 Ga0055527_1000338
514 Ga0055535_1000397
515 Ga0055535_1001139
516 Ga0055535_1002251
517 Ga0055542_1000043
518 Ga0055542_1000141
519 Ga0055542_1000640
520 Ga0055542_1000878
521 Ga0055529_1000164
522 Ga0055529_1000380
523 Ga0055529_1001750
524 JGI25405J52794_10111194
525 Ga0065165_1000399
526 Ga0070676_10045526
527 Ga0070676_10238595
528 Ga0070690_100018381
529 Ga0070670_100093737
530 Ga0070670_100268601
531 Ga0070677_10007039
532 Ga0070677_10070800
533 Ga0068869_100102068
534 Ga0068869_100114759
535 Ga0068869_100571486
536 Ga0070682_100051076
537 Ga0070682_100535125
538 Ga0068868_100554832
539 Ga0068868_100777269
540 Ga0070660_100893072
541 Ga0070689_100085594
542 Ga0070689_100087122
543 Ga0070689_101372535
544 Ga0070668_100109680
545 Ga0070669_100034186
546 Ga0070669_100869622
547 Ga0070669_100962995
548 Ga0070675_100005733
549 Ga0070675_100311679
550 Ga0070675_101094153
551 Ga0070671_100446011
552 Ga0070674_100071614
553 Ga0070674_100152256
554 Ga0070674_100339235
555 Ga0070674_101975827
556 Ga0070673_100082844
557 Ga0070688_100347573
558 Ga0070667_100158004
559 Ga0070667_102086541
560 Ga0070701_10899854
561 Ga0070711_101204600
562 Ga0070705_100129763
563 Ga0070694_100074077
564 Ga0070663_100209942
565 Ga0070678_100055977
566 Ga0070678_100444681
567 Ga0070662_100280562
568 Ga0068867_100023833
569 Ga0068867_100085418
570 Ga0068867_100613694
571 Ga0068853_101510293
572 Ga0070672_100024873
573 Ga0070672_100031800
574 Ga0070672_100128623
575 Ga0070672_100607723
576 Ga0070686_100029883
577 Ga0070686_101832692
578 Ga0070665_100002609
579 Ga0068855_100291621
580 Ga0070664_100059307
581 Ga0068856_100014428
582 Ga0070702_100013478
583 Ga0070702_100955413
584 Ga0068852_102667601
585 Ga0068859_100058587
586 Ga0068859_100202116
587 Ga0068859_100493463
588 Ga0068859_101544825
589 Ga0068864_100122582
590 Ga0068864_101130862
591 Ga0068861_100055755
592 Ga0068861_101047393
593 Ga0068861_101202780
594 Ga0068851_10288050
595 Ga0068870_10282583
596 Ga0068870_10432245
597 Ga0068863_100073500
598 Ga0068863_100709782
599 Ga0068858_100010563
600 Ga0068860_100534844
601 Ga0068862_100010197
602 Ga0068862_100026234
603 Ga0068862_100079534
604 Ga0068862_100161939
605 Ga0068862_102078484
606 Ga0081540_1014229
607 Ga0075365_10004402
608 Ga0075368_10180511
609 Ga0075363_100318905
610 Ga0075364_10141253
611 Ga0075364_10362698
612 Ga0070715_10888174
613 Ga0070716_100328468
614 Ga0075362_10096583
615 Ga0075367_10142938
616 Ga0097621_100022364
617 Ga0097621_100372828
618 Ga0075370_10138954
619 Ga0068871_100003635
620 Ga0068871_100023027
621 Ga0068871_100031947
622 Ga0068871_100133452
623 Ga0068871_100208909
624 Ga0068871_100768045
625 Ga0068871_101579314
626 Ga0075430_101202648
627 Ga0068865_100504597
628 Ga0068865_100565208
629 Ga0068865_100992176
630 Ga0097620_100058588
631 Ga0097620_100202112
632 Ga0097620_100493476
633 Ga0097620_101544612
634 Ga0099795_10100351
635 Ga0105240_10018394
636 Ga0105240_10023512
637 Ga0105240_10061047
638 Ga0111539_10028681
639 Ga0111539_11945904
640 Ga0111539_12641472
641 Ga0105247_10028577
642 Ga0105243_10313047
643 Ga0105241_10090111
644 Ga0105248_10317323
645 Ga0105248_10560569
646 Ga0105248_12492381
647 Ga0105237_10161141
648 Ga0105237_10991223
649 Ga0105237_11532278
650 Ga0105238_10011012
651 Ga0105238_10127361
652 Ga0105238_10151283
653 Ga0105238_10726118
654 Ga0105249_10110968
655 Ga0105249_10154634
656 Ga0105239_10028365
657 Ga0105239_11344426
658 Ga0105239_11399264
659 Ga0157373_10112561
660 Ga0157370_11021135
661 Ga0157369_11837281
662 Ga0157374_11373133
663 Ga0163162_10270915
664 Ga0163162_12603694
665 Ga0157375_10085770
666 Ga0157375_10466403
667 Ga0163163_10045218
668 Ga0163163_11272225
669 Ga0163163_11774441
670 Ga0163163_12594626
671 Ga0157380_10006415
672 Ga0157380_10080380
673 Ga0157380_10088189
674 Ga0157380_10229870
675 Ga0157380_10514263
676 Ga0157380_12986404
677 Ga0182008_10153544
678 Ga0157377_10568211
679 Ga0157379_10051353
680 Ga0157379_10058551
681 Ga0157379_11241355
682 Ga0157376_10011326
683 Ga0157376_10052626
684 Ga0157376_10383731
685 Ga0157376_11246095
686 Ga0183369_1003
687 Ga0183360_10195
688 Ga0163161_10044724
689 Ga0163161_10641067
690 Ga0163161_10835896
691 Ga0163161_11047326
692 Ga0163161_12011831
693 Ga0209672_100005
694 Ga0209672_100009
695 Ga0209672_100176
696 Ga0209672_100177
697 Ga0209672_102275
698 Ga0207427_100062
699 Ga0209437_100258
700 Ga0209437_101225
701 Ga0209258_100006
702 Ga0209258_100011
703 Ga0209258_100088
704 Ga0209258_100265
705 Ga0209646_1007280
706 Ga0209026_1000519
707 Ga0209148_1000012
708 Ga0209148_1000013
709 Ga0209148_1000024
710 Ga0209148_1000065
711 Ga0209759_1001333
712 Ga0209129_1000549
713 Ga0209233_1000023
714 Ga0209455_1000008
715 Ga0209455_1000012
716 Ga0209455_1000025
717 Ga0209455_1007824
718 Ga0209564_1001290
719 Ga0209758_1021743
720 Ga0209256_1003089
721 Ga0207426_1022091
722 Ga0207682_10010980
723 Ga0207682_10179854
724 Ga0207692_10659922
725 Ga0207642_10309962
726 Ga0207642_10848358
727 Ga0207645_10141843
728 Ga0207645_10255552
729 Ga0207643_10248378
730 Ga0207654_10694604
731 Ga0207695_10038300
732 Ga0207695_10041340
733 Ga0207695_10119265
734 Ga0207695_11388610
735 Ga0207671_10255432
736 Ga0207662_10289227
737 Ga0207657_11169675
738 Ga0207681_10117244
739 Ga0207681_10599332
740 Ga0207694_10133986
741 Ga0207694_10150228
742 Ga0207694_10509964
743 Ga0207659_10014256
744 Ga0207659_10179365
745 Ga0207659_10336287
746 Ga0207659_10611425
747 Ga0207659_11441282
748 Ga0207686_10155387
749 Ga0207686_10344587
750 Ga0207709_10103761
751 Ga0207670_10130490
752 Ga0207670_11163672
753 Ga0207669_10024349
754 Ga0207669_11845976
755 Ga0207704_10008544
756 Ga0207704_11179053
757 Ga0207691_10028308
758 Ga0207691_10072623
759 Ga0207691_10095156
760 Ga0207691_10258733
761 Ga0207711_10413206
762 Ga0207711_10966391
763 Ga0207689_10133759
764 Ga0207689_10549438
765 Ga0207689_11081699
766 Ga0207679_10019188
767 Ga0207667_10316566
768 Ga0207651_10073670
769 Ga0207651_10124926
770 Ga0207651_10913214
771 Ga0207651_11276121
772 Ga0207712_10585593
773 Ga0207712_11084901
774 Ga0207712_11226823
775 Ga0207668_12071724
776 Ga0207640_10407653
777 Ga0207658_10496681
778 Ga0207703_10031106
779 Ga0207678_10040716
780 Ga0207678_10105298
781 Ga0207678_10240048
782 Ga0207708_10103383
783 Ga0207702_10001005
784 Ga0207641_10017637
785 Ga0207641_10033923
786 Ga0207641_11118678
787 Ga0207648_10022217
788 Ga0207648_10115706
789 Ga0207648_10586887
790 Ga0207676_10084332
791 Ga0207676_10711085
792 Ga0207676_11470600
793 Ga0207674_10745751
794 Ga0207675_100059109
795 Ga0207675_100646220
796 Ga0207675_102166102
797 Ga0207683_10083942
798 Ga0207683_10751693
799 Ga0207698_12000842
800 Ga0207428_10478220
801 Ga0268266_10010478
802 Ga0268266_10121328
803 Ga0268266_11955110
804 Ga0268265_10018615
805 Ga0268265_10085063
806 Ga0268265_10094073
807 Ga0268265_10424175
808 Ga0268265_11457772
809 Ga0307511_10040305
810 Ga0316177_1118659
811 Ga0265760_10028293
812 Ga0265340_10093391
813 Ga0265340_10263986
814 Ga0307513_10019740
815 Ga0307509_10000034
816 Ga0307509_10130713
817 Ga0307509_10408178
818 Ga0307408_100551609
819 Ga0307413_10129278
820 Ga0307409_100005140
821 Ga0307409_100292238
822 Ga0307409_101216184
823 Ga0307411_10959430
824 Ga0307415_100441620
825 Ga0307415_100642347
826 Ga0373939_0544148
827 Ga0373955_0644804
828 Ga0373961_0439304
829 Ga0373924_0349791
830 Ga0373927_0558702
831 Ga0373937_0240414
832 Ga0395899_0000047
833 Ga0395900_0000011
834 Ga0395898_0000058
835 Ga0395901_0057247
836 Ga0436365_0405789
837 Ga0436363_1599567
838 Ga0451791_0755794
839 Ga0451797_0897525
840 Ga0451807_0304169
841 Ga0451807_1192782
842 Ga0451833_0959168
843 Ga0451833_1457381
844 Ga0451837_0089762
845 Ga0451839_1232280
846 Ga0451843_0679747
847 Ga0451843_1386714
848 Ga0451853_0573422
849 Ga0451853_3708608
850 Ga0450908_000288
851 Ga0450908_001484
852 Ga0450916_094300
853 Ga0466969_0017930
854 Ga0466975_0254749
855 Ga0466982_0000038
856 Ga0466965_0011522
857 Ga0466965_0335003
858 Ga0466966_0002250
859 Ga0466966_0100554
860 Ga0466961_0000993
861 Ga0466961_0008197
862 Ga0466961_0029662
863 Ga0466961_0356751
864 Ga0466963_0286877
865 Ga0466964_0001057
866 Ga0466971_0007459
867 Ga0466971_0133184
868 Ga0466970_0000388
869 Ga0466957_0046459
870 Ga0466959_0000336
871 Ga0466959_0047656
872 Ga0466959_0112187
873 Ga0466958_0315038
874 Ga0466958_0375159
875 Ga0466967_0106526
876 Ga0495617_240622
877 Ga0495603_0747470
878 Ga0495590_0013805
879 Ga0495638_0003825
880 Ga0495638_0004403
881 Ga0495641_0277810
882 Ga0495585_0593319
883 Ga0495606_0000093
884 Ga0495606_0360481
885 Ga0495616_0126679
886 Ga0495631_0037542
887 Ga0495643_0064560
888 Ga0495668_0268648
889 Ga0495634_0755137
890 Ga0495625_0010426
891 Ga0495625_0032187
892 Ga0495625_0150788
893 Ga0495649_0002890
894 Ga0495649_0305889
895 Ga0495683_0427007
896 Ga0495687_162582
897 Ga0495686_0304117
898 Ga0495626_0229718
899 Ga0496100_0084148
900 Ga0496102_0004065
901 Ga0496114_0126477
902 Ga0496116_0207665
903 Ga0496117_0000573
904 Ga0496118_0000170
905 Ga0496118_0086554
906 Ga0496118_0094768
907 Ga0496119_0001086
908 Ga0496119_0016829
909 Ga0496119_0156455
910 Ga0496119_0304172
911 Ga0496120_0000018
912 Ga0496121_0044999
913 Ga0496121_0057046
914 Ga0496121_0278147
915 Ga0496124_0010939
916 Ga0496124_0384158
917 Ga0496125_0042706
918 Ga0496125_0053927
919 Ga0496126_0061688
920 Ga0496126_0126987
921 Ga0496126_0155775
922 Ga0495678_147344
923 Ga0501033_0668750
924 Ga0501037_0201137
925 Ga0501037_0876844
926 Ga0501038_0844722
927 Ga0501039_0371594
928 Ga0501039_1279710
929 Ga0501040_1004530
930 Ga0501041_0625518
931 Ga0501042_0055568
932 Ga0501043_0875531
933 Ga0501043_1140734
934 Ga0501047_0055466
935 Ga0501067_0345498
936 Ga0501068_0003685
937 Ga0501068_0190147
938 Ga0501069_0368471
939 Ga0501070_0030392
940 Ga0501070_0621839
941 Ga0501071_0007729
942 Ga0501072_0138685
943 Ga0501073_0015737
944 Ga0501074_0008337
945 Ga0501075_0208149
946 Ga0501076_0070625
947 Ga0501077_0025172
948 Ga0501217_255045
949 Ga0501079_0016663
950 Ga0501080_0040189
951 Ga0501083_0028494
952 Ga0501035_0020907
953 Ga0501035_0126959
954 Ga0501035_1571368
955 Ga0501044_0030202
956 Ga0501044_0061612
957 Ga0501044_1061899
958 nmdc:mga03683_577931_c1
959 nmdc:mga03n38_235226_c1
960 nmdc:mga00v17_322431_c1
961 nmdc:mga0yw44_955402_c1
962 nmdc:mga06z11_192353_c1
963 nmdc:mga06z11_45177_c1
964 nmdc:mga07m45_9620_c1
965 nmdc:mga0qj67_575115_c1
966 nmdc:mga08y16_1810771_c1
967 nmdc:mga08y16_191220_c1
968 nmdc:mga0sz30_323964_c1
969 Ga0500646_0293098
970 Ga0500566_0001294
971 Ga0500640_000222
972 Ga0500555_000833
973 Ga0500572_000587
974 Ga0500591_008675
975 Ga0500608_006391
976 Ga0500614_000645
977 Ga0500614_304544
978 Ga0500559_0001717
979 Ga0500577_0000208
980 Ga0500577_0373555
981 Ga0500590_208468
982 Ga0500590_208526
983 Ga0500603_001194
984 Ga0500616_0276633
985 Ga0500630_000775
986 Ga0500638_242506
987 Ga0500639_000008
988 Ga0500637_0002973
989 Ga0500637_0505391
990 Ga0500637_0539826
991 Ga0500596_000337
992 Ga0500601_025556
993 Ga0500601_031864
994 Ga0501084_0041767
995 Ga0501082_0251328
996 Ga0466962_0014677
997 Ga0466962_0021455
998 Ga0530510_1078335
999 2687581960
1000 2919407099

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

5

107

0.98

PF01978

TrmB

Sugar-specific transcriptional regulator TrmB

2

70

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9253 7 68
3bz6-assembly1.cif.gz_A crystal structure of a conserved protein of unknown function from pseudomonas syringae pv. tomato str. dc3000 0.9189 5 68
2l02-assembly1.cif.gz_B solution nmr structure of protein bt2368 from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr375 0.9032 9 66
3cuq-assembly1.cif.gz_B integrated structural and functional model of the human escrt-ii complex 0.8973 7 66
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8903 9 67
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.969 5 65 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9579 9 66 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9442 7 66 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9383 5 65 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9331 7 68 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3N5SU18-F1-model_v4 deleted 0.9753 5 68
AF-A0A6L8HA91-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9702 5 69 GO:0003677
GO:0045892
AF-A0A7C2ASF8-F1-model_v4 Orc1-like AAA ATPase domain-containing protein 0.9684 5 68
AF-A0A538NYA2-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9562 3 71 GO:0003677
GO:0045892
AF-A0A359M5J0-F1-model_v4 CopY family transcriptional regulator 0.9521 4 69 GO:0003677
GO:0045892

Map