F455476

General Info

Members Datasets Scaffolds Average Seq Length
500 214 1000 250

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10124227|Ga0065712_101242271
Length 270
Sequence MKRIPRFLQNDKIKIMLKLSKYVLYDIVRSKVILAYTAFLFLVSFSLFNMEENSSKAILSLLNIIXXXVPLISMIFTTIHYYNSYEFIELMLSQPMSRRKILLSEYGGVALSLLSSFLIGVGIPVLIYSPDSVGFSLLFTGICLTLVFTSLAFLTSVKARDKARGIGFALLLWFYFALIYDGLILLILFNFSDYPLEKATLVLSALNPIDLGRISIMLKMDVSALMGYTGALYKDFFGSGSGILFTVGIMLLWIILPLWWALRIFKKKDL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
160 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
186 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
187 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
188 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
189 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
190 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
191 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
192 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
193 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
194 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
195 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
196 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
199 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
204 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
205 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
206 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.4
Nodule 0
Rhizoplane 0.4
Rhizosphere 96.8
Stem 0
Stem Tuber 0
Unclassified 20.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10124227 3300005290 Bacteria 1614
2 MRS1b_contig_3998254 2162886011 Bacteria 999
3 ARcpr5yngRDRAFT_c007529 3300000043 Unclassified 956
4 JGI24751J29686_10000769 3300002459 Bacteria 7560
5 rootH2_10166589 3300003320 Bacteria 1264
6 rootL2_10173495 3300003322 Bacteria 1613
7 rootL2_10321286 3300003322 Bacteria 5806
8 rootH1_10006585 3300003323 Bacteria 90181
9 rootH1_10070677 3300003323 Bacteria 42951
10 rootH1_10144212 3300003323 Bacteria 3272
11 rootH1_10272780 3300003323 Bacteria 5287
12 Ga0065704_10102599 3300005289 Bacteria 2199
13 Ga0065704_10167454 3300005289 Bacteria 1313
14 Ga0065712_10003355 3300005290 Bacteria 5980
15 Ga0065712_10072563 3300005290 Bacteria 4703
16 Ga0065712_10129647 3300005290 Bacteria 1545
17 Ga0065712_10174672 3300005290 Bacteria 1211
18 Ga0065712_10243661 3300005290 Bacteria 977
19 Ga0065707_10329478 3300005295 Bacteria 944
20 Ga0070658_10101626 3300005327 Unclassified 2377
21 Ga0070676_10001833 3300005328 Bacteria 10818
22 Ga0070676_10002307 3300005328 Bacteria 9759
23 Ga0070676_10041782 3300005328 Bacteria 2660
24 Ga0070683_100000711 3300005329 Bacteria 24242
25 Ga0070683_100044477 3300005329 Bacteria 4094
26 Ga0070683_100102379 3300005329 Unclassified 2697
27 Ga0070690_100011905 3300005330 Bacteria 5106
28 Ga0070690_100417525 3300005330 Bacteria 988
29 Ga0070670_100016575 3300005331 Bacteria 6325
30 Ga0070670_100022145 3300005331 Bacteria 5469
31 Ga0070670_100024652 3300005331 Bacteria 5173
32 Ga0070670_100058238 3300005331 Bacteria 3317
33 Ga0070670_100111598 3300005331 Unclassified 2356
34 Ga0070670_100125835 3300005331 Bacteria 2212
35 Ga0070670_100138243 3300005331 Bacteria 2106
36 Ga0070677_10042395 3300005333 Bacteria 1802
37 Ga0068869_100014735 3300005334 Bacteria 5228
38 Ga0068869_100056526 3300005334 Bacteria 2862
39 Ga0068869_100153273 3300005334 Bacteria 1789
40 Ga0068869_100213890 3300005334 Bacteria 1525
41 Ga0068869_100224987 3300005334 Unclassified 1489
42 Ga0070666_10062999 3300005335 Unclassified 2512
43 Ga0070666_10136648 3300005335 Bacteria 1706
44 Ga0070682_100450692 3300005337 Bacteria 985
45 Ga0068868_100001698 3300005338 Bacteria 15068
46 Ga0068868_100002315 3300005338 Bacteria 13180
47 Ga0068868_100131793 3300005338 Unclassified 2046
48 Ga0068868_100547877 3300005338 Bacteria 1019
49 Ga0070660_100045232 3300005339 Unclassified 3369
50 Ga0070660_100092020 3300005339 Bacteria 2393
51 Ga0070689_100015073 3300005340 Bacteria 5629
52 Ga0070689_100093871 3300005340 Bacteria 2368
53 Ga0070689_100119752 3300005340 Bacteria 2101
54 Ga0070689_100271996 3300005340 Bacteria 1403
55 Ga0070687_100005497 3300005343 Bacteria 5134
56 Ga0070661_100002061 3300005344 Bacteria 13835
57 Ga0070661_100008998 3300005344 Bacteria 6909
58 Ga0070661_100013116 3300005344 Bacteria 5815
59 Ga0070661_100030788 3300005344 Bacteria 3878
60 Ga0070668_100004161 3300005347 Bacteria 10722
61 Ga0070668_100013018 3300005347 Bacteria 6194
62 Ga0070669_100002828 3300005353 Bacteria 12531
63 Ga0070669_100022136 3300005353 Bacteria 4546
64 Ga0070669_100024911 3300005353 Bacteria 4294
65 Ga0070675_100242703 3300005354 Bacteria 1574
66 Ga0070671_100044813 3300005355 Unclassified 3675
67 Ga0070671_100146517 3300005355 Bacteria 1993
68 Ga0070671_100166387 3300005355 Bacteria 1864
69 Ga0070674_100001387 3300005356 Bacteria 12805
70 Ga0070674_100010701 3300005356 Bacteria 5559
71 Ga0070673_100036303 3300005364 Bacteria 3744
72 Ga0070673_100053376 3300005364 Bacteria 3174
73 Ga0070673_100108231 3300005364 Unclassified 2301
74 Ga0070673_100171379 3300005364 Unclassified 1853
75 Ga0070673_100334544 3300005364 Bacteria 1340
76 Ga0070688_100000569 3300005365 Bacteria 18642
77 Ga0070688_100122762 3300005365 Unclassified 1742
78 Ga0070659_100003984 3300005366 Bacteria 10513
79 Ga0070659_100016093 3300005366 Bacteria 5612
80 Ga0070659_100519906 3300005366 Bacteria 1016
81 Ga0070667_100084527 3300005367 Unclassified 2720
82 Ga0070667_100282745 3300005367 Unclassified 1490
83 Ga0070701_10129399 3300005438 Bacteria 1433
84 Ga0070700_100365726 3300005441 Bacteria 1074
85 Ga0070663_100109727 3300005455 Bacteria 2072
86 Ga0070663_100595425 3300005455 Bacteria 929
87 Ga0070678_100030300 3300005456 Unclassified 3718
88 Ga0070678_100060324 3300005456 Bacteria 2792
89 Ga0070678_100288064 3300005456 Bacteria 1391
90 Ga0070678_100689717 3300005456 Bacteria 919
91 Ga0070662_100068121 3300005457 Unclassified 2616
92 Ga0070662_100094818 3300005457 Bacteria 2248
93 Ga0070662_100099538 3300005457 Unclassified 2198
94 Ga0068867_100020757 3300005459 Unclassified 4683
95 Ga0068867_100042288 3300005459 Bacteria 3333
96 Ga0068867_100086925 3300005459 Unclassified 2366
97 Ga0070685_10030964 3300005466 Bacteria 2985
98 Ga0070685_10097673 3300005466 Bacteria 1788
99 Ga0070685_10152507 3300005466 Bacteria 1465
100 Ga0070707_100715307 3300005468 Unclassified 964
101 Ga0070698_100001058 3300005471 Bacteria 30280
102 Ga0070698_100002424 3300005471 Bacteria 20548
103 Ga0070698_100196358 3300005471 Bacteria 1954
104 Ga0070698_100203208 3300005471 Bacteria 1917
105 Ga0070684_100003482 3300005535 Bacteria 11815
106 Ga0068853_100032708 3300005539 Bacteria 4408
107 Ga0068853_100092145 3300005539 Unclassified 2665
108 Ga0070672_100029195 3300005543 Bacteria 4134
109 Ga0070672_100055997 3300005543 Bacteria 3091
110 Ga0070672_100065172 3300005543 Bacteria 2881
111 Ga0070672_100140576 3300005543 Bacteria 1991
112 Ga0070672_100317337 3300005543 Unclassified 1324
113 Ga0070686_100109463 3300005544 Unclassified 1880
114 Ga0070665_100251240 3300005548 Bacteria 1769
115 Ga0070665_100276540 3300005548 Unclassified 1681
116 Ga0070665_100348838 3300005548 Bacteria 1485
117 Ga0070665_100378879 3300005548 Bacteria 1422
118 Ga0068855_100125854 3300005563 Bacteria 2930
119 Ga0068855_100848029 3300005563 Bacteria 968
120 Ga0070664_100003269 3300005564 Bacteria 13099
121 Ga0070664_100013920 3300005564 Bacteria 6557
122 Ga0070664_100024816 3300005564 Bacteria 4964
123 Ga0070664_100479543 3300005564 Bacteria 1144
124 Ga0068857_100001350 3300005577 Bacteria 19312
125 Ga0068857_100006950 3300005577 Bacteria 9739
126 Ga0068857_100048588 3300005577 Bacteria 3766
127 Ga0068857_100372058 3300005577 Bacteria 1326
128 Ga0068857_100889782 3300005577 Bacteria 853
129 Ga0068854_100046263 3300005578 Bacteria 3098
130 Ga0070702_100061141 3300005615 Unclassified 2192
131 Ga0068852_100000248 3300005616 Bacteria 36699
132 Ga0068852_100201377 3300005616 Bacteria 1884
133 Ga0068852_100234026 3300005616 Unclassified 1752
134 Ga0068852_100392251 3300005616 Bacteria 1364
135 Ga0068852_100448851 3300005616 Bacteria 1276
136 Ga0068859_100009642 3300005617 Bacteria 9748
137 Ga0068859_100025538 3300005617 Bacteria 5926
138 Ga0068859_100029726 3300005617 Bacteria 5482
139 Ga0068859_100030511 3300005617 Bacteria 5410
140 Ga0068859_100202634 3300005617 Bacteria 2069
141 Ga0068859_100325291 3300005617 Bacteria 1631
142 Ga0068859_100422293 3300005617 Bacteria 1429
143 Ga0068859_100584613 3300005617 Bacteria 1210
144 Ga0068859_100839019 3300005617 Unclassified 1005
145 Ga0068864_100006031 3300005618 Bacteria 9949
146 Ga0068864_100014333 3300005618 Bacteria 6585
147 Ga0068864_100014877 3300005618 Bacteria 6465
148 Ga0068864_100135031 3300005618 Bacteria 2220
149 Ga0068864_100638744 3300005618 Bacteria 1036
150 Ga0068866_10097360 3300005718 Unclassified 1616
151 Ga0068861_100037680 3300005719 Bacteria 3595
152 Ga0068861_100800128 3300005719 Bacteria 885
153 Ga0068851_10081603 3300005834 Unclassified 1690
154 Ga0068870_10006818 3300005840 Bacteria 5064
155 Ga0068870_10269488 3300005840 Unclassified 1063
156 Ga0068863_100027808 3300005841 Bacteria 5398
157 Ga0068863_100219979 3300005841 Bacteria 1829
158 Ga0068863_100293969 3300005841 Unclassified 1575
159 Ga0068863_100339941 3300005841 Bacteria 1460
160 Ga0068863_100434388 3300005841 Unclassified 1287
161 Ga0068858_100065209 3300005842 Unclassified 3370
162 Ga0068858_100083306 3300005842 Bacteria 2974
163 Ga0068858_100879468 3300005842 Bacteria 876
164 Ga0068860_100011752 3300005843 Bacteria 8628
165 Ga0068860_100043372 3300005843 Bacteria 4292
166 Ga0068860_100572888 3300005843 Bacteria 1133
167 Ga0068862_100004673 3300005844 Bacteria 11529
168 Ga0068862_100254741 3300005844 Bacteria 1600
169 Ga0081539_10119354 3300005985 Bacteria 1312
170 Ga0075432_10024002 3300006058 Bacteria 2089
171 Ga0075366_10004507 3300006195 Bacteria 7475
172 Ga0075366_10097909 3300006195 Bacteria 1759
173 Ga0097621_100004351 3300006237 Bacteria 9847
174 Ga0097621_100155337 3300006237 Bacteria 1964
175 Ga0068871_100016670 3300006358 Bacteria 5542
176 Ga0068871_100038033 3300006358 Bacteria 3839
177 Ga0068871_100064356 3300006358 Bacteria 3003
178 Ga0075428_100019977 3300006844 Bacteria 7418
179 Ga0075428_100062423 3300006844 Bacteria 4079
180 Ga0075428_100158137 3300006844 Bacteria 2460
181 Ga0075430_100193417 3300006846 Unclassified 1690
182 Ga0075431_100043970 3300006847 Unclassified 4607
183 Ga0075429_100039587 3300006880 Bacteria 4102
184 Ga0075429_100106115 3300006880 Bacteria 2454
185 Ga0068865_100224555 3300006881 Unclassified 1470
186 Ga0097620_100009641 3300006931 Bacteria 9748
187 Ga0097620_100025538 3300006931 Bacteria 5926
188 Ga0097620_100029725 3300006931 Bacteria 5482
189 Ga0097620_100030511 3300006931 Bacteria 5410
190 Ga0097620_100030906 3300006931 Bacteria 5374
191 Ga0097620_100202661 3300006931 Bacteria 2069
192 Ga0097620_100325287 3300006931 Bacteria 1631
193 Ga0097620_100422272 3300006931 Bacteria 1429
194 Ga0097620_100584559 3300006931 Bacteria 1210
195 Ga0097620_100839004 3300006931 Unclassified 1005
196 Ga0111539_10021793 3300009094 Bacteria 7877
197 Ga0111539_10035262 3300009094 Bacteria 6058
198 Ga0111539_10062147 3300009094 Unclassified 4422
199 Ga0111539_10088444 3300009094 Bacteria 3640
200 Ga0111539_10168903 3300009094 Unclassified 2556
201 Ga0111539_10237658 3300009094 Bacteria 2121
202 Ga0111539_10609146 3300009094 Unclassified 1272
203 Ga0111539_10816775 3300009094 Bacteria 1085
204 Ga0105247_10076687 3300009101 Bacteria 2099
205 Ga0105241_10128628 3300009174 Unclassified 2048
206 Ga0105241_10160820 3300009174 Unclassified 1846
207 Ga0105241_10176364 3300009174 Bacteria 1769
208 Ga0105242_10005285 3300009176 Bacteria 9969
209 Ga0105242_10005322 3300009176 Bacteria 9944
210 Ga0105242_10013638 3300009176 Bacteria 6288
211 Ga0105242_10141625 3300009176 Bacteria 2087
212 Ga0105242_10301271 3300009176 Bacteria 1463
213 Ga0105249_10002009 3300009553 Bacteria 17656
214 Ga0105249_10011926 3300009553 Bacteria 7644
215 Ga0105249_10019596 3300009553 Bacteria 6037
216 Ga0105249_10466267 3300009553 Bacteria 1304
217 Ga0105249_10638094 3300009553 Bacteria 1122
218 Ga0105239_10711564 3300010375 Bacteria 1149
219 Ga0105246_10005914 3300011119 Bacteria 7463
220 Ga0105246_10040832 3300011119 Unclassified 3134
221 Ga0157373_10052552 3300013100 Bacteria 2899
222 Ga0157373_10115795 3300013100 Unclassified 1884
223 Ga0157371_10018392 3300013102 Bacteria 5168
224 Ga0157371_10190095 3300013102 Bacteria 1470
225 Ga0157370_10308278 3300013104 Bacteria 1461
226 Ga0157374_10002504 3300013296 Bacteria 15509
227 Ga0157374_10094378 3300013296 Unclassified 2859
228 Ga0157374_10194969 3300013296 Bacteria 1982
229 Ga0157374_10233836 3300013296 Bacteria 1806
230 Ga0157374_10542746 3300013296 Unclassified 1170
231 Ga0157378_10005296 3300013297 Bacteria 11331
232 Ga0157378_10039137 3300013297 Unclassified 4205
233 Ga0157378_10053268 3300013297 Bacteria 3603
234 Ga0163162_10016082 3300013306 Bacteria 7314
235 Ga0163162_10061887 3300013306 Bacteria 3782
236 Ga0163162_10079768 3300013306 Bacteria 3339
237 Ga0163162_10287296 3300013306 Bacteria 1777
238 Ga0163162_10362466 3300013306 Unclassified 1582
239 Ga0157372_10134513 3300013307 Bacteria 2846
240 Ga0157372_10162874 3300013307 Bacteria 2578
241 Ga0157372_10182832 3300013307 Bacteria 2427
242 Ga0157372_10268565 3300013307 Bacteria 1982
243 Ga0157372_10311147 3300013307 Bacteria 1833
244 Ga0157372_10426871 3300013307 Bacteria 1545
245 Ga0157372_10427773 3300013307 Bacteria 1543
246 Ga0157372_10471303 3300013307 Bacteria 1464
247 Ga0157372_10484937 3300013307 Bacteria 1441
248 Ga0157372_11033375 3300013307 Bacteria 951
249 Ga0157372_11279508 3300013307 Bacteria 847
250 Ga0157375_10006892 3300013308 Bacteria 9913
251 Ga0157375_10007682 3300013308 Bacteria 9433
252 Ga0157375_10010389 3300013308 Bacteria 8197
253 Ga0157375_10014416 3300013308 Bacteria 7051
254 Ga0157375_10024831 3300013308 Bacteria 5554
255 Ga0157375_10187086 3300013308 Bacteria 2224
256 Ga0163163_10002145 3300014325 Bacteria 16670
257 Ga0163163_10078090 3300014325 Bacteria 3307
258 Ga0163163_10264101 3300014325 Bacteria 1772
259 Ga0163163_10377622 3300014325 Unclassified 1475
260 Ga0157380_10003900 3300014326 Bacteria 10283
261 Ga0157380_10006439 3300014326 Bacteria 8268
262 Ga0157380_10020167 3300014326 Bacteria 4981
263 Ga0157380_10154876 3300014326 Bacteria 1985
264 Ga0157380_10154891 3300014326 Bacteria 1985
265 Ga0157380_10290623 3300014326 Bacteria 1501
266 Ga0157380_10458017 3300014326 Bacteria 1227
267 Ga0157380_11132408 3300014326 Bacteria 823
268 Ga0157377_10006433 3300014745 Bacteria 5606
269 Ga0157377_10275816 3300014745 Bacteria 1100
270 Ga0157379_10123775 3300014968 Bacteria 2327
271 Ga0157379_10247063 3300014968 Unclassified 1619
272 Ga0157376_10048513 3300014969 Unclassified 3512
273 Ga0157376_10088440 3300014969 Bacteria 2676
274 Ga0157376_10269792 3300014969 Bacteria 1598
275 Ga0157376_10331302 3300014969 Unclassified 1451
276 Ga0163161_10104449 3300017792 Unclassified 2112
277 Ga0163161_10580305 3300017792 Bacteria 922
278 Ga0209050_1042148 3300025298 Unclassified 1249
279 Ga0207697_10016103 3300025315 Bacteria 3083
280 Ga0207656_10078546 3300025321 Bacteria 1479
281 Ga0207682_10008083 3300025893 Bacteria 4173
282 Ga0207710_10004329 3300025900 Bacteria 6213
283 Ga0207688_10054820 3300025901 Bacteria 2237
284 Ga0207647_10000045 3300025904 Bacteria 90413
285 Ga0207647_10062840 3300025904 Unclassified 2261
286 Ga0207645_10000564 3300025907 Bacteria 30643
287 Ga0207645_10002675 3300025907 Bacteria 13883
288 Ga0207643_10006753 3300025908 Bacteria 6155
289 Ga0207643_10183245 3300025908 Bacteria 1268
290 Ga0207662_10022101 3300025918 Bacteria 3642
291 Ga0207662_10074315 3300025918 Bacteria 2063
292 Ga0207657_10056771 3300025919 Unclassified 3376
293 Ga0207657_10257482 3300025919 Bacteria 1389
294 Ga0207649_10003437 3300025920 Bacteria 8659
295 Ga0207649_10078851 3300025920 Unclassified 2126
296 Ga0207681_10022302 3300025923 Bacteria 4038
297 Ga0207681_10389679 3300025923 Unclassified 1123
298 Ga0207650_10012132 3300025925 Bacteria 5939
299 Ga0207650_10024349 3300025925 Bacteria 4302
300 Ga0207650_10032213 3300025925 Bacteria 3792
301 Ga0207650_10208183 3300025925 Bacteria 1570
302 Ga0207659_10038307 3300025926 Bacteria 3334
303 Ga0207659_10067916 3300025926 Bacteria 2591
304 Ga0207659_10075935 3300025926 Unclassified 2468
305 Ga0207659_10106091 3300025926 Bacteria 2127
306 Ga0207644_10044525 3300025931 Bacteria 3153
307 Ga0207644_10126827 3300025931 Unclassified 1949
308 Ga0207690_10001397 3300025932 Bacteria 15167
309 Ga0207690_10007643 3300025932 Bacteria 6412
310 Ga0207706_10015313 3300025933 Bacteria 6932
311 Ga0207706_10034044 3300025933 Bacteria 4533
312 Ga0207706_10096547 3300025933 Unclassified 2599
313 Ga0207686_10001912 3300025934 Bacteria 11530
314 Ga0207686_10007971 3300025934 Bacteria 5712
315 Ga0207686_10067674 3300025934 Bacteria 2286
316 Ga0207670_10040460 3300025936 Bacteria 3060
317 Ga0207670_10062194 3300025936 Bacteria 2551
318 Ga0207669_10063474 3300025937 Bacteria 2280
319 Ga0207669_10611789 3300025937 Bacteria 887
320 Ga0207704_10167550 3300025938 Bacteria 1571
321 Ga0207691_10082234 3300025940 Bacteria 2893
322 Ga0207691_10082739 3300025940 Bacteria 2882
323 Ga0207691_10192538 3300025940 Bacteria 1778
324 Ga0207691_10348664 3300025940 Bacteria 1267
325 Ga0207711_10141907 3300025941 Unclassified 2162
326 Ga0207689_10009084 3300025942 Bacteria 8605
327 Ga0207689_10012025 3300025942 Bacteria 7417
328 Ga0207689_10066811 3300025942 Bacteria 2955
329 Ga0207689_10090443 3300025942 Unclassified 2515
330 Ga0207689_10142523 3300025942 Bacteria 1974
331 Ga0207689_10255468 3300025942 Bacteria 1449
332 Ga0207689_10281866 3300025942 Bacteria 1376
333 Ga0207661_10006568 3300025944 Bacteria 8226
334 Ga0207661_10027743 3300025944 Bacteria 4329
335 Ga0207661_10061271 3300025944 Unclassified 3039
336 Ga0207679_10034780 3300025945 Bacteria 3558
337 Ga0207679_10052872 3300025945 Bacteria 2981
338 Ga0207679_10107405 3300025945 Bacteria 2196
339 Ga0207667_10683139 3300025949 Bacteria 1030
340 Ga0207667_10747377 3300025949 Bacteria 978
341 Ga0207651_10008583 3300025960 Bacteria 5529
342 Ga0207651_10118487 3300025960 Bacteria 2003
343 Ga0207712_10005591 3300025961 Bacteria 7923
344 Ga0207712_10011267 3300025961 Bacteria 5692
345 Ga0207712_10011960 3300025961 Bacteria 5537
346 Ga0207712_10400659 3300025961 Bacteria 1153
347 Ga0207668_10011881 3300025972 Bacteria 5310
348 Ga0207668_10068377 3300025972 Bacteria 2525
349 Ga0207658_10063484 3300025986 Bacteria 2768
350 Ga0207658_10362392 3300025986 Bacteria 1265
351 Ga0207658_10717023 3300025986 Bacteria 904
352 Ga0207677_10009886 3300026023 Bacteria 5379
353 Ga0207677_10516200 3300026023 Bacteria 1036
354 Ga0207703_10087451 3300026035 Bacteria 2613
355 Ga0207703_10274856 3300026035 Bacteria 1528
356 Ga0207639_10047524 3300026041 Bacteria 3244
357 Ga0207639_10439526 3300026041 Bacteria 1182
358 Ga0207708_10101258 3300026075 Unclassified 2230
359 Ga0207708_10188683 3300026075 Bacteria 1640
360 Ga0207708_10618151 3300026075 Bacteria 919
361 Ga0207641_10006351 3300026088 Bacteria 9981
362 Ga0207641_10088857 3300026088 Unclassified 2699
363 Ga0207641_10365429 3300026088 Unclassified 1379
364 Ga0207641_10435842 3300026088 Unclassified 1264
365 Ga0207648_10001412 3300026089 Bacteria 26464
366 Ga0207648_10065741 3300026089 Bacteria 3162
367 Ga0207648_10068673 3300026089 Bacteria 3088
368 Ga0207648_10189126 3300026089 Bacteria 1824
369 Ga0207648_10431388 3300026089 Bacteria 1198
370 Ga0207648_10607854 3300026089 Bacteria 1008
371 Ga0207676_10010179 3300026095 Bacteria 6692
372 Ga0207676_10066196 3300026095 Unclassified 2880
373 Ga0207674_10003873 3300026116 Bacteria 18239
374 Ga0207674_10007551 3300026116 Bacteria 12665
375 Ga0207674_10021857 3300026116 Bacteria 6884
376 Ga0207674_10321120 3300026116 Bacteria 1498
377 Ga0207674_10334657 3300026116 Bacteria 1464
378 Ga0207674_10609157 3300026116 Bacteria 1055
379 Ga0207675_100002017 3300026118 Bacteria 20238
380 Ga0207675_100015514 3300026118 Bacteria 7106
381 Ga0207675_100113494 3300026118 Bacteria 2558
382 Ga0207675_100376912 3300026118 Bacteria 1394
383 Ga0207683_10012659 3300026121 Bacteria 7194
384 Ga0207683_10020186 3300026121 Bacteria 5696
385 Ga0207683_10072061 3300026121 Unclassified 3055
386 Ga0207683_10533127 3300026121 Bacteria 1085
387 Ga0207683_10577623 3300026121 Bacteria 1040
388 Ga0207698_10001866 3300026142 Bacteria 12309
389 Ga0207698_10425235 3300026142 Bacteria 1276
390 Ga0207698_10593316 3300026142 Unclassified 1091
391 Ga0209968_1005811 3300027526 Bacteria 1854
392 Ga0207428_10177950 3300027907 Bacteria 1608
393 Ga0207428_10227956 3300027907 Bacteria 1395
394 Ga0207428_10339361 3300027907 Bacteria 1107
395 Ga0207428_10374951 3300027907 Bacteria 1044
396 Ga0268266_10073239 3300028379 Unclassified 2972
397 Ga0268265_10041861 3300028380 Bacteria 3394
398 Ga0268264_10021383 3300028381 Bacteria 5283
399 Ga0268264_10049618 3300028381 Unclassified 3492
400 Ga0268264_10717720 3300028381 Bacteria 994
401 Ga0307408_100072368 3300031548 Bacteria 2552
402 Ga0307413_10031729 3300031824 Bacteria 2985
403 Ga0307413_10222823 3300031824 Bacteria 1379
404 Ga0307410_10185416 3300031852 Bacteria 1579
405 Ga0307406_10334537 3300031901 Bacteria 1177
406 Ga0307409_100616543 3300031995 Bacteria 1074
407 Ga0307409_100857725 3300031995 Bacteria 919
408 Ga0307416_100105233 3300032002 Bacteria 2469
409 Ga0307414_10502415 3300032004 Unclassified 1073
410 Ga0307414_10614358 3300032004 Bacteria 976
411 Ga0307415_100068072 3300032126 Bacteria 2491
412 Ga0307415_100075258 3300032126 Bacteria 2389
413 Ga0373955_0043442 3300035172 Unclassified 2418
414 Ga0373924_0148500 3300035410 Bacteria 1025
415 Ga0373935_0248698 3300035692 Bacteria 1244
416 Ga0373933_0180073 3300035724 Bacteria 1348
417 Ga0373947_0041819 3300035725 Bacteria 2735
418 Ga0395905_0507966 3300037471 Unclassified 1106
419 Ga0439453_0054280 3300041408 Bacteria 816
420 Ga0451807_1168521 3300041486 Bacteria 2199
421 Ga0451807_2396850 3300041486 Bacteria 2232
422 Ga0439441_012224 3300042001 Bacteria 1470
423 Ga0439454_008571 3300042011 Unclassified 1309
424 Ga0451577_0079828 3300042876 Unclassified 2917
425 Ga0453684_0000994 3300044712 Bacteria 92499
426 Ga0453684_0088658 3300044712 Unclassified 3830
427 Ga0453684_0103136 3300044712 Bacteria 3486
428 Ga0451576_0040148 3300045051 Bacteria 4955
429 Ga0451576_0230246 3300045051 Unclassified 1935
430 Ga0451576_0535944 3300045051 Unclassified 1230
431 Ga0495592_0035656 3300046454 Unclassified 3749
432 Ga0495638_0000008 3300046460 Bacteria 565643
433 Ga0495618_0083407 3300046514 Unclassified 2042
434 Ga0495630_0211180 3300046517 Unclassified 1481
435 Ga0495640_0033637 3300046533 Bacteria 3641
436 Ga0495634_0054124 3300046642 Bacteria 2687
437 Ga0495657_0031091 3300046675 Unclassified 3735
438 Ga0495676_0223595 3300047321 Unclassified 1296
439 Ga0495684_0192730 3300047471 Unclassified 1506
440 Ga0501322_010470 3300049538 Bacteria 714
441 Ga0501032_0019859 3300049569 Bacteria 4691
442 Ga0501032_0075869 3300049569 Unclassified 2239
443 Ga0501033_0026138 3300049570 Bacteria 4394
444 Ga0501034_0018364 3300049571 Bacteria 7171
445 Ga0501036_0054064 3300049572 Bacteria 3400
446 Ga0501036_0073364 3300049572 Bacteria 2893
447 Ga0501037_0008099 3300049573 Bacteria 7700
448 Ga0501037_0044185 3300049573 Bacteria 3272
449 Ga0501038_0026990 3300049574 Bacteria 5111
450 Ga0501038_0045593 3300049574 Bacteria 3805
451 Ga0501039_0042441 3300049575 Bacteria 3514
452 Ga0501043_0006349 3300049579 Bacteria 9500
453 Ga0501047_0016649 3300049581 Bacteria 7020
454 Ga0501047_0433613 3300049581 Bacteria 1145
455 Ga0501070_0569667 3300049586 Bacteria 905
456 Ga0501072_0096806 3300049588 Unclassified 2345
457 Ga0501198_011231 3300049649 Unclassified 1334
458 Ga0501198_019152 3300049649 Unclassified 1076
459 Ga0501201_001761 3300049651 Unclassified 2006
460 Ga0501202_001037 3300049652 Bacteria 4315
461 Ga0501202_014314 3300049652 Bacteria 1518
462 Ga0501207_005754 3300049654 Bacteria 1723
463 Ga0501217_014892 3300049661 Unclassified 1763
464 Ga0501222_000478 3300049662 Bacteria 5972
465 Ga0501223_007965 3300049663 Bacteria 2162
466 Ga0501223_035955 3300049663 Unclassified 963
467 Ga0501224_023933 3300049664 Unclassified 912
468 Ga0501242_002839 3300049674 Bacteria 1843
469 Ga0501242_004477 3300049674 Bacteria 1551
470 Ga0501243_005810 3300049675 Bacteria 1862
471 Ga0501246_007917 3300049676 Unclassified 933
472 Ga0501252_006703 3300049682 Unclassified 1288
473 Ga0501257_000912 3300049686 Bacteria 5981
474 Ga0501257_000924 3300049686 Bacteria 5960
475 Ga0501258_015068 3300049687 Bacteria 863
476 Ga0501259_003263 3300049688 Bacteria 2591
477 Ga0501225_0005125 3300049705 Unclassified 3858
478 Ga0501225_0016013 3300049705 Bacteria 2084
479 Ga0501234_006330 3300049707 Bacteria 1851
480 Ga0501080_0179414 3300049742 Bacteria 1950
481 Ga0501264_000084 3300049761 Bacteria 13652
482 Ga0501266_002799 3300049763 Bacteria 2183
483 Ga0501266_003286 3300049763 Bacteria 2010
484 Ga0501266_017838 3300049763 Unclassified 951
485 Ga0501267_007133 3300049764 Bacteria 1084
486 Ga0501273_027222 3300049770 Unclassified 800
487 Ga0501035_0006477 3300049822 Bacteria 11000
488 Ga0501035_0045817 3300049822 Bacteria 3934
489 Ga0501044_0009442 3300049823 Bacteria 10626
490 Ga0501044_0034500 3300049823 Bacteria 5305
491 nmdc:mga0k408_16363_c2 3300050493 Bacteria 3074
492 nmdc:mga0k408_74539_c1 3300050493 Unclassified 1983
493 nmdc:mga09592_82784_c1 3300050508 Unclassified 2735
494 nmdc:mga0qj67_2762_c1 3300050509 Bacteria 8806
495 nmdc:mga08y16_117405_c1 3300050511 Bacteria 2769
496 nmdc:mga08y16_141796_c1 3300050511 Bacteria 2498
497 nmdc:mga08y16_2509_c1 3300050511 Bacteria 18877
498 nmdc:mga08y16_301095_c1 3300050511 Bacteria 1653
499 Ga0500604_0019210 3300053151 Bacteria 1911
500 Ga0500622_0008380 3300053156 Bacteria 5785
501 Ga0065712_10124227
502 MRS1b_contig_3998254
503 ARcpr5yngRDRAFT_c007529
504 JGI24751J29686_10000769
505 rootH2_10166589
506 rootL2_10173495
507 rootL2_10321286
508 rootH1_10006585
509 rootH1_10070677
510 rootH1_10144212
511 rootH1_10272780
512 Ga0065704_10102599
513 Ga0065704_10167454
514 Ga0065712_10003355
515 Ga0065712_10072563
516 Ga0065712_10129647
517 Ga0065712_10174672
518 Ga0065712_10243661
519 Ga0065707_10329478
520 Ga0070658_10101626
521 Ga0070676_10001833
522 Ga0070676_10002307
523 Ga0070676_10041782
524 Ga0070683_100000711
525 Ga0070683_100044477
526 Ga0070683_100102379
527 Ga0070690_100011905
528 Ga0070690_100417525
529 Ga0070670_100016575
530 Ga0070670_100022145
531 Ga0070670_100024652
532 Ga0070670_100058238
533 Ga0070670_100111598
534 Ga0070670_100125835
535 Ga0070670_100138243
536 Ga0070677_10042395
537 Ga0068869_100014735
538 Ga0068869_100056526
539 Ga0068869_100153273
540 Ga0068869_100213890
541 Ga0068869_100224987
542 Ga0070666_10062999
543 Ga0070666_10136648
544 Ga0070682_100450692
545 Ga0068868_100001698
546 Ga0068868_100002315
547 Ga0068868_100131793
548 Ga0068868_100547877
549 Ga0070660_100045232
550 Ga0070660_100092020
551 Ga0070689_100015073
552 Ga0070689_100093871
553 Ga0070689_100119752
554 Ga0070689_100271996
555 Ga0070687_100005497
556 Ga0070661_100002061
557 Ga0070661_100008998
558 Ga0070661_100013116
559 Ga0070661_100030788
560 Ga0070668_100004161
561 Ga0070668_100013018
562 Ga0070669_100002828
563 Ga0070669_100022136
564 Ga0070669_100024911
565 Ga0070675_100242703
566 Ga0070671_100044813
567 Ga0070671_100146517
568 Ga0070671_100166387
569 Ga0070674_100001387
570 Ga0070674_100010701
571 Ga0070673_100036303
572 Ga0070673_100053376
573 Ga0070673_100108231
574 Ga0070673_100171379
575 Ga0070673_100334544
576 Ga0070688_100000569
577 Ga0070688_100122762
578 Ga0070659_100003984
579 Ga0070659_100016093
580 Ga0070659_100519906
581 Ga0070667_100084527
582 Ga0070667_100282745
583 Ga0070701_10129399
584 Ga0070700_100365726
585 Ga0070663_100109727
586 Ga0070663_100595425
587 Ga0070678_100030300
588 Ga0070678_100060324
589 Ga0070678_100288064
590 Ga0070678_100689717
591 Ga0070662_100068121
592 Ga0070662_100094818
593 Ga0070662_100099538
594 Ga0068867_100020757
595 Ga0068867_100042288
596 Ga0068867_100086925
597 Ga0070685_10030964
598 Ga0070685_10097673
599 Ga0070685_10152507
600 Ga0070707_100715307
601 Ga0070698_100001058
602 Ga0070698_100002424
603 Ga0070698_100196358
604 Ga0070698_100203208
605 Ga0070684_100003482
606 Ga0068853_100032708
607 Ga0068853_100092145
608 Ga0070672_100029195
609 Ga0070672_100055997
610 Ga0070672_100065172
611 Ga0070672_100140576
612 Ga0070672_100317337
613 Ga0070686_100109463
614 Ga0070665_100251240
615 Ga0070665_100276540
616 Ga0070665_100348838
617 Ga0070665_100378879
618 Ga0068855_100125854
619 Ga0068855_100848029
620 Ga0070664_100003269
621 Ga0070664_100013920
622 Ga0070664_100024816
623 Ga0070664_100479543
624 Ga0068857_100001350
625 Ga0068857_100006950
626 Ga0068857_100048588
627 Ga0068857_100372058
628 Ga0068857_100889782
629 Ga0068854_100046263
630 Ga0070702_100061141
631 Ga0068852_100000248
632 Ga0068852_100201377
633 Ga0068852_100234026
634 Ga0068852_100392251
635 Ga0068852_100448851
636 Ga0068859_100009642
637 Ga0068859_100025538
638 Ga0068859_100029726
639 Ga0068859_100030511
640 Ga0068859_100202634
641 Ga0068859_100325291
642 Ga0068859_100422293
643 Ga0068859_100584613
644 Ga0068859_100839019
645 Ga0068864_100006031
646 Ga0068864_100014333
647 Ga0068864_100014877
648 Ga0068864_100135031
649 Ga0068864_100638744
650 Ga0068866_10097360
651 Ga0068861_100037680
652 Ga0068861_100800128
653 Ga0068851_10081603
654 Ga0068870_10006818
655 Ga0068870_10269488
656 Ga0068863_100027808
657 Ga0068863_100219979
658 Ga0068863_100293969
659 Ga0068863_100339941
660 Ga0068863_100434388
661 Ga0068858_100065209
662 Ga0068858_100083306
663 Ga0068858_100879468
664 Ga0068860_100011752
665 Ga0068860_100043372
666 Ga0068860_100572888
667 Ga0068862_100004673
668 Ga0068862_100254741
669 Ga0081539_10119354
670 Ga0075432_10024002
671 Ga0075366_10004507
672 Ga0075366_10097909
673 Ga0097621_100004351
674 Ga0097621_100155337
675 Ga0068871_100016670
676 Ga0068871_100038033
677 Ga0068871_100064356
678 Ga0075428_100019977
679 Ga0075428_100062423
680 Ga0075428_100158137
681 Ga0075430_100193417
682 Ga0075431_100043970
683 Ga0075429_100039587
684 Ga0075429_100106115
685 Ga0068865_100224555
686 Ga0097620_100009641
687 Ga0097620_100025538
688 Ga0097620_100029725
689 Ga0097620_100030511
690 Ga0097620_100030906
691 Ga0097620_100202661
692 Ga0097620_100325287
693 Ga0097620_100422272
694 Ga0097620_100584559
695 Ga0097620_100839004
696 Ga0111539_10021793
697 Ga0111539_10035262
698 Ga0111539_10062147
699 Ga0111539_10088444
700 Ga0111539_10168903
701 Ga0111539_10237658
702 Ga0111539_10609146
703 Ga0111539_10816775
704 Ga0105247_10076687
705 Ga0105241_10128628
706 Ga0105241_10160820
707 Ga0105241_10176364
708 Ga0105242_10005285
709 Ga0105242_10005322
710 Ga0105242_10013638
711 Ga0105242_10141625
712 Ga0105242_10301271
713 Ga0105249_10002009
714 Ga0105249_10011926
715 Ga0105249_10019596
716 Ga0105249_10466267
717 Ga0105249_10638094
718 Ga0105239_10711564
719 Ga0105246_10005914
720 Ga0105246_10040832
721 Ga0157373_10052552
722 Ga0157373_10115795
723 Ga0157371_10018392
724 Ga0157371_10190095
725 Ga0157370_10308278
726 Ga0157374_10002504
727 Ga0157374_10094378
728 Ga0157374_10194969
729 Ga0157374_10233836
730 Ga0157374_10542746
731 Ga0157378_10005296
732 Ga0157378_10039137
733 Ga0157378_10053268
734 Ga0163162_10016082
735 Ga0163162_10061887
736 Ga0163162_10079768
737 Ga0163162_10287296
738 Ga0163162_10362466
739 Ga0157372_10134513
740 Ga0157372_10162874
741 Ga0157372_10182832
742 Ga0157372_10268565
743 Ga0157372_10311147
744 Ga0157372_10426871
745 Ga0157372_10427773
746 Ga0157372_10471303
747 Ga0157372_10484937
748 Ga0157372_11033375
749 Ga0157372_11279508
750 Ga0157375_10006892
751 Ga0157375_10007682
752 Ga0157375_10010389
753 Ga0157375_10014416
754 Ga0157375_10024831
755 Ga0157375_10187086
756 Ga0163163_10002145
757 Ga0163163_10078090
758 Ga0163163_10264101
759 Ga0163163_10377622
760 Ga0157380_10003900
761 Ga0157380_10006439
762 Ga0157380_10020167
763 Ga0157380_10154876
764 Ga0157380_10154891
765 Ga0157380_10290623
766 Ga0157380_10458017
767 Ga0157380_11132408
768 Ga0157377_10006433
769 Ga0157377_10275816
770 Ga0157379_10123775
771 Ga0157379_10247063
772 Ga0157376_10048513
773 Ga0157376_10088440
774 Ga0157376_10269792
775 Ga0157376_10331302
776 Ga0163161_10104449
777 Ga0163161_10580305
778 Ga0209050_1042148
779 Ga0207697_10016103
780 Ga0207656_10078546
781 Ga0207682_10008083
782 Ga0207710_10004329
783 Ga0207688_10054820
784 Ga0207647_10000045
785 Ga0207647_10062840
786 Ga0207645_10000564
787 Ga0207645_10002675
788 Ga0207643_10006753
789 Ga0207643_10183245
790 Ga0207662_10022101
791 Ga0207662_10074315
792 Ga0207657_10056771
793 Ga0207657_10257482
794 Ga0207649_10003437
795 Ga0207649_10078851
796 Ga0207681_10022302
797 Ga0207681_10389679
798 Ga0207650_10012132
799 Ga0207650_10024349
800 Ga0207650_10032213
801 Ga0207650_10208183
802 Ga0207659_10038307
803 Ga0207659_10067916
804 Ga0207659_10075935
805 Ga0207659_10106091
806 Ga0207644_10044525
807 Ga0207644_10126827
808 Ga0207690_10001397
809 Ga0207690_10007643
810 Ga0207706_10015313
811 Ga0207706_10034044
812 Ga0207706_10096547
813 Ga0207686_10001912
814 Ga0207686_10007971
815 Ga0207686_10067674
816 Ga0207670_10040460
817 Ga0207670_10062194
818 Ga0207669_10063474
819 Ga0207669_10611789
820 Ga0207704_10167550
821 Ga0207691_10082234
822 Ga0207691_10082739
823 Ga0207691_10192538
824 Ga0207691_10348664
825 Ga0207711_10141907
826 Ga0207689_10009084
827 Ga0207689_10012025
828 Ga0207689_10066811
829 Ga0207689_10090443
830 Ga0207689_10142523
831 Ga0207689_10255468
832 Ga0207689_10281866
833 Ga0207661_10006568
834 Ga0207661_10027743
835 Ga0207661_10061271
836 Ga0207679_10034780
837 Ga0207679_10052872
838 Ga0207679_10107405
839 Ga0207667_10683139
840 Ga0207667_10747377
841 Ga0207651_10008583
842 Ga0207651_10118487
843 Ga0207712_10005591
844 Ga0207712_10011267
845 Ga0207712_10011960
846 Ga0207712_10400659
847 Ga0207668_10011881
848 Ga0207668_10068377
849 Ga0207658_10063484
850 Ga0207658_10362392
851 Ga0207658_10717023
852 Ga0207677_10009886
853 Ga0207677_10516200
854 Ga0207703_10087451
855 Ga0207703_10274856
856 Ga0207639_10047524
857 Ga0207639_10439526
858 Ga0207708_10101258
859 Ga0207708_10188683
860 Ga0207708_10618151
861 Ga0207641_10006351
862 Ga0207641_10088857
863 Ga0207641_10365429
864 Ga0207641_10435842
865 Ga0207648_10001412
866 Ga0207648_10065741
867 Ga0207648_10068673
868 Ga0207648_10189126
869 Ga0207648_10431388
870 Ga0207648_10607854
871 Ga0207676_10010179
872 Ga0207676_10066196
873 Ga0207674_10003873
874 Ga0207674_10007551
875 Ga0207674_10021857
876 Ga0207674_10321120
877 Ga0207674_10334657
878 Ga0207674_10609157
879 Ga0207675_100002017
880 Ga0207675_100015514
881 Ga0207675_100113494
882 Ga0207675_100376912
883 Ga0207683_10012659
884 Ga0207683_10020186
885 Ga0207683_10072061
886 Ga0207683_10533127
887 Ga0207683_10577623
888 Ga0207698_10001866
889 Ga0207698_10425235
890 Ga0207698_10593316
891 Ga0209968_1005811
892 Ga0207428_10177950
893 Ga0207428_10227956
894 Ga0207428_10339361
895 Ga0207428_10374951
896 Ga0268266_10073239
897 Ga0268265_10041861
898 Ga0268264_10021383
899 Ga0268264_10049618
900 Ga0268264_10717720
901 Ga0307408_100072368
902 Ga0307413_10031729
903 Ga0307413_10222823
904 Ga0307410_10185416
905 Ga0307406_10334537
906 Ga0307409_100616543
907 Ga0307409_100857725
908 Ga0307416_100105233
909 Ga0307414_10502415
910 Ga0307414_10614358
911 Ga0307415_100068072
912 Ga0307415_100075258
913 Ga0373955_0043442
914 Ga0373924_0148500
915 Ga0373935_0248698
916 Ga0373933_0180073
917 Ga0373947_0041819
918 Ga0395905_0507966
919 Ga0439453_0054280
920 Ga0451807_1168521
921 Ga0451807_2396850
922 Ga0439441_012224
923 Ga0439454_008571
924 Ga0451577_0079828
925 Ga0453684_0000994
926 Ga0453684_0088658
927 Ga0453684_0103136
928 Ga0451576_0040148
929 Ga0451576_0230246
930 Ga0451576_0535944
931 Ga0495592_0035656
932 Ga0495638_0000008
933 Ga0495618_0083407
934 Ga0495630_0211180
935 Ga0495640_0033637
936 Ga0495634_0054124
937 Ga0495657_0031091
938 Ga0495676_0223595
939 Ga0495684_0192730
940 Ga0501322_010470
941 Ga0501032_0019859
942 Ga0501032_0075869
943 Ga0501033_0026138
944 Ga0501034_0018364
945 Ga0501036_0054064
946 Ga0501036_0073364
947 Ga0501037_0008099
948 Ga0501037_0044185
949 Ga0501038_0026990
950 Ga0501038_0045593
951 Ga0501039_0042441
952 Ga0501043_0006349
953 Ga0501047_0016649
954 Ga0501047_0433613
955 Ga0501070_0569667
956 Ga0501072_0096806
957 Ga0501198_011231
958 Ga0501198_019152
959 Ga0501201_001761
960 Ga0501202_001037
961 Ga0501202_014314
962 Ga0501207_005754
963 Ga0501217_014892
964 Ga0501222_000478
965 Ga0501223_007965
966 Ga0501223_035955
967 Ga0501224_023933
968 Ga0501242_002839
969 Ga0501242_004477
970 Ga0501243_005810
971 Ga0501246_007917
972 Ga0501252_006703
973 Ga0501257_000912
974 Ga0501257_000924
975 Ga0501258_015068
976 Ga0501259_003263
977 Ga0501225_0005125
978 Ga0501225_0016013
979 Ga0501234_006330
980 Ga0501080_0179414
981 Ga0501264_000084
982 Ga0501266_002799
983 Ga0501266_003286
984 Ga0501266_017838
985 Ga0501267_007133
986 Ga0501273_027222
987 Ga0501035_0006477
988 Ga0501035_0045817
989 Ga0501044_0009442
990 Ga0501044_0034500
991 nmdc:mga0k408_16363_c2
992 nmdc:mga0k408_74539_c1
993 nmdc:mga09592_82784_c1
994 nmdc:mga0qj67_2762_c1
995 nmdc:mga08y16_117405_c1
996 nmdc:mga08y16_141796_c1
997 nmdc:mga08y16_2509_c1
998 nmdc:mga08y16_301095_c1
999 Ga0500604_0019210
1000 Ga0500622_0008380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12679

ABC2_membrane_2

ABC-2 family transporter protein

87

270

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o16-assembly1.cif.gz_D abc transporter nosdfy, nucleotide-free in lipid nanodisc, r-domain 3 0.7038 4 220
7o12-assembly1.cif.gz_E abc transporter nosdfy, amppnp-bound in gdn 0.6882 4 220
7o16-assembly1.cif.gz_D abc transporter nosdfy, nucleotide-free in lipid nanodisc, r-domain 3 0.6869 4 220
7znq-assembly1.cif.gz_Y abc transporter complex nosdfyl in gdn 0.6769 4 221
7qba-assembly1.cif.gz_E cryoem structure of the abc transporter nosdfy complexed with nitrous oxide reductase nosz 0.6739 2 219
ID Description Score Start End Superfamily
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.4535 24 218 1.10.3720.10
af_Q2G1V6_3_205_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.3705 24 218 1.10.3720.10
3wvoC02 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4; 0.3678 81 216 1.10.132.100
3wvoC02 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4; 0.3606 81 216 1.10.132.100
af_Q2FV70_137_332_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.3341 21 219 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A350UZP5-F1-model_v4 ABC transporter permease 0.9123 52 222 GO:0016020
AF-A0A350UZP5-F1-model_v4 ABC transporter permease 0.9025 52 222 GO:0016020
AF-K1YZ37-F1-model_v4 ABC transporter permease 0.9019 87 222 GO:0005886
GO:0140359
AF-K1YZ37-F1-model_v4 ABC transporter permease 0.8839 87 222 GO:0005886
GO:0140359
AF-A0A524NA75-F1-model_v4 ABC transporter permease 0.8831 40 222 GO:0005886
GO:0140359

Map