F455424

General Info

Members Datasets Scaffolds Average Seq Length
499 313 410 245

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0106040|Ga0495654_0106040_351_1244
Length 284
Sequence LAALVLIVFLPYWRQAWEVSRWLARLLRHLTGKPPPRNYWNLWEQAMNDADFMRYSRQLLLEDIAIEGQQRLLASKVLIVGLGGLGSPAALYLAAAGVGTLTLADDDNVHISNLQRQILFTSQDIEQPKSLAAHRHLQQLNPDIKLQVIGERLAGEVLNQAVKNVDLVLDCSDNMATRQAVNAACVVHNKPLISASAVGFGGQLMVLTPPWETGCYRCVWPDEHEPERNCRTAGIIGPVVLLSGMAPATGTLRLFDARQHSWRSLAMQKAANCPVCGGLDAHPI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
3 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
4 2561511199 Enterobacter sp. R4-368 Isolate Nodule
5 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
6 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
7 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
8 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
9 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
10 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
11 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
12 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
13 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
14 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
15 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
16 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
17 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
18 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
19 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
20 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
21 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
22 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
23 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
24 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
25 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
26 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
27 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
28 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
29 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
30 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
31 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
32 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
33 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
34 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
35 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
36 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
37 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
38 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
39 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
40 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
41 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
42 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
43 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
44 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
45 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
46 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
47 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
48 2636415599 Klebsiella variicola DX120E Isolate Unclassified
49 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
50 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
51 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
52 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
53 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
54 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
55 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
56 2751185917 Enterobacter sp. HK169 Isolate Unclassified
57 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
58 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
59 2775507074 Klebsiella sp. D5A Isolate Unclassified
60 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
61 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
62 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
63 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
64 2821118458 Enterobacter asburiae 609 Isolate Unclassified
65 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
66 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
67 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
68 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
69 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
70 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
71 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
72 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
73 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
74 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
75 2937539931 Pantoea sp. LS15 Isolate Unclassified
76 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
77 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
78 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
79 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
80 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
81 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
82 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
83 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
84 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
85 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
86 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
87 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
88 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
89 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
90 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
91 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
92 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
93 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
94 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
95 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
98 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
99 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
100 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
101 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
102 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
105 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
106 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
107 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
108 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
109 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
110 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
111 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
115 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
116 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
117 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
118 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
119 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
120 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
121 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
122 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
123 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
124 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
125 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
128 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
129 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
130 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
148 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
149 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
150 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
151 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
152 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
153 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
156 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
157 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
189 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
198 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
206 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
214 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
215 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
218 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
221 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
222 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
223 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
224 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
225 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
226 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
227 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
228 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
229 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
230 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
248 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
249 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
250 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
251 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
252 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
256 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
259 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
268 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
274 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
275 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
288 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
289 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
290 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
291 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
292 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
293 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
294 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
295 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
296 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
297 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
302 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
303 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
304 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
305 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 8018221730 Enterobacter sp. CM29 Isolate Unclassified
309 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
310 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
311 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
312 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
313 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.96
Metatranscriptomes 0.2
Isolates 17.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.4
Bulb 0
Endosphere 9.22
Nodule 2.2
Rhizoplane 11.62
Rhizosphere 58.52
Stem 0
Stem Tuber 0
Unclassified 18.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_651300 2162886007 Bacteria 2977
2 rootH2_10079260 3300003320 Bacteria 7410
3 rootL2_10054925 3300003322 Bacteria 4797
4 rootH1_10002305 3300003323 Bacteria 29425
5 Ga0065704_10000683 3300005289 Bacteria 13811
6 Ga0065704_10007790 3300005289 Bacteria 2520
7 Ga0065704_10080163 3300005289 Bacteria 3998
8 Ga0070676_10161647 3300005328 Bacteria 1442
9 Ga0070683_100109513 3300005329 Bacteria 2605
10 Ga0070670_100048895 3300005331 Bacteria 3638
11 Ga0070670_100184500 3300005331 Bacteria 1811
12 Ga0068869_100022661 3300005334 Bacteria 4330
13 Ga0068868_100357648 3300005338 Bacteria 1252
14 Ga0070689_100157364 3300005340 Bacteria 1835
15 Ga0070687_100039292 3300005343 Bacteria 2377
16 Ga0070661_100127269 3300005344 Bacteria 1911
17 Ga0070675_100007369 3300005354 Bacteria 8496
18 Ga0070671_100205470 3300005355 Bacteria 1670
19 Ga0070673_100157902 3300005364 Bacteria 1926
20 Ga0070659_100021454 3300005366 Bacteria 4920
21 Ga0070667_100168276 3300005367 Bacteria 1934
22 Ga0070708_100046083 3300005445 Bacteria 3846
23 Ga0070663_100527540 3300005455 Bacteria 984
24 Ga0070678_100312841 3300005456 Bacteria 1339
25 Ga0068867_100149321 3300005459 Bacteria 1834
26 Ga0070685_10397257 3300005466 Bacteria 954
27 Ga0070706_100002111 3300005467 Bacteria 20241
28 Ga0070707_100012746 3300005468 Bacteria 7850
29 Ga0070699_100023238 3300005518 Bacteria 5341
30 Ga0070672_100009485 3300005543 Bacteria 6712
31 Ga0070672_100093630 3300005543 Bacteria 2428
32 Ga0070693_100051953 3300005547 Bacteria 2348
33 Ga0070665_100003943 3300005548 Bacteria 15663
34 Ga0070664_100129319 3300005564 Bacteria 2217
35 Ga0068857_100000461 3300005577 Bacteria 28989
36 Ga0068857_100178077 3300005577 Bacteria 1934
37 Ga0068857_100247159 3300005577 Bacteria 1634
38 Ga0068854_100225901 3300005578 Bacteria 1483
39 Ga0068852_100031859 3300005616 Bacteria 4358
40 Ga0068852_100056002 3300005616 Bacteria 3405
41 Ga0068859_100258640 3300005617 Bacteria 1832
42 Ga0068851_10000680 3300005834 Bacteria 14486
43 Ga0068863_100138347 3300005841 Bacteria 2327
44 Ga0068858_100034619 3300005842 Bacteria 4685
45 Ga0068860_100013086 3300005843 Bacteria 8143
46 Ga0068860_100463071 3300005843 Bacteria 1262
47 Ga0075365_10004102 3300006038 Bacteria 7659
48 Ga0075368_10010810 3300006042 Bacteria 3308
49 Ga0075368_10137341 3300006042 Bacteria 1018
50 Ga0075364_10053532 3300006051 Bacteria 2638
51 Ga0075362_10092597 3300006177 Bacteria 1404
52 Ga0075362_10128516 3300006177 Bacteria 1203
53 Ga0075367_10001243 3300006178 Bacteria 10737
54 Ga0075367_10007470 3300006178 Bacteria 5598
55 Ga0075367_10105033 3300006178 Bacteria 1730
56 Ga0075369_10045054 3300006186 Bacteria 1896
57 Ga0075366_10008667 3300006195 Bacteria 5662
58 Ga0075366_10010369 3300006195 Bacteria 5231
59 Ga0075366_10221222 3300006195 Bacteria 1153
60 Ga0097621_100005385 3300006237 Bacteria 9019
61 Ga0075370_10000260 3300006353 Bacteria 18957
62 Ga0075370_10004894 3300006353 Bacteria 6575
63 Ga0075370_10006961 3300006353 Bacteria 5732
64 Ga0075370_10020922 3300006353 Bacteria 3582
65 Ga0075370_10036219 3300006353 Bacteria 2771
66 Ga0097620_100258659 3300006931 Bacteria 1832
67 Ga0079104_1001129 3300006946 Bacteria 19449
68 Ga0079104_1001169 3300006946 Bacteria 18954
69 Ga0079104_1003743 3300006946 Bacteria 6868
70 Ga0079104_1004692 3300006946 Bacteria 5725
71 Ga0105251_10001341 3300009011 Bacteria 21259
72 Ga0105251_10003504 3300009011 Bacteria 11341
73 Ga0105251_10006220 3300009011 Bacteria 7657
74 Ga0105251_10016393 3300009011 Bacteria 4005
75 Ga0105251_10054396 3300009011 Bacteria 1901
76 Ga0105251_10061958 3300009011 Bacteria 1758
77 Ga0105251_10069938 3300009011 Bacteria 1636
78 Ga0105244_10001136 3300009036 Bacteria 22077
79 Ga0105244_10001577 3300009036 Bacteria 18112
80 Ga0105244_10002783 3300009036 Bacteria 13038
81 Ga0105244_10003216 3300009036 Bacteria 11826
82 Ga0105244_10004444 3300009036 Bacteria 9634
83 Ga0105244_10005711 3300009036 Bacteria 8213
84 Ga0105244_10035945 3300009036 Bacteria 2599
85 Ga0105250_10000725 3300009092 Bacteria 20132
86 Ga0105250_10002762 3300009092 Bacteria 8621
87 Ga0105240_10018032 3300009093 Bacteria 9493
88 Ga0105243_10002571 3300009148 Bacteria 15159
89 Ga0105243_10031699 3300009148 Bacteria 4077
90 Ga0105243_10035031 3300009148 Bacteria 3891
91 Ga0105243_10276224 3300009148 Bacteria 1511
92 Ga0105237_10012763 3300009545 Bacteria 8835
93 Ga0105249_10751987 3300009553 Bacteria 1037
94 Ga0105239_10171427 3300010375 Bacteria 2427
95 Ga0157371_10047832 3300013102 Bacteria 3040
96 Ga0157371_10113428 3300013102 Bacteria 1925
97 Ga0157370_10010496 3300013104 Bacteria 9755
98 Ga0157374_10073635 3300013296 Bacteria 3224
99 Ga0157372_10007007 3300013307 Bacteria 12009
100 Ga0157375_10010965 3300013308 Bacteria 7994
101 Ga0157375_10015344 3300013308 Bacteria 6855
102 Ga0157380_10218076 3300014326 Bacteria 1705
103 Ga0157379_10024095 3300014968 Bacteria 5401
104 Ga0157379_10819293 3300014968 Bacteria 879
105 Ga0157376_10055136 3300014969 Bacteria 3316
106 Ga0182006_1000574 3300015261 Bacteria 27080
107 Ga0183366_1010 3300015679 Bacteria 29263
108 Ga0183370_1010 3300015680 Bacteria 29263
109 Ga0183369_1025 3300015685 Bacteria 29263
110 Ga0183368_1013 3300015687 Bacteria 29263
111 Ga0163161_10099170 3300017792 Bacteria 2166
112 Ga0213872_10000036 3300021361 Bacteria 129233
113 Ga0213876_10000387 3300021384 Bacteria 36975
114 Ga0209051_1003898 3300025303 Bacteria 9523
115 Ga0207696_1000531 3300025711 Bacteria 31313
116 Ga0207696_1000939 3300025711 Bacteria 17877
117 Ga0207696_1016324 3300025711 Bacteria 2487
118 Ga0207655_1001092 3300025728 Bacteria 26682
119 Ga0207655_1001654 3300025728 Bacteria 19738
120 Ga0207655_1001837 3300025728 Bacteria 18364
121 Ga0207655_1005010 3300025728 Bacteria 9169
122 Ga0207655_1010114 3300025728 Bacteria 5765
123 Ga0207655_1010902 3300025728 Bacteria 5465
124 Ga0207713_1001430 3300025735 Bacteria 19098
125 Ga0207713_1001473 3300025735 Bacteria 18653
126 Ga0207713_1001902 3300025735 Bacteria 15819
127 Ga0207713_1003778 3300025735 Bacteria 10154
128 Ga0207713_1046265 3300025735 Bacteria 1771
129 Ga0207713_1052089 3300025735 Bacteria 1623
130 Ga0207643_10251567 3300025908 Bacteria 1089
131 Ga0207705_10164936 3300025909 Bacteria 1666
132 Ga0207684_10005448 3300025910 Bacteria 11734
133 Ga0207695_10102041 3300025913 Bacteria 2862
134 Ga0207671_10035195 3300025914 Bacteria 3718
135 Ga0207662_10056900 3300025918 Bacteria 2336
136 Ga0207646_10118291 3300025922 Bacteria 2381
137 Ga0207650_10044961 3300025925 Bacteria 3247
138 Ga0207659_10013036 3300025926 Bacteria 5313
139 Ga0207644_10420932 3300025931 Bacteria 1094
140 Ga0207644_10496616 3300025931 Bacteria 1006
141 Ga0207690_10012886 3300025932 Bacteria 5010
142 Ga0207690_10552016 3300025932 Bacteria 937
143 Ga0207706_10017301 3300025933 Bacteria 6495
144 Ga0207709_10001818 3300025935 Bacteria 14238
145 Ga0207709_10094780 3300025935 Bacteria 1960
146 Ga0207709_10135236 3300025935 Bacteria 1686
147 Ga0207709_10366538 3300025935 Bacteria 1092
148 Ga0207691_10000181 3300025940 Bacteria 59607
149 Ga0207691_10052192 3300025940 Bacteria 3735
150 Ga0207689_10154879 3300025942 Bacteria 1889
151 Ga0207679_10154417 3300025945 Bacteria 1872
152 Ga0207679_10165206 3300025945 Bacteria 1816
153 Ga0207651_10049182 3300025960 Bacteria 2855
154 Ga0207658_10086556 3300025986 Bacteria 2417
155 Ga0207677_10565663 3300026023 Bacteria 993
156 Ga0207703_10048610 3300026035 Bacteria 3425
157 Ga0207639_10108580 3300026041 Bacteria 2256
158 Ga0207678_10065319 3300026067 Bacteria 3125
159 Ga0207678_10573241 3300026067 Bacteria 988
160 Ga0207641_10401318 3300026088 Bacteria 1316
161 Ga0207676_10024137 3300026095 Bacteria 4497
162 Ga0207674_10001609 3300026116 Bacteria 29068
163 Ga0207674_10005481 3300026116 Bacteria 15072
164 Ga0207674_10103166 3300026116 Bacteria 2831
165 Ga0207683_10142972 3300026121 Bacteria 2156
166 Ga0207698_10062873 3300026142 Bacteria 2902
167 Ga0207698_10199678 3300026142 Bacteria 1789
168 Ga0209281_1000810 3300027111 Bacteria 28512
169 Ga0209281_1001108 3300027111 Bacteria 19578
170 Ga0209281_1001133 3300027111 Bacteria 18956
171 Ga0209281_1002029 3300027111 Bacteria 9180
172 Ga0209281_1002433 3300027111 Bacteria 7485
173 Ga0209281_1002890 3300027111 Bacteria 6222
174 Ga0209371_1000680 3300027312 Bacteria 29361
175 Ga0209371_1001516 3300027312 Bacteria 15400
176 Ga0209371_1001940 3300027312 Bacteria 12594
177 Ga0209371_1003483 3300027312 Bacteria 7606
178 Ga0209371_1003549 3300027312 Bacteria 7483
179 Ga0209371_1003976 3300027312 Bacteria 6750
180 Ga0209371_1007706 3300027312 Bacteria 3701
181 Ga0209995_1018109 3300027471 Bacteria 1160
182 Ga0209813_10056056 3300027866 Bacteria 1246
183 Ga0268266_10002020 3300028379 Bacteria 22619
184 Ga0268264_10188592 3300028381 Bacteria 1878
185 Ga0265336_10000014 3300028666 Bacteria 241247
186 Ga0307517_10156978 3300028786 Bacteria 1540
187 Ga0307515_10003269 3300028794 Bacteria 34269
188 Ga0265324_10000660 3300029957 Bacteria 23270
189 Ga0268256_1000584 3300030500 Bacteria 29264
190 Ga0268256_1000715 3300030500 Bacteria 24647
191 Ga0268256_1001346 3300030500 Bacteria 15031
192 Ga0268256_1001690 3300030500 Bacteria 12594
193 Ga0268256_1002733 3300030500 Bacteria 8625
194 Ga0268256_1003129 3300030500 Bacteria 7712
195 Ga0268256_1004085 3300030500 Bacteria 6241
196 Ga0268256_1007042 3300030500 Bacteria 4079
197 Ga0307513_10041429 3300031456 Bacteria 5083
198 Ga0307513_10243330 3300031456 Bacteria 1602
199 Ga0307408_100000088 3300031548 Bacteria 101418
200 Ga0307408_100000485 3300031548 Bacteria 34745
201 Ga0316576_10492759 3300031727 Bacteria 902
202 Ga0307516_10000092 3300031730 Bacteria 100931
203 Ga0307516_10098632 3300031730 Bacteria 2740
204 Ga0307516_10222685 3300031730 Bacteria 1595
205 Ga0307406_10003321 3300031901 Bacteria 8773
206 Ga0307406_10066029 3300031901 Bacteria 2353
207 Ga0307414_10045073 3300032004 Bacteria 3017
208 Ga0316583_10013952 3300032133 Bacteria 2898
209 Ga0316593_10049140 3300032168 Bacteria 1421
210 Ga0316574_0086389 3300035398 Bacteria 1996
211 Ga0316574_0247604 3300035398 Bacteria 1139
212 Ga0316582_0251721 3300036647 Bacteria 1211
213 Ga0395900_0000050 3300037418 Bacteria 224616
214 Ga0395905_0048845 3300037471 Bacteria 3964
215 Ga0436365_0628801 3300039437 Bacteria 37043
216 Ga0436361_0208692 3300039447 Bacteria 43307
217 Ga0439438_004284 3300041405 Bacteria 5530
218 Ga0451841_1359822 3300041498 Bacteria 1798
219 Ga0451845_0483588 3300041501 Bacteria 1096
220 Ga0451853_1782401 3300041512 Bacteria 3716
221 Ga0439433_0026490 3300041999 Bacteria 1312
222 Ga0439445_0059313 3300042004 Bacteria 1044
223 Ga0439432_013156 3300042006 Bacteria 2817
224 Ga0439432_073552 3300042006 Bacteria 1040
225 Ga0439450_054998 3300042008 Bacteria 952
226 Ga0439452_000637 3300042010 Bacteria 17667
227 Ga0439452_001200 3300042010 Bacteria 11132
228 Ga0439452_002142 3300042010 Bacteria 7459
229 Ga0439455_0025845 3300042012 Bacteria 1430
230 Ga0439456_000060 3300042013 Bacteria 39159
231 Ga0439457_007441 3300042014 Bacteria 2627
232 Ga0450911_003156 3300042115 Bacteria 2978
233 Ga0450894_005340 3300042131 Bacteria 1664
234 Ga0450899_013880 3300042135 Bacteria 912
235 Ga0450902_004393 3300042137 Bacteria 2097
236 Ga0450905_017063 3300042142 Bacteria 1050
237 Ga0450905_025464 3300042142 Bacteria 891
238 Ga0439464_0000994 3300042439 Bacteria 6446
239 Ga0466972_0081261 3300044658 Bacteria 1543
240 Ga0466972_0176416 3300044658 Bacteria 1002
241 Ga0466981_0000054 3300044669 Bacteria 29349
242 Ga0466965_0006943 3300044683 Bacteria 5180
243 Ga0466965_0011241 3300044683 Bacteria 4191
244 Ga0466965_0022230 3300044683 Bacteria 3058
245 Ga0466966_0005368 3300044684 Bacteria 8426
246 Ga0466966_0026632 3300044684 Bacteria 3775
247 Ga0466961_0002099 3300044693 Bacteria 12406
248 Ga0466961_0009714 3300044693 Bacteria 6123
249 Ga0466971_0008018 3300044719 Bacteria 4604
250 Ga0466968_0046570 3300044735 Bacteria 1842
251 Ga0466957_0008277 3300044842 Bacteria 5912
252 Ga0466957_0013347 3300044842 Bacteria 4766
253 Ga0466960_0127667 3300044901 Bacteria 1338
254 Ga0466959_0000027 3300045049 Bacteria 114262
255 Ga0466959_0036173 3300045049 Bacteria 3648
256 Ga0466967_0085455 3300045976 Bacteria 2857
257 Ga0466967_0124597 3300045976 Bacteria 2385
258 Ga0495603_0036709 3300046455 Bacteria 2942
259 Ga0495590_0032224 3300046457 Bacteria 1833
260 Ga0495591_005641 3300046458 Bacteria 5737
261 Ga0495629_0230817 3300046459 Bacteria 1276
262 Ga0495650_0000257 3300046471 Bacteria 102881
263 Ga0495650_0000892 3300046471 Bacteria 35189
264 Ga0495650_0001118 3300046471 Bacteria 29311
265 Ga0495650_0012753 3300046471 Bacteria 4499
266 Ga0495650_0018332 3300046471 Bacteria 3480
267 Ga0495650_0019513 3300046471 Bacteria 3333
268 Ga0495650_0069140 3300046471 Bacteria 1391
269 Ga0495607_0011710 3300046501 Bacteria 5821
270 Ga0495583_0000258 3300046506 Bacteria 87863
271 Ga0495606_0003186 3300046507 Bacteria 17688
272 Ga0495606_0009822 3300046507 Bacteria 8038
273 Ga0495606_0146234 3300046507 Bacteria 1391
274 Ga0495616_0103579 3300046513 Bacteria 1331
275 Ga0495631_0051036 3300046518 Bacteria 1808
276 Ga0495632_0007576 3300046519 Bacteria 6797
277 Ga0495632_0029469 3300046519 Bacteria 2857
278 Ga0495637_0034658 3300046520 Bacteria 2209
279 Ga0495637_0091008 3300046520 Bacteria 1203
280 Ga0495643_0287387 3300046522 Bacteria 754
281 Ga0495644_0070678 3300046523 Bacteria 1311
282 Ga0495648_0003515 3300046524 Bacteria 13738
283 Ga0495642_0056045 3300046528 Bacteria 1627
284 Ga0495654_0000419 3300046530 Bacteria 36153
285 Ga0495654_0010149 3300046530 Bacteria 5134
286 Ga0495654_0106040 3300046530 Bacteria 1287
287 Ga0495654_0202086 3300046530 Bacteria 850
288 Ga0495597_0000561 3300046542 Bacteria 30821
289 Ga0495597_0015543 3300046542 Bacteria 3603
290 Ga0495633_0001315 3300046558 Bacteria 19614
291 Ga0495656_0021429 3300046615 Bacteria 2516
292 Ga0495668_0168737 3300046616 Bacteria 1199
293 Ga0495668_0218250 3300046616 Bacteria 1044
294 Ga0495611_0056182 3300046648 Bacteria 1782
295 Ga0495625_0007702 3300046660 Bacteria 9321
296 Ga0495625_0013153 3300046660 Bacteria 6667
297 Ga0495671_0009868 3300046692 Bacteria 5311
298 Ga0495671_0048951 3300046692 Bacteria 2107
299 Ga0495649_0002240 3300046694 Bacteria 13750
300 Ga0495649_0012881 3300046694 Bacteria 4845
301 Ga0495649_0031457 3300046694 Bacteria 2926
302 Ga0495649_0075721 3300046694 Bacteria 1802
303 Ga0495589_0003351 3300046794 Bacteria 8691
304 Ga0495660_0000413 3300046810 Bacteria 36358
305 Ga0495660_0029232 3300046810 Bacteria 3111
306 Ga0495672_0000679 3300047320 Bacteria 37907
307 Ga0495672_0000719 3300047320 Bacteria 36413
308 Ga0495683_0007298 3300047323 Bacteria 5993
309 Ga0495683_0011121 3300047323 Bacteria 4743
310 Ga0495687_000350 3300047443 Bacteria 59063
311 Ga0495687_006352 3300047443 Bacteria 7265
312 Ga0495679_000943 3300047446 Bacteria 18100
313 Ga0495673_0000581 3300047469 Bacteria 36788
314 Ga0495615_0011568 3300048090 Bacteria 1797
315 Ga0495626_0039848 3300048091 Bacteria 2221
316 Ga0495626_0048842 3300048091 Bacteria 1962
317 Ga0496100_0038888 3300048903 Bacteria 3017
318 Ga0496101_0105352 3300048904 Bacteria 2116
319 Ga0496104_0000670 3300048907 Bacteria 29396
320 Ga0496104_0150722 3300048907 Bacteria 2232
321 Ga0496105_0006011 3300048908 Bacteria 9272
322 Ga0496105_0227785 3300048908 Bacteria 1515
323 Ga0496108_0489536 3300048911 Bacteria 1074
324 Ga0496113_0221124 3300048916 Bacteria 1509
325 Ga0496114_0146122 3300048917 Bacteria 2050
326 Ga0496116_0004818 3300048919 Bacteria 12731
327 Ga0496116_0008163 3300048919 Bacteria 9136
328 Ga0496117_0007967 3300048920 Bacteria 10175
329 Ga0496117_0009327 3300048920 Bacteria 9150
330 Ga0496117_0023448 3300048920 Bacteria 4917
331 Ga0496117_0089060 3300048920 Bacteria 1994
332 Ga0496118_0007359 3300048921 Bacteria 11700
333 Ga0496118_0018747 3300048921 Bacteria 6218
334 Ga0496118_0088901 3300048921 Bacteria 2134
335 Ga0496119_0003567 3300048922 Bacteria 16060
336 Ga0496119_0005284 3300048922 Bacteria 12438
337 Ga0496119_0011941 3300048922 Bacteria 7119
338 Ga0496119_0067955 3300048922 Bacteria 2099
339 Ga0496120_0003748 3300048923 Bacteria 13469
340 Ga0496120_0005507 3300048923 Bacteria 10078
341 Ga0496120_0008688 3300048923 Bacteria 7320
342 Ga0496120_0008824 3300048923 Bacteria 7239
343 Ga0496120_0011164 3300048923 Bacteria 6200
344 Ga0496120_0021388 3300048923 Bacteria 4089
345 Ga0496121_0004503 3300048924 Bacteria 18670
346 Ga0496121_0007561 3300048924 Bacteria 13096
347 Ga0496121_0008041 3300048924 Bacteria 12572
348 Ga0496121_0013305 3300048924 Bacteria 8857
349 Ga0496121_0016340 3300048924 Bacteria 7669
350 Ga0496121_0016431 3300048924 Bacteria 7645
351 Ga0496121_0097078 3300048924 Bacteria 2284
352 Ga0496122_0003283 3300048925 Bacteria 21433
353 Ga0496122_0006366 3300048925 Bacteria 13580
354 Ga0496122_0018024 3300048925 Bacteria 6547
355 Ga0496122_0102175 3300048925 Bacteria 1912
356 Ga0496122_0183706 3300048925 Bacteria 1243
357 Ga0496123_0003964 3300048926 Bacteria 16038
358 Ga0496123_0010141 3300048926 Bacteria 8369
359 Ga0496123_0014440 3300048926 Bacteria 6548
360 Ga0496123_0038298 3300048926 Bacteria 3372
361 Ga0496123_0039848 3300048926 Bacteria 3280
362 Ga0496123_0061385 3300048926 Bacteria 2415
363 Ga0496123_0082504 3300048926 Bacteria 1948
364 Ga0496123_0086183 3300048926 Bacteria 1885
365 Ga0496124_0004264 3300048927 Bacteria 16823
366 Ga0496124_0010381 3300048927 Bacteria 9437
367 Ga0496124_0017472 3300048927 Bacteria 6758
368 Ga0496124_0334680 3300048927 Bacteria 1078
369 Ga0496125_0004908 3300048928 Bacteria 15141
370 Ga0496125_0006891 3300048928 Bacteria 12165
371 Ga0496125_0009223 3300048928 Bacteria 10192
372 Ga0496125_0011398 3300048928 Bacteria 8895
373 Ga0496125_0017502 3300048928 Bacteria 6828
374 Ga0496125_0026593 3300048928 Bacteria 5267
375 Ga0496125_0051976 3300048928 Bacteria 3373
376 Ga0496125_0057595 3300048928 Bacteria 3145
377 Ga0496125_0211042 3300048928 Bacteria 1261
378 Ga0496126_0003021 3300048929 Bacteria 21809
379 Ga0496126_0009584 3300048929 Bacteria 10270
380 Ga0496126_0630094 3300048929 Bacteria 841
381 Ga0495678_002108 3300049459 Bacteria 14114
382 Ga0495678_068974 3300049459 Bacteria 1302
383 Ga0495682_0000831 3300049460 Bacteria 19326
384 Ga0501034_0182506 3300049571 Bacteria 2063
385 nmdc:mga03683_126184_c1 3300050489 Bacteria 1142
386 nmdc:mga03683_26655_c1 3300050489 Bacteria 2282
387 nmdc:mga00v17_169344_c1 3300050491 Bacteria 1408
388 nmdc:mga00v17_52304_c1 3300050491 Bacteria 2485
389 nmdc:mga0k408_10093_c1 3300050493 Bacteria 5101
390 nmdc:mga0k408_118714_c1 3300050493 Bacteria 1566
391 nmdc:mga0k408_185222_c1 3300050493 Bacteria 1242
392 nmdc:mga0k408_28725_c1 3300050493 Bacteria 3163
393 nmdc:mga0k408_55476_c1 3300050493 Bacteria 2298
394 nmdc:mga0k408_57109_c1 3300050493 Bacteria 2266
395 nmdc:mga0k408_6083_c1 3300050493 Bacteria 6430
396 nmdc:mga0k408_7140_c1 3300050493 Bacteria 5968
397 nmdc:mga0k408_8856_c1 3300050493 Bacteria 5415
398 nmdc:mga06z11_152279_c1 3300050494 Bacteria 1316
399 nmdc:mga06z11_24779_c1 3300050494 Bacteria 2835
400 nmdc:mga06z11_7765_c1 3300050494 Bacteria 4433
401 nmdc:mga04h51_61759_c1 3300050495 Bacteria 1286
402 nmdc:mga07m45_110668_c1 3300050496 Bacteria 1582
403 nmdc:mga07m45_14259_c1 3300050496 Bacteria 4230
404 nmdc:mga07m45_1883_c1 3300050496 Bacteria 9690
405 nmdc:mga07m45_7501_c2 3300050496 Bacteria 4192
406 nmdc:mga0sz30_71234_c1 3300050516 Bacteria 1497
407 Ga0500651_0096261 3300053093 Bacteria 1819
408 Ga0500621_000030 3300053126 Bacteria 36497
409 Ga0500658_0007154 3300053134 Bacteria 4126
410 Ga0500616_0015287 3300053153 Bacteria 4393

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0287387 Ga0495643_0287387_30_671 195
2 3300041501 Ga0451845_0483588 Ga0451845_0483588_426_1073 198
3 3300005344 Ga0070661_100127269 Ga0070661_1001272692 204
4 3300005547 Ga0070693_100051953 Ga0070693_1000519532 207
5 3300005329 Ga0070683_100109513 Ga0070683_1001095133 211
6 3300021361 Ga0213872_10000036 Ga0213872_1000003648 214
7 3300039447 Ga0436361_0208692 Ga0436361_0208692_26469_27242 214
8 3300005340 Ga0070689_100157364 Ga0070689_1001573641 215
9 3300005343 Ga0070687_100039292 Ga0070687_1000392922 215
10 3300005466 Ga0070685_10397257 Ga0070685_103972571 215
11 3300005543 Ga0070672_100093630 Ga0070672_1000936301 215
12 3300005616 Ga0068852_100031859 Ga0068852_1000318595 215
13 3300005842 Ga0068858_100034619 Ga0068858_1000346193 215
14 3300005843 Ga0068860_100013086 Ga0068860_1000130862 215
15 3300013308 Ga0157375_10015344 Ga0157375_100153448 215
16 3300014326 Ga0157380_10218076 Ga0157380_102180762 215
17 3300014968 Ga0157379_10024095 Ga0157379_100240953 215
18 3300025918 Ga0207662_10056900 Ga0207662_100569002 215
19 3300025940 Ga0207691_10052192 Ga0207691_100521922 215
20 3300026035 Ga0207703_10048610 Ga0207703_100486102 215
21 3300031727 Ga0316576_10492759 Ga0316576_104927592 215
22 3300035398 Ga0316574_0086389 Ga0316574_0086389_954_1712 215
23 3300045976 Ga0466967_0085455 Ga0466967_0085455_1654_2439 215
24 3300048090 Ga0495615_0011568 Ga0495615_0011568_974_1729 216
25 3300005364 Ga0070673_100157902 Ga0070673_1001579022 218
26 3300005456 Ga0070678_100312841 Ga0070678_1003128412 218
27 3300005564 Ga0070664_100129319 Ga0070664_1001293192 218
28 3300025908 Ga0207643_10251567 Ga0207643_102515671 218
29 3300025931 Ga0207644_10420932 Ga0207644_104209322 218
30 3300025932 Ga0207690_10552016 Ga0207690_105520161 218
31 3300025945 Ga0207679_10165206 Ga0207679_101652062 218
32 3300026067 Ga0207678_10065319 Ga0207678_100653193 218
33 3300026121 Ga0207683_10142972 Ga0207683_101429722 218
34 3300042008 Ga0439450_054998 Ga0439450_054998_51_833 218
35 3300042012 Ga0439455_0025845 Ga0439455_0025845_533_1303 218
36 3300048917 Ga0496114_0146122 Ga0496114_0146122_184_936 218
37 3300046615 Ga0495656_0021429 Ga0495656_0021429_734_1489 219
38 3300041512 Ga0451853_1782401 Ga0451853_1782401_1822_2592 221
39 3300005355 Ga0070671_100205470 Ga0070671_1002054702 222
40 3300005841 Ga0068863_100138347 Ga0068863_1001383472 222
41 3300006237 Ga0097621_100005385 Ga0097621_1000053855 222
42 3300013308 Ga0157375_10010965 Ga0157375_100109655 222
43 3300025926 Ga0207659_10013036 Ga0207659_100130363 222
44 3300025931 Ga0207644_10496616 Ga0207644_104966162 222
45 3300026023 Ga0207677_10565663 Ga0207677_105656631 222
46 3300026095 Ga0207676_10024137 Ga0207676_100241373 222
47 3300044684 Ga0466966_0005368 Ga0466966_0005368_3701_4450 222
48 3300044693 Ga0466961_0002099 Ga0466961_0002099_628_1377 222
49 3300044842 Ga0466957_0013347 Ga0466957_0013347_1073_1822 222
50 3300045049 Ga0466959_0000027 Ga0466959_0000027_113493_114242 222
51 3300045976 Ga0466967_0124597 Ga0466967_0124597_1280_2029 222
52 3300044735 Ga0466968_0046570 Ga0466968_0046570_829_1584 223
53 3300005331 Ga0070670_100184500 Ga0070670_1001845002 224
54 3300028794 Ga0307515_10003269 Ga0307515_1000326914 224
55 3300042010 Ga0439452_002142 Ga0439452_002142_959_1708 224
56 3300042013 Ga0439456_000060 Ga0439456_000060_29026_29781 224
57 3300046506 Ga0495583_0000258 Ga0495583_0000258_21497_22264 225
58 3300046507 Ga0495606_0009822 Ga0495606_0009822_3138_3905 225
59 3300046616 Ga0495668_0168737 Ga0495668_0168737_334_1101 225
60 3300046694 Ga0495649_0002240 Ga0495649_0002240_9453_10220 225
61 3300053093 Ga0500651_0096261 Ga0500651_0096261_1028_1795 225
62 3300028666 Ga0265336_10000014 Ga0265336_10000014131 226
63 3300029957 Ga0265324_10000660 Ga0265324_100006603 226
64 3300032004 Ga0307414_10045073 Ga0307414_100450732 226
65 3300046471 Ga0495650_0018332 Ga0495650_0018332_2522_3277 226
66 3300046519 Ga0495632_0029469 Ga0495632_0029469_946_1701 226
67 3300046692 Ga0495671_0009868 Ga0495671_0009868_2626_3381 226
68 3300005331 Ga0070670_100048895 Ga0070670_1000488953 227
69 3300005354 Ga0070675_100007369 Ga0070675_1000073696 227
70 3300005543 Ga0070672_100009485 Ga0070672_1000094855 227
71 3300013296 Ga0157374_10073635 Ga0157374_100736354 227
72 3300014969 Ga0157376_10055136 Ga0157376_100551365 227
73 3300025925 Ga0207650_10044961 Ga0207650_100449612 227
74 3300025940 Ga0207691_10000181 Ga0207691_1000018154 227
75 3300025960 Ga0207651_10049182 Ga0207651_100491822 227
76 3300026088 Ga0207641_10401318 Ga0207641_104013182 227
77 3300044658 Ga0466972_0081261 Ga0466972_0081261_753_1523 228
78 3300046455 Ga0495603_0036709 Ga0495603_0036709_969_1724 228
79 iso_pu_bacteria 2738541276 2738713453 229
80 3300003323 rootH1_10002305 rootH1_100023058 230
81 3300027471 Ga0209995_1018109 Ga0209995_10181092 230
82 3300046471 Ga0495650_0019513 Ga0495650_0019513_2407_3150 230
83 iso_pu_bacteria 2919046199 2919050710 230
84 3300037471 Ga0395905_0048845 Ga0395905_0048845_535_1290 231
85 3300041405 Ga0439438_004284 Ga0439438_004284_3425_4180 231
86 3300042137 Ga0450902_004393 Ga0450902_004393_327_1082 231
87 3300042142 Ga0450905_017063 Ga0450905_017063_100_855 231
88 3300046694 Ga0495649_0031457 Ga0495649_0031457_1011_1772 231
89 3300048903 Ga0496100_0038888 Ga0496100_0038888_1290_2045 231
90 3300005289 Ga0065704_10080163 Ga0065704_100801636 232
91 3300005577 Ga0068857_100000461 Ga0068857_10000046117 232
92 3300006946 Ga0079104_1001129 Ga0079104_10011299 232
93 3300006946 Ga0079104_1004692 Ga0079104_10046923 232
94 3300009148 Ga0105243_10035031 Ga0105243_100350314 232
95 3300013102 Ga0157371_10047832 Ga0157371_100478322 232
96 3300013307 Ga0157372_10007007 Ga0157372_1000700711 232
97 3300015679 Ga0183366_1010 Ga0183366_101016 232
98 3300015680 Ga0183370_1010 Ga0183370_101016 232
99 3300015685 Ga0183369_1025 Ga0183369_102516 232
100 3300015687 Ga0183368_1013 Ga0183368_101316 232
101 3300021384 Ga0213876_10000387 Ga0213876_1000038720 232
102 3300025711 Ga0207696_1016324 Ga0207696_10163243 232
103 3300025935 Ga0207709_10094780 Ga0207709_100947802 232
104 3300026116 Ga0207674_10001609 Ga0207674_1000160916 232
105 3300026142 Ga0207698_10199678 Ga0207698_101996782 232
106 3300027111 Ga0209281_1001133 Ga0209281_10011339 232
107 3300027111 Ga0209281_1002433 Ga0209281_10024338 232
108 3300027312 Ga0209371_1000680 Ga0209371_100068016 232
109 3300027312 Ga0209371_1003976 Ga0209371_10039766 232
110 3300030500 Ga0268256_1000584 Ga0268256_100058416 232
111 3300030500 Ga0268256_1003129 Ga0268256_10031296 232
112 3300039437 Ga0436365_0628801 Ga0436365_0628801_14543_15301 232
113 3300042004 Ga0439445_0059313 Ga0439445_0059313_232_981 232
114 3300042115 Ga0450911_003156 Ga0450911_003156_904_1653 232
115 3300044683 Ga0466965_0011241 Ga0466965_0011241_2762_3511 232
116 3300046458 Ga0495591_005641 Ga0495591_005641_2314_3075 232
117 3300046471 Ga0495650_0000892 Ga0495650_0000892_22010_22771 232
118 3300046501 Ga0495607_0011710 Ga0495607_0011710_992_1753 232
119 3300046507 Ga0495606_0003186 Ga0495606_0003186_4528_5289 232
120 3300046520 Ga0495637_0034658 Ga0495637_0034658_368_1129 232
121 3300046523 Ga0495644_0070678 Ga0495644_0070678_217_978 232
122 3300046524 Ga0495648_0003515 Ga0495648_0003515_4837_5598 232
123 3300046530 Ga0495654_0000419 Ga0495654_0000419_12267_13028 232
124 3300046648 Ga0495611_0056182 Ga0495611_0056182_155_916 232
125 3300046692 Ga0495671_0048951 Ga0495671_0048951_609_1370 232
126 3300046794 Ga0495589_0003351 Ga0495589_0003351_6968_7729 232
127 3300046810 Ga0495660_0000413 Ga0495660_0000413_23116_23877 232
128 3300047320 Ga0495672_0000719 Ga0495672_0000719_23167_23928 232
129 3300047323 Ga0495683_0011121 Ga0495683_0011121_768_1529 232
130 3300047469 Ga0495673_0000581 Ga0495673_0000581_23546_24307 232
131 3300048907 Ga0496104_0000670 Ga0496104_0000670_11217_11972 232
132 3300048908 Ga0496105_0006011 Ga0496105_0006011_2802_3557 232
133 3300048911 Ga0496108_0489536 Ga0496108_0489536_108_857 232
134 3300048916 Ga0496113_0221124 Ga0496113_0221124_84_839 232
135 3300048919 Ga0496116_0008163 Ga0496116_0008163_5555_6310 232
136 3300048920 Ga0496117_0023448 Ga0496117_0023448_2552_3307 232
137 3300048921 Ga0496118_0088901 Ga0496118_0088901_341_1096 232
138 3300048922 Ga0496119_0011941 Ga0496119_0011941_5401_6156 232
139 3300048922 Ga0496119_0067955 Ga0496119_0067955_1036_1791 232
140 3300048923 Ga0496120_0003748 Ga0496120_0003748_4134_4889 232
141 3300048923 Ga0496120_0008688 Ga0496120_0008688_2387_3142 232
142 3300048923 Ga0496120_0021388 Ga0496120_0021388_948_1703 232
143 3300048924 Ga0496121_0008041 Ga0496121_0008041_5137_5892 232
144 3300048924 Ga0496121_0013305 Ga0496121_0013305_1151_1933 232
145 3300048924 Ga0496121_0097078 Ga0496121_0097078_395_1150 232
146 3300048925 Ga0496122_0003283 Ga0496122_0003283_10604_11362 232
147 3300048925 Ga0496122_0183706 Ga0496122_0183706_194_949 232
148 3300048926 Ga0496123_0003964 Ga0496123_0003964_11851_12609 232
149 3300048926 Ga0496123_0039848 Ga0496123_0039848_1008_1763 232
150 3300048926 Ga0496123_0061385 Ga0496123_0061385_1001_1756 232
151 3300048926 Ga0496123_0082504 Ga0496123_0082504_1014_1769 232
152 3300048927 Ga0496124_0017472 Ga0496124_0017472_1666_2421 232
153 3300048927 Ga0496124_0334680 Ga0496124_0334680_239_997 232
154 3300048928 Ga0496125_0004908 Ga0496125_0004908_13431_14180 232
155 3300048928 Ga0496125_0006891 Ga0496125_0006891_866_1615 232
156 3300048928 Ga0496125_0026593 Ga0496125_0026593_1039_1794 232
157 3300048928 Ga0496125_0051976 Ga0496125_0051976_169_924 232
158 3300048928 Ga0496125_0057595 Ga0496125_0057595_1879_2634 232
159 3300048928 Ga0496125_0211042 Ga0496125_0211042_301_1059 232
160 3300049459 Ga0495678_002108 Ga0495678_002108_1195_1956 232
161 3300049460 Ga0495682_0000831 Ga0495682_0000831_1202_1963 232
162 3300050493 nmdc:mga0k408_7140_c1 nmdc:mga0k408_7140_c1_3635_4456 232
163 3300053126 Ga0500621_000030 Ga0500621_000030_23181_23942 232
164 3300009011 Ga0105251_10061958 Ga0105251_100619582 233
165 3300009036 Ga0105244_10001577 Ga0105244_100015779 233
166 3300009036 Ga0105244_10005711 Ga0105244_100057114 233
167 3300025728 Ga0207655_1001654 Ga0207655_10016549 233
168 3300025728 Ga0207655_1001837 Ga0207655_10018379 233
169 3300025728 Ga0207655_1005010 Ga0207655_10050105 233
170 3300027111 Ga0209281_1002890 Ga0209281_10028905 233
171 3300031548 Ga0307408_100000088 Ga0307408_10000008813 233
172 3300031548 Ga0307408_100000485 Ga0307408_10000048514 233
173 3300031901 Ga0307406_10003321 Ga0307406_100033216 233
174 3300031901 Ga0307406_10066029 Ga0307406_100660293 233
175 3300032168 Ga0316593_10049140 Ga0316593_100491402 233
176 3300042006 Ga0439432_073552 Ga0439432_073552_75_830 233
177 3300042142 Ga0450905_025464 Ga0450905_025464_31_783 233
178 3300046471 Ga0495650_0000257 Ga0495650_0000257_88696_89460 233
179 3300046471 Ga0495650_0069140 Ga0495650_0069140_611_1375 233
180 3300046507 Ga0495606_0146234 Ga0495606_0146234_146_898 233
181 3300046520 Ga0495637_0091008 Ga0495637_0091008_289_1041 233
182 3300046528 Ga0495642_0056045 Ga0495642_0056045_221_973 233
183 3300047323 Ga0495683_0007298 Ga0495683_0007298_4595_5368 233
184 3300048928 Ga0496125_0017502 Ga0496125_0017502_1855_2607 233
185 3300049571 Ga0501034_0182506 Ga0501034_0182506_1009_1761 233
186 3300003322 rootL2_10054925 rootL2_100549256 234
187 3300005328 Ga0070676_10161647 Ga0070676_101616472 234
188 3300005445 Ga0070708_100046083 Ga0070708_1000460832 234
189 3300005467 Ga0070706_100002111 Ga0070706_10000211116 234
190 3300005468 Ga0070707_100012746 Ga0070707_1000127461 234
191 3300005518 Ga0070699_100023238 Ga0070699_1000232383 234
192 3300006178 Ga0075367_10007470 Ga0075367_100074702 234
193 3300006353 Ga0075370_10036219 Ga0075370_100362192 234
194 3300009036 Ga0105244_10003216 Ga0105244_100032169 234
195 3300025728 Ga0207655_1010114 Ga0207655_10101144 234
196 3300025909 Ga0207705_10164936 Ga0207705_101649362 234
197 3300025910 Ga0207684_10005448 Ga0207684_1000544811 234
198 3300025922 Ga0207646_10118291 Ga0207646_101182912 234
199 3300031456 Ga0307513_10041429 Ga0307513_100414293 234
200 3300041498 Ga0451841_1359822 Ga0451841_1359822_536_1303 234
201 3300041999 Ga0439433_0026490 Ga0439433_0026490_258_1013 234
202 3300042014 Ga0439457_007441 Ga0439457_007441_1161_1916 234
203 3300042131 Ga0450894_005340 Ga0450894_005340_19_774 234
204 3300042135 Ga0450899_013880 Ga0450899_013880_86_841 234
205 3300046660 Ga0495625_0007702 Ga0495625_0007702_6579_7334 234
206 3300048927 Ga0496124_0004264 Ga0496124_0004264_11155_11910 234
207 3300050493 nmdc:mga0k408_10093_c1 nmdc:mga0k408_10093_c1_1691_2446 234
208 3300050493 nmdc:mga0k408_118714_c1 nmdc:mga0k408_118714_c1_91_846 234
209 3300053153 Ga0500616_0015287 Ga0500616_0015287_1234_1989 234
210 3300005843 Ga0068860_100463071 Ga0068860_1004630711 235
211 3300006038 Ga0075365_10004102 Ga0075365_100041023 235
212 3300026041 Ga0207639_10108580 Ga0207639_101085803 235
213 3300028381 Ga0268264_10188592 Ga0268264_101885922 235
214 3300031730 Ga0307516_10222685 Ga0307516_102226852 235
215 3300032133 Ga0316583_10013952 Ga0316583_100139523 235
216 3300037418 Ga0395900_0000050 Ga0395900_0000050_192725_193549 235
217 3300048924 Ga0496121_0016431 Ga0496121_0016431_2650_3423 235
218 iso_pu_bacteria 2852103415 2852106415 235
219 3300044683 Ga0466965_0022230 Ga0466965_0022230_1309_2070 236
220 3300044684 Ga0466966_0026632 Ga0466966_0026632_378_1139 236
221 3300044693 Ga0466961_0009714 Ga0466961_0009714_300_1061 236
222 3300044719 Ga0466971_0008018 Ga0466971_0008018_2876_3637 236
223 3300044842 Ga0466957_0008277 Ga0466957_0008277_3580_4341 236
224 3300045049 Ga0466959_0036173 Ga0466959_0036173_1719_2480 236
225 3300053134 Ga0500658_0007154 Ga0500658_0007154_3340_4104 236
226 3300005334 Ga0068869_100022661 Ga0068869_1000226613 237
227 3300005338 Ga0068868_100357648 Ga0068868_1003576482 237
228 3300005367 Ga0070667_100168276 Ga0070667_1001682762 237
229 3300005455 Ga0070663_100527540 Ga0070663_1005275401 237
230 3300005459 Ga0068867_100149321 Ga0068867_1001493212 237
231 3300005577 Ga0068857_100178077 Ga0068857_1001780772 237
232 3300005577 Ga0068857_100247159 Ga0068857_1002471592 237
233 3300005578 Ga0068854_100225901 Ga0068854_1002259011 237
234 3300005616 Ga0068852_100056002 Ga0068852_1000560023 237
235 3300005617 Ga0068859_100258640 Ga0068859_1002586402 237
236 3300006042 Ga0075368_10010810 Ga0075368_100108102 237
237 3300006042 Ga0075368_10137341 Ga0075368_101373412 237
238 3300006051 Ga0075364_10053532 Ga0075364_100535322 237
239 3300006177 Ga0075362_10092597 Ga0075362_100925972 237
240 3300006177 Ga0075362_10128516 Ga0075362_101285162 237
241 3300006178 Ga0075367_10001243 Ga0075367_100012434 237
242 3300006178 Ga0075367_10105033 Ga0075367_101050332 237
243 3300006186 Ga0075369_10045054 Ga0075369_100450542 237
244 3300006195 Ga0075366_10008667 Ga0075366_100086672 237
245 3300006195 Ga0075366_10010369 Ga0075366_100103695 237
246 3300006195 Ga0075366_10221222 Ga0075366_102212222 237
247 3300006353 Ga0075370_10000260 Ga0075370_1000026012 237
248 3300006353 Ga0075370_10004894 Ga0075370_100048947 237
249 3300006353 Ga0075370_10006961 Ga0075370_100069615 237
250 3300006353 Ga0075370_10020922 Ga0075370_100209222 237
251 3300006931 Ga0097620_100258659 Ga0097620_1002586592 237
252 3300009093 Ga0105240_10018032 Ga0105240_100180328 237
253 3300009148 Ga0105243_10031699 Ga0105243_100316992 237
254 3300009148 Ga0105243_10276224 Ga0105243_102762242 237
255 3300009545 Ga0105237_10012763 Ga0105237_100127639 237
256 3300009553 Ga0105249_10751987 Ga0105249_107519871 237
257 3300010375 Ga0105239_10171427 Ga0105239_101714272 237
258 3300014968 Ga0157379_10819293 Ga0157379_108192931 237
259 3300015261 Ga0182006_1000574 Ga0182006_100057415 237
260 3300025303 Ga0209051_1003898 Ga0209051_10038985 237
261 3300025913 Ga0207695_10102041 Ga0207695_101020412 237
262 3300025914 Ga0207671_10035195 Ga0207671_100351953 237
263 3300025933 Ga0207706_10017301 Ga0207706_100173013 237
264 3300025935 Ga0207709_10135236 Ga0207709_101352362 237
265 3300025935 Ga0207709_10366538 Ga0207709_103665382 237
266 3300025942 Ga0207689_10154879 Ga0207689_101548792 237
267 3300025945 Ga0207679_10154417 Ga0207679_101544173 237
268 3300025986 Ga0207658_10086556 Ga0207658_100865563 237
269 3300026067 Ga0207678_10573241 Ga0207678_105732411 237
270 3300026116 Ga0207674_10005481 Ga0207674_1000548112 237
271 3300026116 Ga0207674_10103166 Ga0207674_101031662 237
272 3300026142 Ga0207698_10062873 Ga0207698_100628732 237
273 3300027866 Ga0209813_10056056 Ga0209813_100560562 237
274 3300028786 Ga0307517_10156978 Ga0307517_101569782 237
275 3300031456 Ga0307513_10243330 Ga0307513_102433302 237
276 3300031730 Ga0307516_10000092 Ga0307516_1000009292 237
277 3300031730 Ga0307516_10098632 Ga0307516_100986322 237
278 3300035398 Ga0316574_0247604 Ga0316574_0247604_49_822 237
279 3300036647 Ga0316582_0251721 Ga0316582_0251721_141_911 237
280 3300044658 Ga0466972_0176416 Ga0466972_0176416_156_920 237
281 3300044683 Ga0466965_0006943 Ga0466965_0006943_1967_2731 237
282 3300044901 Ga0466960_0127667 Ga0466960_0127667_394_1158 237
283 3300046457 Ga0495590_0032224 Ga0495590_0032224_519_1286 237
284 3300046459 Ga0495629_0230817 Ga0495629_0230817_175_966 237
285 3300046513 Ga0495616_0103579 Ga0495616_0103579_276_1043 237
286 3300046518 Ga0495631_0051036 Ga0495631_0051036_863_1630 237
287 3300046519 Ga0495632_0007576 Ga0495632_0007576_2370_3137 237
288 3300046530 Ga0495654_0202086 Ga0495654_0202086_44_811 237
289 3300046542 Ga0495597_0015543 Ga0495597_0015543_1442_2209 237
290 3300046558 Ga0495633_0001315 Ga0495633_0001315_11680_12450 237
291 3300046616 Ga0495668_0218250 Ga0495668_0218250_53_820 237
292 3300046660 Ga0495625_0013153 Ga0495625_0013153_4994_5761 237
293 3300046694 Ga0495649_0012881 Ga0495649_0012881_807_1574 237
294 3300046810 Ga0495660_0029232 Ga0495660_0029232_1760_2527 237
295 3300047443 Ga0495687_000350 Ga0495687_000350_50570_51337 237
296 3300047443 Ga0495687_006352 Ga0495687_006352_3270_4037 237
297 3300048091 Ga0495626_0039848 Ga0495626_0039848_345_1112 237
298 3300048091 Ga0495626_0048842 Ga0495626_0048842_645_1412 237
299 3300049459 Ga0495678_068974 Ga0495678_068974_198_965 237
300 3300050489 nmdc:mga03683_126184_c1 nmdc:mga03683_126184_c1_217_984 237
301 3300050489 nmdc:mga03683_26655_c1 nmdc:mga03683_26655_c1_975_1742 237
302 3300050491 nmdc:mga00v17_169344_c1 nmdc:mga00v17_169344_c1_149_916 237
303 3300050493 nmdc:mga0k408_185222_c1 nmdc:mga0k408_185222_c1_262_1029 237
304 3300050493 nmdc:mga0k408_28725_c1 nmdc:mga0k408_28725_c1_711_1478 237
305 3300050493 nmdc:mga0k408_55476_c1 nmdc:mga0k408_55476_c1_1382_2149 237
306 3300050493 nmdc:mga0k408_57109_c1 nmdc:mga0k408_57109_c1_228_995 237
307 3300050493 nmdc:mga0k408_6083_c1 nmdc:mga0k408_6083_c1_2306_3073 237
308 3300050493 nmdc:mga0k408_8856_c1 nmdc:mga0k408_8856_c1_1269_2036 237
309 3300050494 nmdc:mga06z11_152279_c1 nmdc:mga06z11_152279_c1_172_939 237
310 3300050494 nmdc:mga06z11_24779_c1 nmdc:mga06z11_24779_c1_771_1538 237
311 3300050494 nmdc:mga06z11_7765_c1 nmdc:mga06z11_7765_c1_2000_2767 237
312 3300050495 nmdc:mga04h51_61759_c1 nmdc:mga04h51_61759_c1_67_834 237
313 3300050496 nmdc:mga07m45_110668_c1 nmdc:mga07m45_110668_c1_634_1401 237
314 3300050496 nmdc:mga07m45_14259_c1 nmdc:mga07m45_14259_c1_625_1392 237
315 3300050496 nmdc:mga07m45_1883_c1 nmdc:mga07m45_1883_c1_1256_2023 237
316 3300050496 nmdc:mga07m45_7501_c2 nmdc:mga07m45_7501_c2_2126_2893 237
317 3300050516 nmdc:mga0sz30_71234_c1 nmdc:mga0sz30_71234_c1_713_1480 237
318 3300005366 Ga0070659_100021454 Ga0070659_1000214545 238
319 3300006946 Ga0079104_1001169 Ga0079104_100116913 238
320 3300009011 Ga0105251_10001341 Ga0105251_1000134113 238
321 3300009036 Ga0105244_10035945 Ga0105244_100359453 238
322 3300025932 Ga0207690_10012886 Ga0207690_100128863 238
323 3300027111 Ga0209281_1001108 Ga0209281_100110812 238
324 3300027312 Ga0209371_1007706 Ga0209371_10077063 238
325 3300030500 Ga0268256_1007042 Ga0268256_10070423 238
326 3300046530 Ga0495654_0010149 Ga0495654_0010149_453_1208 238
327 3300046530 Ga0495654_0106040 Ga0495654_0106040_351_1244 238
328 3300047320 Ga0495672_0000679 Ga0495672_0000679_10988_11743 238
329 3300047446 Ga0495679_000943 Ga0495679_000943_11200_11955 238
330 3300048928 Ga0496125_0011398 Ga0496125_0011398_4004_4759 238
331 3300048929 Ga0496126_0009584 Ga0496126_0009584_5313_6068 238
332 iso_pu_bacteria 2547132416 2548649777 238
333 iso_pu_bacteria 2554235234 2555262621 238
334 iso_pu_bacteria 2561511199 2562465436 238
335 iso_pu_bacteria 2599185169 2599413673 238
336 iso_pu_bacteria 2600255254 2601526338 238
337 iso_pu_bacteria 2600255255 2601531362 238
338 iso_pu_bacteria 2600255257 2601542049 238
339 iso_pu_bacteria 2600255280 2601618194 238
340 iso_pu_bacteria 2600255281 2601623229 238
341 iso_pu_bacteria 2600255287 2601646596 238
342 iso_pu_bacteria 2600255288 2601651609 238
343 iso_pu_bacteria 2600255289 2601656643 238
344 iso_pu_bacteria 2600255290 2601661649 238
345 iso_pu_bacteria 2600255291 2601666555 238
346 iso_pu_bacteria 2600255298 2601699517 238
347 iso_pu_bacteria 2600255299 2601704426 238
348 iso_pu_bacteria 2600255300 2601709451 238
349 iso_pu_bacteria 2600255301 2601714467 238
350 iso_pu_bacteria 2600255302 2601719499 238
351 iso_pu_bacteria 2600255303 2601724400 238
352 iso_pu_bacteria 2600255304 2601729421 238
353 iso_pu_bacteria 2600255305 2601734444 238
354 iso_pu_bacteria 2600255306 2601739432 238
355 iso_pu_bacteria 2600255307 2601744555 238
356 iso_pu_bacteria 2600255309 2601755086 238
357 iso_pu_bacteria 2600255310 2601760405 238
358 iso_pu_bacteria 2600255311 2601765810 238
359 iso_pu_bacteria 2600255392 2602022351 238
360 iso_pu_bacteria 2602042046 2603636443 238
361 iso_pu_bacteria 2602042047 2603641925 238
362 iso_pu_bacteria 2602042052 2603659245 238
363 iso_pu_bacteria 2602042053 2603664138 238
364 iso_pu_bacteria 2602042066 2603697968 238
365 iso_pu_bacteria 2602042067 2603702287 238
366 iso_pu_bacteria 2602042103 2603836794 238
367 iso_pu_bacteria 2602042104 2603841871 238
368 iso_pu_bacteria 2602042105 2603846944 238
369 iso_pu_bacteria 2602042106 2603852017 238
370 iso_pu_bacteria 2602042109 2603864960 238
371 iso_pu_bacteria 2602042110 2603869586 238
372 iso_pu_bacteria 2602042111 2603874764 238
373 iso_pu_bacteria 2603880178 2606046772 238
374 iso_pu_bacteria 2603880184 2606068568 238
375 iso_pu_bacteria 2603880202 2606144444 238
376 iso_pu_bacteria 2603880211 2606174661 238
377 iso_pu_bacteria 2609459761 2609914437 238
378 iso_pu_bacteria 2636415599 2637227656 238
379 iso_pu_bacteria 2667528172 2671105889 238
380 iso_pu_bacteria 2671180115 2671588992 238
381 iso_pu_bacteria 2675903046 2676410345 238
382 iso_pu_bacteria 2681812866 2681995264 238
383 iso_pu_bacteria 2681812869 2682010067 238
384 iso_pu_bacteria 2711768156 2712471531 238
385 iso_pu_bacteria 2751185917 2753854116 238
386 iso_pu_bacteria 2765235842 2765587011 238
387 iso_pu_bacteria 2775506706 2775542455 238
388 iso_pu_bacteria 2775507074 2777024511 238
389 iso_pu_bacteria 2791354903 2791923293 238
390 iso_pu_bacteria 2791355010 2792314835 238
391 iso_pu_bacteria 2791355275 2793407292 238
392 iso_pu_bacteria 2814123068 2814698814 238
393 iso_pu_bacteria 2821118458 2821122123 238
394 iso_pu_bacteria 2823373977 2823378603 238
395 iso_pu_bacteria 2844425489 2844425729 238
396 iso_pu_bacteria 2884086401 2884090964 238
397 iso_pu_bacteria 2891670763 2891674005 238
398 iso_pu_bacteria 2904513164 2904518472 238
399 iso_pu_bacteria 2919108558 2919114028 238
400 iso_pu_bacteria 2923634449 2923637497 238
401 iso_pu_bacteria 2927833300 2927836049 238
402 iso_pu_bacteria 2937539931 2937542023 238
403 iso_pu_bacteria 2939607340 2939611865 238
404 iso_pu_bacteria 2939617950 2939622486 238
405 iso_pu_bacteria 2945874760 2945874926 238
406 iso_pu_bacteria 2969079654 2969084696 238
407 iso_pu_bacteria 2971820967 2971826221 238
408 iso_pu_bacteria 2974310843 2974314114 238
409 iso_pu_bacteria 2984559226 2984561817 238
410 iso_pu_bacteria 2984595703 2984599883 238
411 iso_pu_bacteria 3000376612 3000380960 238
412 iso_pu_bacteria 8018221730 8018223531 238
413 iso_pu_bacteria 8018405270 8018406507 238
414 iso_pu_bacteria 8019504834 8019509376 238
415 iso_pu_bacteria 8054844752 8054846346 238
416 iso_pu_bacteria 8054849141 8054852256 238
417 iso_pu_bacteria 8055097453 8055097645 238
418 3300009036 Ga0105244_10001136 Ga0105244_1000113612 239
419 3300009036 Ga0105244_10004444 Ga0105244_100044448 239
420 3300009092 Ga0105250_10002762 Ga0105250_100027623 239
421 3300025711 Ga0207696_1000939 Ga0207696_100093913 239
422 3300025728 Ga0207655_1001092 Ga0207655_100109212 239
423 3300042006 Ga0439432_013156 Ga0439432_013156_850_1608 239
424 3300044669 Ga0466981_0000054 Ga0466981_0000054_17288_18043 239
425 3300046542 Ga0495597_0000561 Ga0495597_0000561_9677_10432 239
426 3300046694 Ga0495649_0075721 Ga0495649_0075721_109_867 239
427 3300009011 Ga0105251_10006220 Ga0105251_100062205 240
428 3300025728 Ga0207655_1010902 Ga0207655_10109023 240
429 3300025735 Ga0207713_1001473 Ga0207713_10014738 240
430 3300048904 Ga0496101_0105352 Ga0496101_0105352_409_1167 240
431 3300048920 Ga0496117_0007967 Ga0496117_0007967_8479_9234 240
432 3300048923 Ga0496120_0011164 Ga0496120_0011164_978_1733 240
433 3300048924 Ga0496121_0004503 Ga0496121_0004503_6817_7572 240
434 3300048926 Ga0496123_0038298 Ga0496123_0038298_1693_2448 240
435 2162886007 SwRhRL2b_contig_651300 SwRhRL2b_0565.00006380 242
436 3300003320 rootH2_10079260 rootH2_100792608 242
437 3300005289 Ga0065704_10000683 Ga0065704_100006838 242
438 3300005289 Ga0065704_10007790 Ga0065704_100077903 242
439 3300005548 Ga0070665_100003943 Ga0070665_1000039438 242
440 3300005834 Ga0068851_10000680 Ga0068851_100006807 242
441 3300006946 Ga0079104_1003743 Ga0079104_10037436 242
442 3300009011 Ga0105251_10003504 Ga0105251_100035049 242
443 3300009011 Ga0105251_10016393 Ga0105251_100163933 242
444 3300009011 Ga0105251_10054396 Ga0105251_100543962 242
445 3300009011 Ga0105251_10069938 Ga0105251_100699382 242
446 3300009036 Ga0105244_10002783 Ga0105244_100027836 242
447 3300009092 Ga0105250_10000725 Ga0105250_1000072513 242
448 3300009148 Ga0105243_10002571 Ga0105243_100025716 242
449 3300013102 Ga0157371_10113428 Ga0157371_101134282 242
450 3300013104 Ga0157370_10010496 Ga0157370_100104968 242
451 3300017792 Ga0163161_10099170 Ga0163161_100991702 242
452 3300025711 Ga0207696_1000531 Ga0207696_100053117 242
453 3300025735 Ga0207713_1001430 Ga0207713_100143012 242
454 3300025735 Ga0207713_1001902 Ga0207713_10019026 242
455 3300025735 Ga0207713_1003778 Ga0207713_10037786 242
456 3300025735 Ga0207713_1046265 Ga0207713_10462653 242
457 3300025735 Ga0207713_1052089 Ga0207713_10520893 242
458 3300025935 Ga0207709_10001818 Ga0207709_1000181810 242
459 3300027111 Ga0209281_1000810 Ga0209281_100081012 242
460 3300027111 Ga0209281_1002029 Ga0209281_10020295 242
461 3300027312 Ga0209371_1001516 Ga0209371_10015169 242
462 3300027312 Ga0209371_1001940 Ga0209371_10019408 242
463 3300027312 Ga0209371_1003483 Ga0209371_10034838 242
464 3300027312 Ga0209371_1003549 Ga0209371_10035497 242
465 3300028379 Ga0268266_10002020 Ga0268266_1000202012 242
466 3300030500 Ga0268256_1000715 Ga0268256_100071516 242
467 3300030500 Ga0268256_1001346 Ga0268256_10013469 242
468 3300030500 Ga0268256_1001690 Ga0268256_10016908 242
469 3300030500 Ga0268256_1002733 Ga0268256_10027332 242
470 3300030500 Ga0268256_1004085 Ga0268256_10040854 242
471 3300042010 Ga0439452_000637 Ga0439452_000637_5828_6583 242
472 3300042010 Ga0439452_001200 Ga0439452_001200_5886_6641 242
473 3300042439 Ga0439464_0000994 Ga0439464_0000994_402_1157 242
474 3300046471 Ga0495650_0001118 Ga0495650_0001118_11239_11994 242
475 3300046471 Ga0495650_0012753 Ga0495650_0012753_3259_4014 242
476 3300048907 Ga0496104_0150722 Ga0496104_0150722_1265_2020 242
477 3300048908 Ga0496105_0227785 Ga0496105_0227785_282_1037 242
478 3300048919 Ga0496116_0004818 Ga0496116_0004818_5256_6011 242
479 3300048920 Ga0496117_0009327 Ga0496117_0009327_6743_7498 242
480 3300048920 Ga0496117_0089060 Ga0496117_0089060_946_1701 242
481 3300048921 Ga0496118_0007359 Ga0496118_0007359_6743_7498 242
482 3300048921 Ga0496118_0018747 Ga0496118_0018747_4075_4830 242
483 3300048922 Ga0496119_0003567 Ga0496119_0003567_8031_8786 242
484 3300048922 Ga0496119_0005284 Ga0496119_0005284_6743_7498 242
485 3300048923 Ga0496120_0005507 Ga0496120_0005507_1088_1843 242
486 3300048923 Ga0496120_0008824 Ga0496120_0008824_4812_5567 242
487 3300048924 Ga0496121_0007561 Ga0496121_0007561_5600_6355 242
488 3300048924 Ga0496121_0016340 Ga0496121_0016340_2759_3514 242
489 3300048925 Ga0496122_0006366 Ga0496122_0006366_6743_7498 242
490 3300048925 Ga0496122_0018024 Ga0496122_0018024_4155_4910 242
491 3300048925 Ga0496122_0102175 Ga0496122_0102175_477_1232 242
492 3300048926 Ga0496123_0010141 Ga0496123_0010141_872_1627 242
493 3300048926 Ga0496123_0014440 Ga0496123_0014440_4649_5404 242
494 3300048926 Ga0496123_0086183 Ga0496123_0086183_282_1037 242
495 3300048927 Ga0496124_0010381 Ga0496124_0010381_2661_3416 242
496 3300048928 Ga0496125_0009223 Ga0496125_0009223_5269_6024 242
497 3300048929 Ga0496126_0003021 Ga0496126_0003021_10712_11467 242
498 3300048929 Ga0496126_0630094 Ga0496126_0630094_51_806 242
499 3300050491 nmdc:mga00v17_52304_c1 nmdc:mga00v17_52304_c1_1005_1760 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00899

ThiF

ThiF family

55

274

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zfn-assembly1.cif.gz_A structural analysis of escherichia coli thif 0.9288 1 235
1zud-assembly2.cif.gz_3 structure of this-thif protein complex 0.9219 1 236
4p22-assembly1.cif.gz_A crystal structure of n-terminal fragments of e1 0.921 29 161
5um6-assembly1.cif.gz_A crystal structure of s. pombe uba1 in a closed conformation 0.9188 19 163
6zhs-assembly1.cif.gz_A uba1 bound to two e2 (ubc13) molecules 0.9186 21 170
ID Description Score Start End Superfamily
af_Q6H7A7_75_268_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9345 6 162 3.40.50.720
af_P9WM11_85_248_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9275 23 150 3.40.50.720
af_A0A1D6II59_3_109_3.50.50.80 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;Ubiquitin-activating enzyme E1, inactive adenylation domain, subdomain 1 0.9164 23 122 3.50.50.80
1zkmD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9142 1 235 3.40.50.720
af_L7N674_15_263_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9102 2 238 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3D3YVJ3-F1-model_v4 Molybdopterin biosynthesis protein MoeB 0.953 18 146 GO:0004792
GO:0005829
GO:0008146
GO:0008641
GO:0016779
AF-A0A3N0Z8D1-F1-model_v4 SUMO-activating enzyme subunit 2 0.9462 23 162 GO:0005737
GO:0016925
GO:0019948
GO:0031510
AF-A0A2V9HWS4-F1-model_v4 Thiamine biosynthesis protein ThiF 0.9433 22 170 GO:0008641
GO:0016020
GO:0061503
GO:0061504
AF-A0A6V7W470-F1-model_v4 SUMO-activating enzyme subunit 0.9397 21 172 GO:0005524
GO:0005737
GO:0016925
GO:0019948
GO:0031510
GO:0046872
AF-D8T3J7-F1-model_v4 SUMO-activating enzyme subunit 0.9371 23 172 GO:0005524
GO:0005737
GO:0016567
GO:0016925
GO:0019948
GO:0031510
GO:0046872

Feature Viewer

pLDDT pTM Quality
86.95 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map