F455155

General Info

Members Datasets Scaffolds Average Seq Length
498 241 494 227

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100004780|Ga0070708_1000047806
Length 266
Sequence MKLCSDYIVAAQGTLLNAFSSSLRLQFIRKRQYTILRDSPMRILLVEDETKVSSFVARGLTAERFAVDVAADGQSGLELATTYAYDLIILDLMLPKMDGTQVLRRVRSQNSTVPVLILTARDAVADKVGNFEAGADDYLTKPFAFAELLVRVKALLRRGPVSRSSVVRVGDLELDRLSQQVRRSGKRIDLTSKEYSLLEYLMSNSGRVLSRTMIIEHVWDQSFDGITNIVDVYVRHLRNKVDDPYEHKLIRTVRGVGYTISNGAQS

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221696 Nocardioides sp. Root140 Isolate Unclassified
3 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
4 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
124 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
125 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
237 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
238 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 1
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 1.2
Rhizosphere 92.77
Stem 0
Stem Tuber 0
Unclassified 4.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000005 3300002737 Bacteria 435925
2 JGI25406J46586_10006217 3300003203 Bacteria 5514
3 rootH2_10035222 3300003320 Bacteria 15394
4 rootH2_10234348 3300003320 Bacteria 2923
5 rootH1_10186427 3300003323 Bacteria 4626
6 JGI25405J52794_10011653 3300003911 Bacteria 1684
7 Ga0058862_10260855 3300004803 Bacteria 1400
8 Ga0065714_10069362 3300005288 Bacteria 4258
9 Ga0070658_10000306 3300005327 Bacteria 42420
10 Ga0070658_10021685 3300005327 Bacteria 5148
11 Ga0070658_10030299 3300005327 Bacteria 4347
12 Ga0070683_100348244 3300005329 Bacteria 1411
13 Ga0070683_100823218 3300005329 Bacteria 890
14 Ga0070680_100347295 3300005336 Bacteria 1261
15 Ga0070660_100005362 3300005339 Bacteria 8874
16 Ga0070675_100312288 3300005354 Bacteria 1387
17 Ga0070659_100225060 3300005366 Bacteria 1549
18 Ga0070709_10023133 3300005434 Bacteria 3645
19 Ga0070709_10053563 3300005434 Bacteria 2541
20 Ga0070709_10130017 3300005434 Bacteria 1718
21 Ga0070714_100244391 3300005435 Bacteria 1657
22 Ga0070713_100004439 3300005436 Bacteria 9425
23 Ga0070713_100028023 3300005436 Bacteria 4443
24 Ga0070713_100097123 3300005436 Bacteria 2545
25 Ga0070713_100120915 3300005436 Bacteria 2297
26 Ga0070713_100127909 3300005436 Bacteria 2237
27 Ga0070713_100156943 3300005436 Bacteria 2029
28 Ga0070713_100173094 3300005436 Unclassified 1935
29 Ga0070713_100227341 3300005436 Bacteria 1695
30 Ga0070713_100286343 3300005436 Bacteria 1513
31 Ga0070710_10000357 3300005437 Bacteria 21648
32 Ga0070710_10094262 3300005437 Unclassified 1771
33 Ga0070710_10182765 3300005437 Bacteria 1314
34 Ga0070710_10255054 3300005437 Bacteria 1129
35 Ga0070711_100264786 3300005439 Bacteria 1354
36 Ga0070711_100557740 3300005439 Bacteria 951
37 Ga0070700_100054630 3300005441 Bacteria 2497
38 Ga0070700_100226791 3300005441 Bacteria 1327
39 Ga0070694_100000726 3300005444 Bacteria 18391
40 Ga0070708_100004780 3300005445 Bacteria 10677
41 Ga0070708_100005254 3300005445 Bacteria 10251
42 Ga0070708_100010340 3300005445 Bacteria 7557
43 Ga0070708_100016008 3300005445 Bacteria 6211
44 Ga0070708_100028494 3300005445 Bacteria 4806
45 Ga0070708_100049696 3300005445 Bacteria 3711
46 Ga0070708_100070582 3300005445 Bacteria 3143
47 Ga0070708_100079677 3300005445 Bacteria 2963
48 Ga0070708_100098664 3300005445 Bacteria 2671
49 Ga0070708_100169442 3300005445 Bacteria 2038
50 Ga0070708_100426916 3300005445 Bacteria 1250
51 Ga0070681_10038246 3300005458 Bacteria 4810
52 Ga0070681_10066912 3300005458 Bacteria 3562
53 Ga0068867_100254163 3300005459 Bacteria 1430
54 Ga0070706_100001465 3300005467 Bacteria 24824
55 Ga0070706_100001640 3300005467 Bacteria 23302
56 Ga0070706_100002806 3300005467 Bacteria 17428
57 Ga0070706_100050195 3300005467 Bacteria 3850
58 Ga0070706_100126413 3300005467 Bacteria 2384
59 Ga0070707_100003063 3300005468 Bacteria 15838
60 Ga0070707_100008458 3300005468 Bacteria 9558
61 Ga0070707_100013999 3300005468 Bacteria 7515
62 Ga0070707_100027539 3300005468 Bacteria 5408
63 Ga0070707_100324621 3300005468 Unclassified 1496
64 Ga0070698_100000542 3300005471 Bacteria 40354
65 Ga0070698_100003505 3300005471 Bacteria 17262
66 Ga0070698_100228583 3300005471 Bacteria 1793
67 Ga0070699_100037296 3300005518 Bacteria 4205
68 Ga0070699_100143169 3300005518 Bacteria 2112
69 Ga0070699_100290096 3300005518 Bacteria 1467
70 Ga0070679_100228695 3300005530 Bacteria 1820
71 Ga0070679_100281651 3300005530 Bacteria 1615
72 Ga0070679_100304806 3300005530 Bacteria 1543
73 Ga0070679_100352556 3300005530 Unclassified 1419
74 Ga0070684_100273172 3300005535 Bacteria 1548
75 Ga0070697_100000141 3300005536 Bacteria 58102
76 Ga0070697_100001137 3300005536 Bacteria 20128
77 Ga0070697_100006676 3300005536 Bacteria 8953
78 Ga0070697_100010121 3300005536 Bacteria 7356
79 Ga0070697_100010650 3300005536 Bacteria 7175
80 Ga0070697_100084093 3300005536 Bacteria 2624
81 Ga0070697_100131295 3300005536 Bacteria 2101
82 Ga0070697_100199516 3300005536 Bacteria 1700
83 Ga0070697_100398982 3300005536 Bacteria 1193
84 Ga0070697_100401874 3300005536 Bacteria 1189
85 Ga0068853_100000008 3300005539 Bacteria 259050
86 Ga0068853_100116775 3300005539 Unclassified 2376
87 Ga0070686_100000163 3300005544 Bacteria 46117
88 Ga0070695_100198777 3300005545 Bacteria 1431
89 Ga0070693_100158628 3300005547 Bacteria 1439
90 Ga0070665_100157717 3300005548 Bacteria 2271
91 Ga0070704_100004479 3300005549 Bacteria 8067
92 Ga0070704_100911316 3300005549 Bacteria 791
93 Ga0068855_100029747 3300005563 Bacteria 6531
94 Ga0068855_100103972 3300005563 Bacteria 3267
95 Ga0068855_100136229 3300005563 Unclassified 2802
96 Ga0068855_100308243 3300005563 Bacteria 1752
97 Ga0068855_100342030 3300005563 Bacteria 1649
98 Ga0068857_100571570 3300005577 Bacteria 1066
99 Ga0068854_100054071 3300005578 Bacteria 2886
100 Ga0068854_100613280 3300005578 Bacteria 930
101 Ga0068856_100000067 3300005614 Bacteria 98357
102 Ga0068856_100120798 3300005614 Bacteria 2621
103 Ga0068856_100510393 3300005614 Bacteria 1223
104 Ga0068856_100816558 3300005614 Bacteria 952
105 Ga0068852_100019153 3300005616 Bacteria 5409
106 Ga0068863_100077387 3300005841 Bacteria 3148
107 Ga0068863_101141657 3300005841 Bacteria 784
108 Ga0068858_100007767 3300005842 Bacteria 10357
109 Ga0068858_100067237 3300005842 Bacteria 3319
110 Ga0068860_100692976 3300005843 Bacteria 1028
111 Ga0068862_100953590 3300005844 Unclassified 846
112 Ga0081455_10020720 3300005937 Bacteria 6183
113 Ga0081540_1066650 3300005983 Bacteria 1686
114 Ga0081539_10000732 3300005985 Bacteria 65756
115 Ga0081539_10002589 3300005985 Bacteria 24876
116 Ga0081539_10010453 3300005985 Bacteria 7534
117 Ga0081539_10054207 3300005985 Bacteria 2240
118 Ga0070717_10001440 3300006028 Bacteria 16406
119 Ga0070717_10004886 3300006028 Bacteria 9755
120 Ga0070717_10006680 3300006028 Bacteria 8507
121 Ga0070717_10013997 3300006028 Bacteria 6162
122 Ga0070717_10162500 3300006028 Bacteria 1938
123 Ga0070717_10346135 3300006028 Bacteria 1328
124 Ga0070717_10517605 3300006028 Unclassified 1079
125 Ga0070717_10981039 3300006028 Bacteria 769
126 Ga0075365_10434701 3300006038 Bacteria 927
127 Ga0070715_10080937 3300006163 Bacteria 1474
128 Ga0070716_100004067 3300006173 Bacteria 6942
129 Ga0070716_100248028 3300006173 Bacteria 1211
130 Ga0070712_100006976 3300006175 Bacteria 7043
131 Ga0070712_100804026 3300006175 Unclassified 807
132 Ga0097621_100353627 3300006237 Bacteria 1307
133 Ga0075428_100713920 3300006844 Bacteria 1068
134 Ga0075431_100027479 3300006847 Bacteria 5839
135 Ga0075431_100027752 3300006847 Bacteria 5810
136 Ga0075431_100093647 3300006847 Bacteria 3100
137 Ga0075431_100122793 3300006847 Bacteria 2679
138 Ga0075431_100282042 3300006847 Bacteria 1682
139 Ga0075431_100439389 3300006847 Bacteria 1302
140 Ga0075433_10009731 3300006852 Bacteria 7700
141 Ga0075433_10015987 3300006852 Bacteria 6172
142 Ga0075433_10087811 3300006852 Bacteria 2747
143 Ga0075433_10708706 3300006852 Bacteria 881
144 Ga0075434_100012176 3300006871 Bacteria 8148
145 Ga0075434_100262767 3300006871 Bacteria 1745
146 Ga0075434_100326860 3300006871 Bacteria 1554
147 Ga0075429_100257221 3300006880 Bacteria 1529
148 Ga0075429_100483979 3300006880 Bacteria 1084
149 Ga0075436_100013666 3300006914 Bacteria 5562
150 Ga0075435_100002261 3300007076 Bacteria 12724
151 Ga0105240_10000001 3300009093 Bacteria 2887840
152 Ga0105240_10000069 3300009093 Bacteria 205335
153 Ga0105240_10014910 3300009093 Bacteria 10588
154 Ga0105240_10042688 3300009093 Bacteria 5777
155 Ga0105240_10060316 3300009093 Unclassified 4729
156 Ga0105240_10115009 3300009093 Unclassified 3249
157 Ga0105240_10195867 3300009093 Bacteria 2373
158 Ga0105240_10769176 3300009093 Bacteria 1045
159 Ga0111539_10508634 3300009094 Bacteria 1403
160 Ga0111539_10778031 3300009094 Bacteria 1114
161 Ga0105245_10043635 3300009098 Bacteria 4000
162 Ga0105247_10021561 3300009101 Bacteria 3877
163 Ga0114129_10131044 3300009147 Bacteria 3443
164 Ga0105241_10256852 3300009174 Bacteria 1484
165 Ga0105248_10090097 3300009177 Bacteria 3453
166 Ga0105248_10225002 3300009177 Bacteria 2112
167 Ga0105237_10001617 3300009545 Bacteria 29249
168 Ga0105237_10113701 3300009545 Bacteria 2699
169 Ga0105238_10040158 3300009551 Bacteria 4742
170 Ga0105238_10100993 3300009551 Bacteria 2867
171 Ga0105239_10000032 3300010375 Bacteria 225528
172 Ga0105239_10198187 3300010375 Unclassified 2249
173 Ga0105239_10314228 3300010375 Bacteria 1766
174 Ga0157370_10006891 3300013104 Bacteria 12438
175 Ga0157370_10018779 3300013104 Bacteria 6951
176 Ga0157370_10105317 3300013104 Bacteria 2640
177 Ga0157370_10151673 3300013104 Bacteria 2156
178 Ga0157369_10011151 3300013105 Bacteria 10218
179 Ga0157369_10069219 3300013105 Bacteria 3792
180 Ga0157369_10177447 3300013105 Bacteria 2242
181 Ga0157369_10539049 3300013105 Bacteria 1207
182 Ga0157374_10217384 3300013296 Bacteria 1875
183 Ga0157374_10372176 3300013296 Bacteria 1422
184 Ga0157378_10084464 3300013297 Bacteria 2874
185 Ga0157378_10104125 3300013297 Bacteria 2594
186 Ga0157378_10444529 3300013297 Bacteria 1286
187 Ga0163162_10004081 3300013306 Bacteria 14013
188 Ga0157372_10012429 3300013307 Bacteria 9075
189 Ga0157372_10018353 3300013307 Bacteria 7519
190 Ga0157372_10050439 3300013307 Unclassified 4629
191 Ga0157372_10175085 3300013307 Unclassified 2483
192 Ga0157372_10175986 3300013307 Bacteria 2477
193 Ga0163163_10361420 3300014325 Bacteria 1508
194 Ga0157379_10014712 3300014968 Bacteria 6863
195 Ga0197907_11192561 3300020069 Bacteria 873
196 Ga0213873_10003483 3300021358 Bacteria 2835
197 Ga0213874_10010809 3300021377 Bacteria 2295
198 Ga0213874_10177721 3300021377 Unclassified 756
199 Ga0213876_10027624 3300021384 Bacteria 2993
200 Ga0213871_10014732 3300021441 Bacteria 1860
201 Ga0209437_100043 3300025233 Bacteria 440454
202 Ga0207692_10000177 3300025898 Bacteria 20491
203 Ga0207692_10155037 3300025898 Bacteria 1315
204 Ga0207692_10167431 3300025898 Bacteria 1271
205 Ga0207710_10031468 3300025900 Bacteria 2320
206 Ga0207685_10169256 3300025905 Bacteria 1004
207 Ga0207699_10016052 3300025906 Bacteria 3907
208 Ga0207699_10047872 3300025906 Bacteria 2509
209 Ga0207699_10155136 3300025906 Bacteria 1519
210 Ga0207699_10653389 3300025906 Bacteria 768
211 Ga0207705_10003558 3300025909 Bacteria 11862
212 Ga0207705_10017092 3300025909 Bacteria 5197
213 Ga0207705_10037857 3300025909 Bacteria 3452
214 Ga0207684_10016658 3300025910 Bacteria 6311
215 Ga0207684_10021279 3300025910 Bacteria 5537
216 Ga0207684_10260789 3300025910 Bacteria 1495
217 Ga0207684_10360288 3300025910 Bacteria 1251
218 Ga0207684_10456220 3300025910 Bacteria 1097
219 Ga0207654_10131762 3300025911 Bacteria 1583
220 Ga0207707_10011303 3300025912 Bacteria 7771
221 Ga0207707_10078351 3300025912 Bacteria 2886
222 Ga0207695_10000001 3300025913 Bacteria 2888630
223 Ga0207695_10000186 3300025913 Bacteria 179847
224 Ga0207695_10011398 3300025913 Bacteria 10776
225 Ga0207695_10025305 3300025913 Bacteria 6649
226 Ga0207695_10332463 3300025913 Bacteria 1408
227 Ga0207695_10696049 3300025913 Bacteria 897
228 Ga0207671_10002113 3300025914 Bacteria 21691
229 Ga0207693_10090981 3300025915 Bacteria 2392
230 Ga0207693_10316308 3300025915 Bacteria 1222
231 Ga0207660_10142381 3300025917 Bacteria 1834
232 Ga0207660_10467731 3300025917 Bacteria 1021
233 Ga0207662_10116533 3300025918 Bacteria 1671
234 Ga0207657_10029570 3300025919 Bacteria 4985
235 Ga0207657_10326593 3300025919 Bacteria 1212
236 Ga0207652_10066034 3300025921 Bacteria 3134
237 Ga0207652_10267012 3300025921 Bacteria 1543
238 Ga0207652_10284807 3300025921 Unclassified 1491
239 Ga0207652_10854829 3300025921 Bacteria 805
240 Ga0207646_10063970 3300025922 Bacteria 3284
241 Ga0207646_10091098 3300025922 Bacteria 2729
242 Ga0207646_10105674 3300025922 Bacteria 2525
243 Ga0207646_10145866 3300025922 Bacteria 2133
244 Ga0207646_10278726 3300025922 Unclassified 1511
245 Ga0207646_10577261 3300025922 Bacteria 1010
246 Ga0207694_10009926 3300025924 Bacteria 7184
247 Ga0207694_10022721 3300025924 Bacteria 4758
248 Ga0207687_10074701 3300025927 Bacteria 2430
249 Ga0207700_10011144 3300025928 Bacteria 5718
250 Ga0207700_10019772 3300025928 Bacteria 4555
251 Ga0207700_10020103 3300025928 Bacteria 4526
252 Ga0207700_10086061 3300025928 Bacteria 2469
253 Ga0207700_10093505 3300025928 Bacteria 2380
254 Ga0207700_10175662 3300025928 Bacteria 1790
255 Ga0207700_10332290 3300025928 Bacteria 1319
256 Ga0207664_10180738 3300025929 Bacteria 1811
257 Ga0207664_10290530 3300025929 Unclassified 1436
258 Ga0207664_10386268 3300025929 Bacteria 1243
259 Ga0207664_10502543 3300025929 Bacteria 1086
260 Ga0207670_10268637 3300025936 Bacteria 1325
261 Ga0207665_10000256 3300025939 Bacteria 36790
262 Ga0207665_10085376 3300025939 Bacteria 2179
263 Ga0207665_10129970 3300025939 Bacteria 1786
264 Ga0207665_10135221 3300025939 Bacteria 1754
265 Ga0207661_10230774 3300025944 Bacteria 1639
266 Ga0207667_10022219 3300025949 Bacteria 7014
267 Ga0207667_10027314 3300025949 Bacteria 6214
268 Ga0207667_10041664 3300025949 Bacteria 4882
269 Ga0207667_10158262 3300025949 Unclassified 2331
270 Ga0207667_10158989 3300025949 Bacteria 2325
271 Ga0207667_10219234 3300025949 Bacteria 1949
272 Ga0207667_10230221 3300025949 Bacteria 1898
273 Ga0207640_10636026 3300025981 Bacteria 907
274 Ga0207703_10009512 3300026035 Bacteria 7626
275 Ga0207703_10031274 3300026035 Bacteria 4208
276 Ga0207703_10104739 3300026035 Bacteria 2404
277 Ga0207703_10780837 3300026035 Bacteria 911
278 Ga0207639_10000014 3300026041 Bacteria 274629
279 Ga0207639_10092481 3300026041 Bacteria 2424
280 Ga0207708_10019777 3300026075 Bacteria 5077
281 Ga0207702_10001092 3300026078 Bacteria 27756
282 Ga0207702_10104069 3300026078 Bacteria 2511
283 Ga0207702_10596229 3300026078 Bacteria 1084
284 Ga0207641_10003313 3300026088 Bacteria 14328
285 Ga0207674_10596126 3300026116 Bacteria 1067
286 Ga0207698_10007154 3300026142 Bacteria 6991
287 Ga0268266_10493521 3300028379 Bacteria 1168
288 Ga0265337_1027920 3300028556 Bacteria 1697
289 Ga0265326_10009140 3300028558 Bacteria 2966
290 Ga0265336_10000551 3300028666 Bacteria 21372
291 Ga0265338_10001482 3300028800 Bacteria 38038
292 Ga0265338_10003414 3300028800 Bacteria 22405
293 Ga0265338_10007107 3300028800 Bacteria 14026
294 Ga0265338_10014683 3300028800 Bacteria 8682
295 Ga0265338_10022214 3300028800 Bacteria 6578
296 Ga0265338_10030729 3300028800 Bacteria 5282
297 Ga0265338_10232689 3300028800 Bacteria 1369
298 Ga0265324_10000110 3300029957 Bacteria 65065
299 Ga0265330_10018645 3300031235 Bacteria 3186
300 Ga0265332_10014628 3300031238 Bacteria 3470
301 Ga0265320_10032981 3300031240 Bacteria 2647
302 Ga0265320_10117778 3300031240 Bacteria 1213
303 Ga0265325_10001302 3300031241 Bacteria 17663
304 Ga0265339_10028241 3300031249 Bacteria 3192
305 Ga0265339_10141341 3300031249 Bacteria 1224
306 Ga0265331_10004464 3300031250 Bacteria 8738
307 Ga0265327_10003537 3300031251 Bacteria 14808
308 Ga0265316_10002940 3300031344 Bacteria 17440
309 Ga0265316_10102836 3300031344 Bacteria 2170
310 Ga0265313_10083366 3300031595 Bacteria 1448
311 Ga0265314_10000406 3300031711 Bacteria 58465
312 Ga0265314_10001380 3300031711 Bacteria 27286
313 Ga0265314_10172228 3300031711 Bacteria 1305
314 Ga0265314_10187481 3300031711 Bacteria 1233
315 Ga0265342_10119863 3300031712 Bacteria 1482
316 Ga0265342_10253951 3300031712 Bacteria 937
317 Ga0316576_10012737 3300031727 Bacteria 5564
318 Ga0316577_10011132 3300031733 Bacteria 4867
319 Ga0307406_10057503 3300031901 Unclassified 2495
320 Ga0373926_0010673 3300035083 Bacteria 3081
321 Ga0373926_0034270 3300035083 Bacteria 1796
322 Ga0373944_0033597 3300035089 Unclassified 1555
323 Ga0373923_0125403 3300035111 Bacteria 1150
324 Ga0373936_0005665 3300035113 Bacteria 4711
325 Ga0373945_0007027 3300035116 Bacteria 3641
326 Ga0373953_0001890 3300035117 Bacteria 6207
327 Ga0373954_0016125 3300035118 Bacteria 3343
328 Ga0373956_0138950 3300035119 Bacteria 1140
329 Ga0373943_0009015 3300035170 Bacteria 4472
330 Ga0373946_0010701 3300035171 Bacteria 3405
331 Ga0373946_0022107 3300035171 Bacteria 2473
332 Ga0373955_0057096 3300035172 Bacteria 2143
333 Ga0373924_0000007 3300035410 Bacteria 54976
334 Ga0373924_0013082 3300035410 Bacteria 3114
335 Ga0373935_0006457 3300035692 Bacteria 7002
336 Ga0373935_0017263 3300035692 Unclassified 4376
337 Ga0373935_0018970 3300035692 Bacteria 4193
338 Ga0373935_0122110 3300035692 Bacteria 1742
339 Ga0373927_0030961 3300035695 Bacteria 3490
340 Ga0373927_0037768 3300035695 Bacteria 3137
341 Ga0373927_0294937 3300035695 Bacteria 1067
342 Ga0373933_0006560 3300035724 Bacteria 6341
343 Ga0373947_0001475 3300035725 Bacteria 14477
344 Ga0373947_0002508 3300035725 Bacteria 11028
345 Ga0373947_0377883 3300035725 Bacteria 953
346 Ga0373947_0423678 3300035725 Bacteria 900
347 Ga0373937_0059851 3300036401 Bacteria 3500
348 Ga0373937_0172963 3300036401 Bacteria 2027
349 Ga0373937_0409143 3300036401 Unclassified 1287
350 Ga0373937_0418167 3300036401 Bacteria 1272
351 Ga0316584_0515836 3300036712 Bacteria 838
352 Ga0373925_0001183 3300037068 Bacteria 23049
353 Ga0373925_0001474 3300037068 Bacteria 20256
354 Ga0373925_0259002 3300037068 Bacteria 1397
355 Ga0373925_0347353 3300037068 Bacteria 1204
356 Ga0373925_0354472 3300037068 Bacteria 1192
357 Ga0395905_0078196 3300037471 Bacteria 3100
358 Ga0395905_0079643 3300037471 Bacteria 3071
359 Ga0395905_0713976 3300037471 Unclassified 905
360 Ga0436364_0372361 3300037853 Bacteria 1649
361 Ga0436364_1465067 3300037853 Unclassified 795
362 Ga0395901_0119465 3300038443 Bacteria 2770
363 Ga0395901_0162050 3300038443 Bacteria 2349
364 Ga0395901_0218494 3300038443 Bacteria 1993
365 Ga0436365_0816722 3300039437 Bacteria 1658
366 Ga0436365_1183338 3300039437 Bacteria 3840
367 Ga0436365_1217298 3300039437 Bacteria 3002
368 Ga0436360_0774108 3300039438 Unclassified 1670
369 Ga0436361_0050405 3300039447 Bacteria 1792
370 Ga0436361_0723366 3300039447 Bacteria 804
371 Ga0436363_0220347 3300039450 Bacteria 933
372 Ga0436363_0272652 3300039450 Bacteria 1143
373 Ga0436363_0357605 3300039450 Unclassified 1720
374 Ga0436362_1127703 3300039453 Bacteria 9079
375 Ga0451853_3163402 3300041512 Bacteria 1951
376 Ga0453683_0001529 3300044673 Bacteria 19727
377 Ga0453683_0050690 3300044673 Bacteria 2601
378 Ga0453683_0377908 3300044673 Bacteria 912
379 Ga0466966_0058134 3300044684 Bacteria 2445
380 Ga0453684_0781648 3300044712 Bacteria 1031
381 Ga0466968_0334656 3300044735 Bacteria 733
382 Ga0466959_0258856 3300045049 Bacteria 1198
383 Ga0451576_0003294 3300045051 Bacteria 22423
384 Ga0451576_0429091 3300045051 Bacteria 1387
385 Ga0451576_0442983 3300045051 Unclassified 1363
386 Ga0451576_0576130 3300045051 Bacteria 1183
387 Ga0451576_1039546 3300045051 Bacteria 858
388 Ga0495629_0230376 3300046459 Bacteria 1277
389 Ga0495651_0015402 3300046462 Bacteria 5913
390 Ga0495580_0011364 3300046472 Bacteria 6890
391 Ga0495580_0017063 3300046472 Bacteria 5439
392 Ga0495580_0028282 3300046472 Bacteria 4076
393 Ga0495580_0056939 3300046472 Bacteria 2752
394 Ga0495580_0147354 3300046472 Bacteria 1631
395 Ga0495580_0243914 3300046472 Bacteria 1231
396 Ga0495582_0007506 3300046473 Bacteria 6029
397 Ga0495639_0124982 3300046475 Bacteria 1229
398 Ga0495664_0006147 3300046477 Bacteria 6628
399 Ga0495664_0043765 3300046477 Bacteria 2653
400 Ga0495664_0220235 3300046477 Bacteria 1149
401 Ga0495618_0002180 3300046514 Bacteria 12798
402 Ga0495620_0034806 3300046515 Bacteria 2272
403 Ga0495628_0000972 3300046516 Bacteria 26183
404 Ga0495628_0029864 3300046516 Unclassified 4418
405 Ga0495630_0000090 3300046517 Bacteria 71226
406 Ga0495630_0067519 3300046517 Bacteria 2688
407 Ga0495666_0000375 3300046526 Bacteria 19632
408 Ga0495666_0082367 3300046526 Bacteria 1521
409 Ga0495652_0287037 3300046529 Unclassified 1202
410 Ga0495640_0086623 3300046533 Bacteria 2073
411 Ga0495586_0000059 3300046535 Bacteria 66207
412 Ga0495586_0001134 3300046535 Bacteria 14970
413 Ga0495586_0303533 3300046535 Bacteria 915
414 Ga0495645_0002653 3300046543 Bacteria 12162
415 Ga0495634_0122166 3300046642 Bacteria 1667
416 Ga0495599_0003376 3300046678 Bacteria 9336
417 Ga0495599_0092197 3300046678 Unclassified 1890
418 Ga0495623_0218210 3300046679 Bacteria 1088
419 Ga0495646_0106355 3300046680 Unclassified 1602
420 Ga0495658_0004835 3300046683 Bacteria 6609
421 Ga0495658_0010975 3300046683 Bacteria 4542
422 Ga0495613_0136147 3300046689 Unclassified 1757
423 Ga0495613_0350977 3300046689 Bacteria 1013
424 Ga0495624_0100630 3300046690 Bacteria 1779
425 Ga0495624_0470874 3300046690 Bacteria 752
426 Ga0495600_0030238 3300046809 Bacteria 3508
427 Ga0495581_0179002 3300047315 Bacteria 1240
428 Ga0495674_0000212 3300047319 Bacteria 48127
429 Ga0495674_0010402 3300047319 Bacteria 8809
430 Ga0495674_0273263 3300047319 Bacteria 1386
431 Ga0495676_0242498 3300047321 Bacteria 1233
432 Ga0495675_0137035 3300047444 Unclassified 1519
433 Ga0495684_0028209 3300047471 Bacteria 4310
434 Ga0495684_0075738 3300047471 Bacteria 2556
435 Ga0495684_0464290 3300047471 Bacteria 877
436 Ga0495686_0039296 3300047472 Bacteria 3023
437 Ga0495602_0070786 3300048088 Bacteria 2982
438 Ga0495602_0194988 3300048088 Unclassified 1550
439 Ga0496102_0002856 3300048905 Bacteria 14671
440 Ga0496103_0066838 3300048906 Bacteria 2244
441 Ga0496106_0076073 3300048909 Bacteria 2573
442 Ga0496107_0391153 3300048910 Bacteria 1034
443 Ga0496109_0000107 3300048912 Bacteria 86168
444 Ga0496115_0566063 3300048918 Bacteria 907
445 Ga0496119_0190295 3300048922 Bacteria 1070
446 Ga0496125_0403007 3300048928 Bacteria 799
447 Ga0496126_0003335 3300048929 Bacteria 20410
448 Ga0496126_0162715 3300048929 Bacteria 1906
449 Ga0496126_0238352 3300048929 Bacteria 1521
450 Ga0501031_0013420 3300049568 Bacteria 5344
451 Ga0501032_0090270 3300049569 Bacteria 2033
452 Ga0501033_0098932 3300049570 Bacteria 2130
453 Ga0501034_0062462 3300049571 Bacteria 3740
454 Ga0501038_0035407 3300049574 Bacteria 4383
455 Ga0501046_0002062 3300049580 Bacteria 19066
456 Ga0501047_0019360 3300049581 Bacteria 6529
457 Ga0501047_0090675 3300049581 Bacteria 2934
458 Ga0501047_0528231 3300049581 Bacteria 1005
459 Ga0501070_0000031 3300049586 Bacteria 138137
460 Ga0501070_0049651 3300049586 Bacteria 3484
461 Ga0501070_0145249 3300049586 Bacteria 1958
462 Ga0501070_0726119 3300049586 Bacteria 784
463 Ga0501080_0005230 3300049742 Bacteria 11560
464 Ga0501080_0124897 3300049742 Bacteria 2384
465 Ga0501080_0290686 3300049742 Bacteria 1484
466 Ga0501044_0069415 3300049823 Bacteria 3587
467 Ga0501044_0152796 3300049823 Bacteria 2290
468 Ga0501045_0275618 3300049824 Bacteria 1252
469 nmdc:mga0yw44_186854_c1 3300050492 Bacteria 1365
470 nmdc:mga05p37_1196_c1 3300050507 Bacteria 29998
471 nmdc:mga09592_196910_c1 3300050508 Bacteria 1744
472 nmdc:mga0qj67_265494_c1 3300050509 Bacteria 1392
473 nmdc:mga06r32_421064_c1 3300050510 Bacteria 1317
474 nmdc:mga06r32_425020_c1 3300050510 Bacteria 1310
475 nmdc:mga06r32_4831_c2 3300050510 Bacteria 8793
476 nmdc:mga06r32_741432_c1 3300050510 Bacteria 946
477 nmdc:mga08y16_407647_c1 3300050511 Bacteria 1390
478 nmdc:mga08y16_429199_c1 3300050511 Bacteria 1350
479 nmdc:mga08y16_596178_c1 3300050511 Bacteria 1114
480 nmdc:mga0n895_159694_c1 3300050512 Unclassified 2285
481 nmdc:mga0n895_321109_c1 3300050512 Bacteria 1569
482 nmdc:mga0n895_368751_c1 3300050512 Bacteria 1454
483 nmdc:mga0rr50_167_c1 3300050513 Bacteria 31282
484 nmdc:mga08x19_8082_c1 3300050514 Bacteria 6251
485 nmdc:mga0a205_101951_c1 3300050515 Bacteria 2769
486 nmdc:mga0a205_127657_c1 3300050515 Bacteria 2443
487 nmdc:mga0a205_464328_c1 3300050515 Bacteria 1125
488 nmdc:mga0a205_4746_c1 3300050515 Bacteria 12212
489 Ga0500562_091688 3300053108 Bacteria 825
490 Ga0500595_008643 3300053119 Bacteria 4154
491 Ga0587077_053961 3300059493 Bacteria 850
492 Ga0587080_044112 3300059503 Bacteria 822
493 Ga0587076_024485 3300059645 Bacteria 1024
494 Ga0501082_0310925 3300060353 Bacteria 1372

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_1465067 Ga0436364_1465067_220_783 184
2 3300039447 Ga0436361_0050405 Ga0436361_0050405_803_1468 206
3 3300046515 Ga0495620_0034806 Ga0495620_0034806_405_1073 206
4 3300028800 Ga0265338_10007107 Ga0265338_1000710711 212
5 3300035695 Ga0373927_0294937 Ga0373927_0294937_20_676 212
6 3300047315 Ga0495581_0179002 Ga0495581_0179002_580_1227 212
7 iso_pu_bacteria 2837183177 2837183852 215
8 3300045051 Ga0451576_0576130 Ga0451576_0576130_17_667 216
9 iso_pu_bacteria 2643221561 2643826586 217
10 iso_pu_bacteria 2643221696 2644535622 217
11 3300037068 Ga0373925_0259002 Ga0373925_0259002_373_1053 218
12 3300046459 Ga0495629_0230376 Ga0495629_0230376_383_1063 218
13 3300046517 Ga0495630_0000090 Ga0495630_0000090_28515_29195 218
14 3300046526 Ga0495666_0000375 Ga0495666_0000375_5531_6211 218
15 3300046535 Ga0495586_0000059 Ga0495586_0000059_23496_24176 218
16 3300046690 Ga0495624_0470874 Ga0495624_0470874_43_723 218
17 3300047319 Ga0495674_0000212 Ga0495674_0000212_35109_35789 218
18 3300047471 Ga0495684_0464290 Ga0495684_0464290_85_765 218
19 3300031240 Ga0265320_10032981 Ga0265320_100329812 219
20 3300005437 Ga0070710_10255054 Ga0070710_102550542 220
21 3300041512 Ga0451853_3163402 Ga0451853_3163402_767_1429 220
22 3300045051 Ga0451576_0003294 Ga0451576_0003294_1648_2313 220
23 3300048922 Ga0496119_0190295 Ga0496119_0190295_370_1038 220
24 iso_pu_bacteria 2919497567 2919500950 220
25 3300005441 Ga0070700_100054630 Ga0070700_1000546304 221
26 3300005441 Ga0070700_100226791 Ga0070700_1002267912 221
27 3300006038 Ga0075365_10434701 Ga0075365_104347011 221
28 3300009093 Ga0105240_10042688 Ga0105240_100426882 221
29 3300009094 Ga0111539_10508634 Ga0111539_105086342 221
30 3300025910 Ga0207684_10360288 Ga0207684_103602882 221
31 3300025918 Ga0207662_10116533 Ga0207662_101165333 221
32 3300026075 Ga0207708_10019777 Ga0207708_100197772 221
33 3300044684 Ga0466966_0058134 Ga0466966_0058134_1021_1701 221
34 3300048918 Ga0496115_0566063 Ga0496115_0566063_200_877 221
35 3300048928 Ga0496125_0403007 Ga0496125_0403007_47_724 221
36 3300048929 Ga0496126_0003335 Ga0496126_0003335_3185_3862 221
37 3300048929 Ga0496126_0162715 Ga0496126_0162715_82_750 221
38 3300048929 Ga0496126_0238352 Ga0496126_0238352_584_1258 221
39 3300050492 nmdc:mga0yw44_186854_c1 nmdc:mga0yw44_186854_c1_316_984 221
40 3300050511 nmdc:mga08y16_407647_c1 nmdc:mga08y16_407647_c1_450_1118 221
41 3300005445 Ga0070708_100079677 Ga0070708_1000796772 222
42 3300005468 Ga0070707_100003063 Ga0070707_1000030639 222
43 3300005536 Ga0070697_100199516 Ga0070697_1001995162 222
44 3300006847 Ga0075431_100027752 Ga0075431_1000277528 222
45 3300006852 Ga0075433_10087811 Ga0075433_100878112 222
46 3300006871 Ga0075434_100262767 Ga0075434_1002627672 222
47 3300021441 Ga0213871_10014732 Ga0213871_100147322 222
48 3300025939 Ga0207665_10135221 Ga0207665_101352212 222
49 3300039438 Ga0436360_0774108 Ga0436360_0774108_677_1354 222
50 3300050510 nmdc:mga06r32_4831_c2 nmdc:mga06r32_4831_c2_2495_3172 222
51 3300050511 nmdc:mga08y16_429199_c1 nmdc:mga08y16_429199_c1_343_1020 222
52 3300050512 nmdc:mga0n895_368751_c1 nmdc:mga0n895_368751_c1_49_726 222
53 3300003203 JGI25406J46586_10006217 JGI25406J46586_100062173 223
54 3300003320 rootH2_10035222 rootH2_100352225 223
55 3300003320 rootH2_10234348 rootH2_102343482 223
56 3300003323 rootH1_10186427 rootH1_101864276 223
57 3300004803 Ga0058862_10260855 Ga0058862_102608552 223
58 3300005327 Ga0070658_10000306 Ga0070658_1000030616 223
59 3300005327 Ga0070658_10021685 Ga0070658_100216852 223
60 3300005327 Ga0070658_10030299 Ga0070658_100302993 223
61 3300005329 Ga0070683_100348244 Ga0070683_1003482442 223
62 3300005336 Ga0070680_100347295 Ga0070680_1003472952 223
63 3300005339 Ga0070660_100005362 Ga0070660_1000053625 223
64 3300005354 Ga0070675_100312288 Ga0070675_1003122882 223
65 3300005366 Ga0070659_100225060 Ga0070659_1002250602 223
66 3300005434 Ga0070709_10023133 Ga0070709_100231333 223
67 3300005434 Ga0070709_10053563 Ga0070709_100535631 223
68 3300005434 Ga0070709_10130017 Ga0070709_101300171 223
69 3300005435 Ga0070714_100244391 Ga0070714_1002443912 223
70 3300005436 Ga0070713_100004439 Ga0070713_1000044392 223
71 3300005436 Ga0070713_100028023 Ga0070713_1000280233 223
72 3300005436 Ga0070713_100097123 Ga0070713_1000971232 223
73 3300005436 Ga0070713_100120915 Ga0070713_1001209152 223
74 3300005436 Ga0070713_100127909 Ga0070713_1001279091 223
75 3300005436 Ga0070713_100156943 Ga0070713_1001569432 223
76 3300005436 Ga0070713_100173094 Ga0070713_1001730942 223
77 3300005436 Ga0070713_100227341 Ga0070713_1002273413 223
78 3300005436 Ga0070713_100286343 Ga0070713_1002863432 223
79 3300005437 Ga0070710_10000357 Ga0070710_100003574 223
80 3300005437 Ga0070710_10094262 Ga0070710_100942622 223
81 3300005439 Ga0070711_100557740 Ga0070711_1005577402 223
82 3300005444 Ga0070694_100000726 Ga0070694_10000072611 223
83 3300005445 Ga0070708_100005254 Ga0070708_1000052545 223
84 3300005445 Ga0070708_100010340 Ga0070708_1000103408 223
85 3300005445 Ga0070708_100016008 Ga0070708_1000160088 223
86 3300005445 Ga0070708_100028494 Ga0070708_1000284944 223
87 3300005445 Ga0070708_100049696 Ga0070708_1000496964 223
88 3300005445 Ga0070708_100070582 Ga0070708_1000705824 223
89 3300005445 Ga0070708_100098664 Ga0070708_1000986642 223
90 3300005445 Ga0070708_100169442 Ga0070708_1001694421 223
91 3300005445 Ga0070708_100426916 Ga0070708_1004269162 223
92 3300005458 Ga0070681_10038246 Ga0070681_100382463 223
93 3300005458 Ga0070681_10066912 Ga0070681_100669123 223
94 3300005459 Ga0068867_100254163 Ga0068867_1002541631 223
95 3300005467 Ga0070706_100001465 Ga0070706_10000146515 223
96 3300005467 Ga0070706_100001640 Ga0070706_10000164010 223
97 3300005467 Ga0070706_100002806 Ga0070706_10000280611 223
98 3300005467 Ga0070706_100050195 Ga0070706_1000501953 223
99 3300005467 Ga0070706_100126413 Ga0070706_1001264132 223
100 3300005468 Ga0070707_100008458 Ga0070707_1000084583 223
101 3300005468 Ga0070707_100013999 Ga0070707_1000139993 223
102 3300005468 Ga0070707_100027539 Ga0070707_1000275392 223
103 3300005468 Ga0070707_100324621 Ga0070707_1003246212 223
104 3300005471 Ga0070698_100000542 Ga0070698_10000054211 223
105 3300005471 Ga0070698_100003505 Ga0070698_10000350510 223
106 3300005471 Ga0070698_100228583 Ga0070698_1002285833 223
107 3300005518 Ga0070699_100143169 Ga0070699_1001431693 223
108 3300005518 Ga0070699_100290096 Ga0070699_1002900963 223
109 3300005530 Ga0070679_100228695 Ga0070679_1002286951 223
110 3300005530 Ga0070679_100281651 Ga0070679_1002816512 223
111 3300005530 Ga0070679_100304806 Ga0070679_1003048062 223
112 3300005530 Ga0070679_100352556 Ga0070679_1003525562 223
113 3300005535 Ga0070684_100273172 Ga0070684_1002731722 223
114 3300005536 Ga0070697_100000141 Ga0070697_10000014127 223
115 3300005536 Ga0070697_100001137 Ga0070697_1000011375 223
116 3300005536 Ga0070697_100006676 Ga0070697_1000066763 223
117 3300005536 Ga0070697_100010121 Ga0070697_1000101214 223
118 3300005536 Ga0070697_100084093 Ga0070697_1000840931 223
119 3300005536 Ga0070697_100131295 Ga0070697_1001312952 223
120 3300005536 Ga0070697_100398982 Ga0070697_1003989822 223
121 3300005536 Ga0070697_100401874 Ga0070697_1004018742 223
122 3300005539 Ga0068853_100000008 Ga0068853_100000008144 223
123 3300005539 Ga0068853_100116775 Ga0068853_1001167752 223
124 3300005544 Ga0070686_100000163 Ga0070686_10000016310 223
125 3300005545 Ga0070695_100198777 Ga0070695_1001987771 223
126 3300005547 Ga0070693_100158628 Ga0070693_1001586282 223
127 3300005548 Ga0070665_100157717 Ga0070665_1001577172 223
128 3300005549 Ga0070704_100911316 Ga0070704_1009113161 223
129 3300005563 Ga0068855_100029747 Ga0068855_1000297475 223
130 3300005563 Ga0068855_100103972 Ga0068855_1001039722 223
131 3300005563 Ga0068855_100136229 Ga0068855_1001362293 223
132 3300005563 Ga0068855_100308243 Ga0068855_1003082432 223
133 3300005563 Ga0068855_100342030 Ga0068855_1003420302 223
134 3300005577 Ga0068857_100571570 Ga0068857_1005715701 223
135 3300005578 Ga0068854_100054071 Ga0068854_1000540712 223
136 3300005578 Ga0068854_100613280 Ga0068854_1006132801 223
137 3300005614 Ga0068856_100000067 Ga0068856_10000006733 223
138 3300005614 Ga0068856_100120798 Ga0068856_1001207983 223
139 3300005614 Ga0068856_100510393 Ga0068856_1005103932 223
140 3300005614 Ga0068856_100816558 Ga0068856_1008165581 223
141 3300005616 Ga0068852_100019153 Ga0068852_1000191532 223
142 3300005841 Ga0068863_100077387 Ga0068863_1000773872 223
143 3300005841 Ga0068863_101141657 Ga0068863_1011416571 223
144 3300005842 Ga0068858_100067237 Ga0068858_1000672373 223
145 3300005843 Ga0068860_100692976 Ga0068860_1006929762 223
146 3300005844 Ga0068862_100953590 Ga0068862_1009535902 223
147 3300005937 Ga0081455_10020720 Ga0081455_100207203 223
148 3300005985 Ga0081539_10000732 Ga0081539_1000073254 223
149 3300005985 Ga0081539_10002589 Ga0081539_1000258918 223
150 3300005985 Ga0081539_10010453 Ga0081539_100104534 223
151 3300005985 Ga0081539_10054207 Ga0081539_100542072 223
152 3300006028 Ga0070717_10001440 Ga0070717_100014404 223
153 3300006028 Ga0070717_10004886 Ga0070717_100048862 223
154 3300006028 Ga0070717_10006680 Ga0070717_100066806 223
155 3300006028 Ga0070717_10013997 Ga0070717_100139975 223
156 3300006028 Ga0070717_10162500 Ga0070717_101625002 223
157 3300006028 Ga0070717_10346135 Ga0070717_103461352 223
158 3300006028 Ga0070717_10517605 Ga0070717_105176052 223
159 3300006028 Ga0070717_10981039 Ga0070717_109810392 223
160 3300006163 Ga0070715_10080937 Ga0070715_100809372 223
161 3300006173 Ga0070716_100004067 Ga0070716_1000040673 223
162 3300006173 Ga0070716_100248028 Ga0070716_1002480283 223
163 3300006175 Ga0070712_100006976 Ga0070712_1000069764 223
164 3300006175 Ga0070712_100804026 Ga0070712_1008040262 223
165 3300006237 Ga0097621_100353627 Ga0097621_1003536272 223
166 3300006844 Ga0075428_100713920 Ga0075428_1007139202 223
167 3300006847 Ga0075431_100027479 Ga0075431_1000274792 223
168 3300006847 Ga0075431_100093647 Ga0075431_1000936472 223
169 3300006847 Ga0075431_100122793 Ga0075431_1001227933 223
170 3300006847 Ga0075431_100282042 Ga0075431_1002820422 223
171 3300006847 Ga0075431_100439389 Ga0075431_1004393892 223
172 3300006852 Ga0075433_10009731 Ga0075433_100097312 223
173 3300006852 Ga0075433_10015987 Ga0075433_100159873 223
174 3300006852 Ga0075433_10708706 Ga0075433_107087062 223
175 3300006871 Ga0075434_100012176 Ga0075434_1000121764 223
176 3300006871 Ga0075434_100326860 Ga0075434_1003268604 223
177 3300006880 Ga0075429_100257221 Ga0075429_1002572212 223
178 3300006880 Ga0075429_100483979 Ga0075429_1004839792 223
179 3300006914 Ga0075436_100013666 Ga0075436_1000136663 223
180 3300007076 Ga0075435_100002261 Ga0075435_1000022615 223
181 3300009093 Ga0105240_10000001 Ga0105240_10000001766 223
182 3300009093 Ga0105240_10014910 Ga0105240_100149105 223
183 3300009093 Ga0105240_10060316 Ga0105240_100603165 223
184 3300009093 Ga0105240_10115009 Ga0105240_101150093 223
185 3300009093 Ga0105240_10195867 Ga0105240_101958672 223
186 3300009093 Ga0105240_10769176 Ga0105240_107691762 223
187 3300009094 Ga0111539_10778031 Ga0111539_107780311 223
188 3300009098 Ga0105245_10043635 Ga0105245_100436353 223
189 3300009101 Ga0105247_10021561 Ga0105247_100215614 223
190 3300009147 Ga0114129_10131044 Ga0114129_101310444 223
191 3300009174 Ga0105241_10256852 Ga0105241_102568522 223
192 3300009177 Ga0105248_10090097 Ga0105248_100900972 223
193 3300009177 Ga0105248_10225002 Ga0105248_102250022 223
194 3300009545 Ga0105237_10001617 Ga0105237_100016178 223
195 3300009551 Ga0105238_10040158 Ga0105238_100401586 223
196 3300009551 Ga0105238_10100993 Ga0105238_101009932 223
197 3300010375 Ga0105239_10198187 Ga0105239_101981872 223
198 3300010375 Ga0105239_10314228 Ga0105239_103142281 223
199 3300013104 Ga0157370_10006891 Ga0157370_100068912 223
200 3300013104 Ga0157370_10018779 Ga0157370_100187794 223
201 3300013104 Ga0157370_10105317 Ga0157370_101053172 223
202 3300013104 Ga0157370_10151673 Ga0157370_101516732 223
203 3300013105 Ga0157369_10011151 Ga0157369_100111517 223
204 3300013105 Ga0157369_10069219 Ga0157369_100692192 223
205 3300013105 Ga0157369_10177447 Ga0157369_101774472 223
206 3300013105 Ga0157369_10539049 Ga0157369_105390492 223
207 3300013296 Ga0157374_10217384 Ga0157374_102173842 223
208 3300013296 Ga0157374_10372176 Ga0157374_103721762 223
209 3300013297 Ga0157378_10084464 Ga0157378_100844642 223
210 3300013297 Ga0157378_10104125 Ga0157378_101041253 223
211 3300013297 Ga0157378_10444529 Ga0157378_104445291 223
212 3300013307 Ga0157372_10012429 Ga0157372_100124295 223
213 3300013307 Ga0157372_10018353 Ga0157372_100183532 223
214 3300013307 Ga0157372_10050439 Ga0157372_100504392 223
215 3300013307 Ga0157372_10175085 Ga0157372_101750852 223
216 3300013307 Ga0157372_10175986 Ga0157372_101759862 223
217 3300014325 Ga0163163_10361420 Ga0163163_103614202 223
218 3300014968 Ga0157379_10014712 Ga0157379_1001471211 223
219 3300020069 Ga0197907_11192561 Ga0197907_111925612 223
220 3300021358 Ga0213873_10003483 Ga0213873_100034832 223
221 3300021377 Ga0213874_10010809 Ga0213874_100108092 223
222 3300021377 Ga0213874_10177721 Ga0213874_101777211 223
223 3300021384 Ga0213876_10027624 Ga0213876_100276242 223
224 3300025898 Ga0207692_10000177 Ga0207692_100001776 223
225 3300025898 Ga0207692_10155037 Ga0207692_101550372 223
226 3300025898 Ga0207692_10167431 Ga0207692_101674311 223
227 3300025900 Ga0207710_10031468 Ga0207710_100314682 223
228 3300025905 Ga0207685_10169256 Ga0207685_101692562 223
229 3300025906 Ga0207699_10016052 Ga0207699_100160522 223
230 3300025906 Ga0207699_10047872 Ga0207699_100478722 223
231 3300025906 Ga0207699_10155136 Ga0207699_101551362 223
232 3300025906 Ga0207699_10653389 Ga0207699_106533891 223
233 3300025909 Ga0207705_10003558 Ga0207705_100035583 223
234 3300025909 Ga0207705_10017092 Ga0207705_100170923 223
235 3300025909 Ga0207705_10037857 Ga0207705_100378572 223
236 3300025910 Ga0207684_10016658 Ga0207684_100166582 223
237 3300025910 Ga0207684_10021279 Ga0207684_100212792 223
238 3300025910 Ga0207684_10260789 Ga0207684_102607892 223
239 3300025910 Ga0207684_10456220 Ga0207684_104562202 223
240 3300025911 Ga0207654_10131762 Ga0207654_101317621 223
241 3300025912 Ga0207707_10011303 Ga0207707_100113032 223
242 3300025912 Ga0207707_10078351 Ga0207707_100783512 223
243 3300025913 Ga0207695_10000001 Ga0207695_10000001767 223
244 3300025913 Ga0207695_10000186 Ga0207695_1000018663 223
245 3300025913 Ga0207695_10011398 Ga0207695_100113985 223
246 3300025913 Ga0207695_10025305 Ga0207695_100253053 223
247 3300025913 Ga0207695_10332463 Ga0207695_103324632 223
248 3300025913 Ga0207695_10696049 Ga0207695_106960491 223
249 3300025914 Ga0207671_10002113 Ga0207671_1000211312 223
250 3300025915 Ga0207693_10090981 Ga0207693_100909813 223
251 3300025915 Ga0207693_10316308 Ga0207693_103163082 223
252 3300025917 Ga0207660_10142381 Ga0207660_101423812 223
253 3300025917 Ga0207660_10467731 Ga0207660_104677311 223
254 3300025919 Ga0207657_10029570 Ga0207657_100295703 223
255 3300025919 Ga0207657_10326593 Ga0207657_103265932 223
256 3300025921 Ga0207652_10066034 Ga0207652_100660342 223
257 3300025921 Ga0207652_10267012 Ga0207652_102670122 223
258 3300025921 Ga0207652_10284807 Ga0207652_102848072 223
259 3300025921 Ga0207652_10854829 Ga0207652_108548292 223
260 3300025922 Ga0207646_10063970 Ga0207646_100639702 223
261 3300025922 Ga0207646_10091098 Ga0207646_100910982 223
262 3300025922 Ga0207646_10105674 Ga0207646_101056741 223
263 3300025922 Ga0207646_10145866 Ga0207646_101458662 223
264 3300025922 Ga0207646_10278726 Ga0207646_102787261 223
265 3300025922 Ga0207646_10577261 Ga0207646_105772611 223
266 3300025924 Ga0207694_10009926 Ga0207694_100099266 223
267 3300025924 Ga0207694_10022721 Ga0207694_100227212 223
268 3300025927 Ga0207687_10074701 Ga0207687_100747012 223
269 3300025928 Ga0207700_10011144 Ga0207700_100111443 223
270 3300025928 Ga0207700_10019772 Ga0207700_100197722 223
271 3300025928 Ga0207700_10020103 Ga0207700_100201033 223
272 3300025928 Ga0207700_10086061 Ga0207700_100860612 223
273 3300025928 Ga0207700_10093505 Ga0207700_100935052 223
274 3300025928 Ga0207700_10175662 Ga0207700_101756623 223
275 3300025928 Ga0207700_10332290 Ga0207700_103322902 223
276 3300025929 Ga0207664_10180738 Ga0207664_101807382 223
277 3300025929 Ga0207664_10290530 Ga0207664_102905302 223
278 3300025929 Ga0207664_10386268 Ga0207664_103862682 223
279 3300025929 Ga0207664_10502543 Ga0207664_105025432 223
280 3300025939 Ga0207665_10000256 Ga0207665_1000025622 223
281 3300025939 Ga0207665_10085376 Ga0207665_100853762 223
282 3300025939 Ga0207665_10129970 Ga0207665_101299702 223
283 3300025944 Ga0207661_10230774 Ga0207661_102307742 223
284 3300025949 Ga0207667_10022219 Ga0207667_100222195 223
285 3300025949 Ga0207667_10027314 Ga0207667_100273141 223
286 3300025949 Ga0207667_10041664 Ga0207667_100416643 223
287 3300025949 Ga0207667_10158262 Ga0207667_101582624 223
288 3300025949 Ga0207667_10158989 Ga0207667_101589892 223
289 3300025949 Ga0207667_10219234 Ga0207667_102192343 223
290 3300025949 Ga0207667_10230221 Ga0207667_102302211 223
291 3300025981 Ga0207640_10636026 Ga0207640_106360262 223
292 3300026035 Ga0207703_10104739 Ga0207703_101047392 223
293 3300026035 Ga0207703_10780837 Ga0207703_107808372 223
294 3300026041 Ga0207639_10000014 Ga0207639_1000001445 223
295 3300026041 Ga0207639_10092481 Ga0207639_100924814 223
296 3300026078 Ga0207702_10001092 Ga0207702_1000109212 223
297 3300026078 Ga0207702_10104069 Ga0207702_101040692 223
298 3300026088 Ga0207641_10003313 Ga0207641_100033134 223
299 3300026116 Ga0207674_10596126 Ga0207674_105961262 223
300 3300026142 Ga0207698_10007154 Ga0207698_100071542 223
301 3300028379 Ga0268266_10493521 Ga0268266_104935211 223
302 3300028556 Ga0265337_1027920 Ga0265337_10279202 223
303 3300028558 Ga0265326_10009140 Ga0265326_100091403 223
304 3300028666 Ga0265336_10000551 Ga0265336_100005514 223
305 3300028800 Ga0265338_10001482 Ga0265338_1000148214 223
306 3300028800 Ga0265338_10003414 Ga0265338_100034143 223
307 3300028800 Ga0265338_10014683 Ga0265338_100146835 223
308 3300028800 Ga0265338_10022214 Ga0265338_100222143 223
309 3300028800 Ga0265338_10030729 Ga0265338_100307293 223
310 3300028800 Ga0265338_10232689 Ga0265338_102326892 223
311 3300029957 Ga0265324_10000110 Ga0265324_1000011037 223
312 3300031240 Ga0265320_10117778 Ga0265320_101177782 223
313 3300031249 Ga0265339_10141341 Ga0265339_101413412 223
314 3300031250 Ga0265331_10004464 Ga0265331_100044645 223
315 3300031251 Ga0265327_10003537 Ga0265327_100035374 223
316 3300031344 Ga0265316_10002940 Ga0265316_1000294011 223
317 3300031711 Ga0265314_10000406 Ga0265314_100004063 223
318 3300031711 Ga0265314_10172228 Ga0265314_101722281 223
319 3300031711 Ga0265314_10187481 Ga0265314_101874812 223
320 3300031712 Ga0265342_10253951 Ga0265342_102539511 223
321 3300031727 Ga0316576_10012737 Ga0316576_100127374 223
322 3300031901 Ga0307406_10057503 Ga0307406_100575033 223
323 3300035083 Ga0373926_0010673 Ga0373926_0010673_2132_2812 223
324 3300035083 Ga0373926_0034270 Ga0373926_0034270_836_1516 223
325 3300035089 Ga0373944_0033597 Ga0373944_0033597_834_1520 223
326 3300035111 Ga0373923_0125403 Ga0373923_0125403_219_899 223
327 3300035113 Ga0373936_0005665 Ga0373936_0005665_3813_4493 223
328 3300035116 Ga0373945_0007027 Ga0373945_0007027_2866_3546 223
329 3300035117 Ga0373953_0001890 Ga0373953_0001890_787_1467 223
330 3300035118 Ga0373954_0016125 Ga0373954_0016125_1221_1901 223
331 3300035119 Ga0373956_0138950 Ga0373956_0138950_441_1121 223
332 3300035170 Ga0373943_0009015 Ga0373943_0009015_3064_3744 223
333 3300035171 Ga0373946_0010701 Ga0373946_0010701_2200_2880 223
334 3300035171 Ga0373946_0022107 Ga0373946_0022107_860_1540 223
335 3300035172 Ga0373955_0057096 Ga0373955_0057096_879_1559 223
336 3300035410 Ga0373924_0000007 Ga0373924_0000007_45992_46669 223
337 3300035410 Ga0373924_0013082 Ga0373924_0013082_1415_2095 223
338 3300035692 Ga0373935_0017263 Ga0373935_0017263_3123_3803 223
339 3300035692 Ga0373935_0018970 Ga0373935_0018970_2672_3352 223
340 3300035692 Ga0373935_0122110 Ga0373935_0122110_82_768 223
341 3300035695 Ga0373927_0030961 Ga0373927_0030961_1734_2414 223
342 3300035695 Ga0373927_0037768 Ga0373927_0037768_1497_2177 223
343 3300035724 Ga0373933_0006560 Ga0373933_0006560_4219_4899 223
344 3300035725 Ga0373947_0001475 Ga0373947_0001475_3001_3681 223
345 3300035725 Ga0373947_0002508 Ga0373947_0002508_3157_3837 223
346 3300035725 Ga0373947_0377883 Ga0373947_0377883_42_722 223
347 3300035725 Ga0373947_0423678 Ga0373947_0423678_187_867 223
348 3300036401 Ga0373937_0059851 Ga0373937_0059851_951_1631 223
349 3300036401 Ga0373937_0172963 Ga0373937_0172963_990_1679 223
350 3300036401 Ga0373937_0409143 Ga0373937_0409143_270_950 223
351 3300037068 Ga0373925_0001474 Ga0373925_0001474_2013_2693 223
352 3300037068 Ga0373925_0347353 Ga0373925_0347353_322_1011 223
353 3300037068 Ga0373925_0354472 Ga0373925_0354472_465_1145 223
354 3300037471 Ga0395905_0078196 Ga0395905_0078196_498_1178 223
355 3300037471 Ga0395905_0713976 Ga0395905_0713976_182_862 223
356 3300037853 Ga0436364_0372361 Ga0436364_0372361_190_870 223
357 3300038443 Ga0395901_0119465 Ga0395901_0119465_357_1034 223
358 3300038443 Ga0395901_0218494 Ga0395901_0218494_732_1412 223
359 3300039437 Ga0436365_1183338 Ga0436365_1183338_2229_2912 223
360 3300039447 Ga0436361_0723366 Ga0436361_0723366_48_728 223
361 3300039450 Ga0436363_0220347 Ga0436363_0220347_52_732 223
362 3300039450 Ga0436363_0272652 Ga0436363_0272652_253_936 223
363 3300039450 Ga0436363_0357605 Ga0436363_0357605_686_1366 223
364 3300039453 Ga0436362_1127703 Ga0436362_1127703_3242_3922 223
365 3300044673 Ga0453683_0001529 Ga0453683_0001529_7222_7896 223
366 3300044673 Ga0453683_0050690 Ga0453683_0050690_1651_2331 223
367 3300044673 Ga0453683_0377908 Ga0453683_0377908_85_765 223
368 3300044712 Ga0453684_0781648 Ga0453684_0781648_258_938 223
369 3300044735 Ga0466968_0334656 Ga0466968_0334656_26_706 223
370 3300045049 Ga0466959_0258856 Ga0466959_0258856_224_904 223
371 3300045051 Ga0451576_0429091 Ga0451576_0429091_11_694 223
372 3300045051 Ga0451576_0442983 Ga0451576_0442983_267_947 223
373 3300045051 Ga0451576_1039546 Ga0451576_1039546_34_714 223
374 3300046462 Ga0495651_0015402 Ga0495651_0015402_1791_2471 223
375 3300046472 Ga0495580_0017063 Ga0495580_0017063_461_1144 223
376 3300046472 Ga0495580_0028282 Ga0495580_0028282_2185_2865 223
377 3300046472 Ga0495580_0056939 Ga0495580_0056939_437_1117 223
378 3300046472 Ga0495580_0147354 Ga0495580_0147354_724_1407 223
379 3300046472 Ga0495580_0243914 Ga0495580_0243914_512_1192 223
380 3300046475 Ga0495639_0124982 Ga0495639_0124982_39_719 223
381 3300046477 Ga0495664_0006147 Ga0495664_0006147_2762_3442 223
382 3300046477 Ga0495664_0043765 Ga0495664_0043765_1625_2305 223
383 3300046514 Ga0495618_0002180 Ga0495618_0002180_10301_10981 223
384 3300046516 Ga0495628_0000972 Ga0495628_0000972_17432_18112 223
385 3300046516 Ga0495628_0029864 Ga0495628_0029864_3354_4034 223
386 3300046517 Ga0495630_0067519 Ga0495630_0067519_844_1524 223
387 3300046526 Ga0495666_0082367 Ga0495666_0082367_137_817 223
388 3300046529 Ga0495652_0287037 Ga0495652_0287037_245_925 223
389 3300046533 Ga0495640_0086623 Ga0495640_0086623_753_1433 223
390 3300046535 Ga0495586_0001134 Ga0495586_0001134_3666_4346 223
391 3300046535 Ga0495586_0303533 Ga0495586_0303533_144_824 223
392 3300046543 Ga0495645_0002653 Ga0495645_0002653_5373_6053 223
393 3300046642 Ga0495634_0122166 Ga0495634_0122166_450_1130 223
394 3300046678 Ga0495599_0003376 Ga0495599_0003376_1209_1889 223
395 3300046678 Ga0495599_0092197 Ga0495599_0092197_161_841 223
396 3300046679 Ga0495623_0218210 Ga0495623_0218210_313_993 223
397 3300046680 Ga0495646_0106355 Ga0495646_0106355_18_698 223
398 3300046683 Ga0495658_0010975 Ga0495658_0010975_888_1574 223
399 3300046689 Ga0495613_0136147 Ga0495613_0136147_352_1032 223
400 3300046690 Ga0495624_0100630 Ga0495624_0100630_405_1085 223
401 3300046809 Ga0495600_0030238 Ga0495600_0030238_473_1153 223
402 3300047319 Ga0495674_0010402 Ga0495674_0010402_1909_2589 223
403 3300047319 Ga0495674_0273263 Ga0495674_0273263_202_882 223
404 3300047321 Ga0495676_0242498 Ga0495676_0242498_118_798 223
405 3300047444 Ga0495675_0137035 Ga0495675_0137035_793_1473 223
406 3300047471 Ga0495684_0028209 Ga0495684_0028209_2289_2969 223
407 3300047471 Ga0495684_0075738 Ga0495684_0075738_589_1275 223
408 3300048088 Ga0495602_0070786 Ga0495602_0070786_639_1319 223
409 3300048905 Ga0496102_0002856 Ga0496102_0002856_7393_8076 223
410 3300048906 Ga0496103_0066838 Ga0496103_0066838_132_815 223
411 3300048909 Ga0496106_0076073 Ga0496106_0076073_179_862 223
412 3300048910 Ga0496107_0391153 Ga0496107_0391153_144_827 223
413 3300048912 Ga0496109_0000107 Ga0496109_0000107_82089_82769 223
414 3300049586 Ga0501070_0726119 Ga0501070_0726119_33_713 223
415 3300049824 Ga0501045_0275618 Ga0501045_0275618_245_925 223
416 3300050507 nmdc:mga05p37_1196_c1 nmdc:mga05p37_1196_c1_4021_4701 223
417 3300050508 nmdc:mga09592_196910_c1 nmdc:mga09592_196910_c1_602_1282 223
418 3300050509 nmdc:mga0qj67_265494_c1 nmdc:mga0qj67_265494_c1_268_948 223
419 3300050510 nmdc:mga06r32_421064_c1 nmdc:mga06r32_421064_c1_244_924 223
420 3300050510 nmdc:mga06r32_425020_c1 nmdc:mga06r32_425020_c1_482_1162 223
421 3300050510 nmdc:mga06r32_741432_c1 nmdc:mga06r32_741432_c1_69_749 223
422 3300050511 nmdc:mga08y16_596178_c1 nmdc:mga08y16_596178_c1_299_979 223
423 3300050512 nmdc:mga0n895_159694_c1 nmdc:mga0n895_159694_c1_160_843 223
424 3300050512 nmdc:mga0n895_321109_c1 nmdc:mga0n895_321109_c1_875_1555 223
425 3300050513 nmdc:mga0rr50_167_c1 nmdc:mga0rr50_167_c1_5168_5848 223
426 3300050514 nmdc:mga08x19_8082_c1 nmdc:mga08x19_8082_c1_4046_4726 223
427 3300050515 nmdc:mga0a205_101951_c1 nmdc:mga0a205_101951_c1_667_1347 223
428 3300050515 nmdc:mga0a205_127657_c1 nmdc:mga0a205_127657_c1_1513_2193 223
429 3300050515 nmdc:mga0a205_464328_c1 nmdc:mga0a205_464328_c1_171_854 223
430 3300050515 nmdc:mga0a205_4746_c1 nmdc:mga0a205_4746_c1_852_1532 223
431 3300053108 Ga0500562_091688 Ga0500562_091688_117_797 223
432 3300053119 Ga0500595_008643 Ga0500595_008643_2001_2678 223
433 3300059493 Ga0587077_053961 Ga0587077_053961_132_812 223
434 3300059503 Ga0587080_044112 Ga0587080_044112_108_785 223
435 3300059645 Ga0587076_024485 Ga0587076_024485_313_993 223
436 3300005288 Ga0065714_10069362 Ga0065714_100693623 224
437 3300005329 Ga0070683_100823218 Ga0070683_1008232182 224
438 3300005437 Ga0070710_10182765 Ga0070710_101827652 224
439 3300005439 Ga0070711_100264786 Ga0070711_1002647861 224
440 3300005445 Ga0070708_100004780 Ga0070708_1000047806 224
441 3300005518 Ga0070699_100037296 Ga0070699_1000372964 224
442 3300005536 Ga0070697_100010650 Ga0070697_1000106502 224
443 3300005549 Ga0070704_100004479 Ga0070704_1000044792 224
444 3300005842 Ga0068858_100007767 Ga0068858_1000077674 224
445 3300005983 Ga0081540_1066650 Ga0081540_10666501 224
446 3300009093 Ga0105240_10000069 Ga0105240_1000006973 224
447 3300009545 Ga0105237_10113701 Ga0105237_101137012 224
448 3300013306 Ga0163162_10004081 Ga0163162_1000408118 224
449 3300025936 Ga0207670_10268637 Ga0207670_102686372 224
450 3300026035 Ga0207703_10009512 Ga0207703_100095122 224
451 3300026035 Ga0207703_10031274 Ga0207703_100312745 224
452 3300026078 Ga0207702_10596229 Ga0207702_105962292 224
453 3300037471 Ga0395905_0079643 Ga0395905_0079643_919_1647 224
454 3300038443 Ga0395901_0162050 Ga0395901_0162050_1393_2121 224
455 3300039437 Ga0436365_0816722 Ga0436365_0816722_581_1285 224
456 3300039437 Ga0436365_1217298 Ga0436365_1217298_1605_2282 224
457 3300046477 Ga0495664_0220235 Ga0495664_0220235_304_1002 224
458 3300048088 Ga0495602_0194988 Ga0495602_0194988_395_1108 224
459 3300003911 JGI25405J52794_10011653 JGI25405J52794_100116532 225
460 3300031235 Ga0265330_10018645 Ga0265330_100186455 225
461 3300031238 Ga0265332_10014628 Ga0265332_100146282 225
462 3300031241 Ga0265325_10001302 Ga0265325_1000130212 225
463 3300031249 Ga0265339_10028241 Ga0265339_100282412 225
464 3300031344 Ga0265316_10102836 Ga0265316_101028364 225
465 3300031595 Ga0265313_10083366 Ga0265313_100833662 225
466 3300031711 Ga0265314_10001380 Ga0265314_1000138023 225
467 3300031712 Ga0265342_10119863 Ga0265342_101198633 225
468 3300031733 Ga0316577_10011132 Ga0316577_100111322 225
469 3300035692 Ga0373935_0006457 Ga0373935_0006457_5003_5701 225
470 3300036401 Ga0373937_0418167 Ga0373937_0418167_145_843 225
471 3300036712 Ga0316584_0515836 Ga0316584_0515836_109_798 225
472 3300037068 Ga0373925_0001183 Ga0373925_0001183_19479_20177 225
473 3300046472 Ga0495580_0011364 Ga0495580_0011364_4645_5343 225
474 3300046473 Ga0495582_0007506 Ga0495582_0007506_1699_2397 225
475 3300046683 Ga0495658_0004835 Ga0495658_0004835_1284_1982 225
476 3300046689 Ga0495613_0350977 Ga0495613_0350977_24_722 225
477 3300049568 Ga0501031_0013420 Ga0501031_0013420_4336_5040 225
478 3300049569 Ga0501032_0090270 Ga0501032_0090270_475_1179 225
479 3300049570 Ga0501033_0098932 Ga0501033_0098932_107_817 225
480 3300049571 Ga0501034_0062462 Ga0501034_0062462_1090_1800 225
481 3300049574 Ga0501038_0035407 Ga0501038_0035407_172_876 225
482 3300049580 Ga0501046_0002062 Ga0501046_0002062_780_1490 225
483 3300049581 Ga0501047_0019360 Ga0501047_0019360_606_1316 225
484 3300049581 Ga0501047_0090675 Ga0501047_0090675_787_1491 225
485 3300049581 Ga0501047_0528231 Ga0501047_0528231_248_958 225
486 3300049586 Ga0501070_0000031 Ga0501070_0000031_121512_122216 225
487 3300049586 Ga0501070_0049651 Ga0501070_0049651_1046_1768 225
488 3300049586 Ga0501070_0145249 Ga0501070_0145249_502_1212 225
489 3300049742 Ga0501080_0005230 Ga0501080_0005230_4527_5231 225
490 3300049742 Ga0501080_0124897 Ga0501080_0124897_83_793 225
491 3300049742 Ga0501080_0290686 Ga0501080_0290686_503_1207 225
492 3300049823 Ga0501044_0069415 Ga0501044_0069415_2145_2855 225
493 3300049823 Ga0501044_0152796 Ga0501044_0152796_1377_2087 225
494 3300060353 Ga0501082_0310925 Ga0501082_0310925_128_832 225
495 3300002737 JGI25162J39368_1000005 JGI25162J39368_1000005296 226
496 3300010375 Ga0105239_10000032 Ga0105239_10000032136 226
497 3300025233 Ga0209437_100043 Ga0209437_100043111 226
498 3300047472 Ga0495686_0039296 Ga0495686_0039296_1683_2363 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

43

153

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

185

260

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9764 1 119
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9712 3 119
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9706 1 121
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9705 3 119
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9695 3 119
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9907 1 80 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9875 3 80 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9844 3 84 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9809 3 80 3.40.50.2300
af_P23836_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9766 3 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A849NIE5-F1-model_v4 Response regulator 0.9773 1 127 GO:0000156
GO:0000976
GO:0004016
GO:0005829
GO:0006355
GO:0009190
GO:0032993
AF-A0A6I5QSI8-F1-model_v4 Response regulator 0.9773 1 126 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A6I5QSI8-F1-model_v4 Response regulator 0.955 1 126 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A060VDP9-F1-model_v4 DNA-binding response regulator CreB 0.8343 1 162 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A6B1I0J4-F1-model_v4 Response regulator transcription factor 0.8325 1 146 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
89.6 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map