F455155
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 498 | 241 | 494 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100004780|Ga0070708_1000047806 |
| Length | 266 |
| Sequence | MKLCSDYIVAAQGTLLNAFSSSLRLQFIRKRQYTILRDSPMRILLVEDETKVSSFVARGLTAERFAVDVAADGQSGLELATTYAYDLIILDLMLPKMDGTQVLRRVRSQNSTVPVLILTARDAVADKVGNFEAGADDYLTKPFAFAELLVRVKALLRRGPVSRSSVVRVGDLELDRLSQQVRRSGKRIDLTSKEYSLLEYLMSNSGRVLSRTMIIEHVWDQSFDGITNIVDVYVRHLRNKVDDPYEHKLIRTVRGVGYTISNGAQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 2 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 3 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 4 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 86 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 89 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 124 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 125 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 126 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 131 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 132 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 135 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 140 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 141 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 142 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 143 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 145 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 146 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 154 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 156 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 157 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 162 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 163 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 164 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 165 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 166 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 167 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 168 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 169 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 170 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 171 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 172 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 173 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 176 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 207 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 208 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 209 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 212 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 213 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 214 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 215 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 227 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 237 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 238 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.19 |
| Metatranscriptomes | 1 |
| Isolates | 0.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.2 |
| Nodule | 0 |
| Rhizoplane | 1.2 |
| Rhizosphere | 92.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000005 | 3300002737 | Bacteria | 435925 |
| 2 | JGI25406J46586_10006217 | 3300003203 | Bacteria | 5514 |
| 3 | rootH2_10035222 | 3300003320 | Bacteria | 15394 |
| 4 | rootH2_10234348 | 3300003320 | Bacteria | 2923 |
| 5 | rootH1_10186427 | 3300003323 | Bacteria | 4626 |
| 6 | JGI25405J52794_10011653 | 3300003911 | Bacteria | 1684 |
| 7 | Ga0058862_10260855 | 3300004803 | Bacteria | 1400 |
| 8 | Ga0065714_10069362 | 3300005288 | Bacteria | 4258 |
| 9 | Ga0070658_10000306 | 3300005327 | Bacteria | 42420 |
| 10 | Ga0070658_10021685 | 3300005327 | Bacteria | 5148 |
| 11 | Ga0070658_10030299 | 3300005327 | Bacteria | 4347 |
| 12 | Ga0070683_100348244 | 3300005329 | Bacteria | 1411 |
| 13 | Ga0070683_100823218 | 3300005329 | Bacteria | 890 |
| 14 | Ga0070680_100347295 | 3300005336 | Bacteria | 1261 |
| 15 | Ga0070660_100005362 | 3300005339 | Bacteria | 8874 |
| 16 | Ga0070675_100312288 | 3300005354 | Bacteria | 1387 |
| 17 | Ga0070659_100225060 | 3300005366 | Bacteria | 1549 |
| 18 | Ga0070709_10023133 | 3300005434 | Bacteria | 3645 |
| 19 | Ga0070709_10053563 | 3300005434 | Bacteria | 2541 |
| 20 | Ga0070709_10130017 | 3300005434 | Bacteria | 1718 |
| 21 | Ga0070714_100244391 | 3300005435 | Bacteria | 1657 |
| 22 | Ga0070713_100004439 | 3300005436 | Bacteria | 9425 |
| 23 | Ga0070713_100028023 | 3300005436 | Bacteria | 4443 |
| 24 | Ga0070713_100097123 | 3300005436 | Bacteria | 2545 |
| 25 | Ga0070713_100120915 | 3300005436 | Bacteria | 2297 |
| 26 | Ga0070713_100127909 | 3300005436 | Bacteria | 2237 |
| 27 | Ga0070713_100156943 | 3300005436 | Bacteria | 2029 |
| 28 | Ga0070713_100173094 | 3300005436 | Unclassified | 1935 |
| 29 | Ga0070713_100227341 | 3300005436 | Bacteria | 1695 |
| 30 | Ga0070713_100286343 | 3300005436 | Bacteria | 1513 |
| 31 | Ga0070710_10000357 | 3300005437 | Bacteria | 21648 |
| 32 | Ga0070710_10094262 | 3300005437 | Unclassified | 1771 |
| 33 | Ga0070710_10182765 | 3300005437 | Bacteria | 1314 |
| 34 | Ga0070710_10255054 | 3300005437 | Bacteria | 1129 |
| 35 | Ga0070711_100264786 | 3300005439 | Bacteria | 1354 |
| 36 | Ga0070711_100557740 | 3300005439 | Bacteria | 951 |
| 37 | Ga0070700_100054630 | 3300005441 | Bacteria | 2497 |
| 38 | Ga0070700_100226791 | 3300005441 | Bacteria | 1327 |
| 39 | Ga0070694_100000726 | 3300005444 | Bacteria | 18391 |
| 40 | Ga0070708_100004780 | 3300005445 | Bacteria | 10677 |
| 41 | Ga0070708_100005254 | 3300005445 | Bacteria | 10251 |
| 42 | Ga0070708_100010340 | 3300005445 | Bacteria | 7557 |
| 43 | Ga0070708_100016008 | 3300005445 | Bacteria | 6211 |
| 44 | Ga0070708_100028494 | 3300005445 | Bacteria | 4806 |
| 45 | Ga0070708_100049696 | 3300005445 | Bacteria | 3711 |
| 46 | Ga0070708_100070582 | 3300005445 | Bacteria | 3143 |
| 47 | Ga0070708_100079677 | 3300005445 | Bacteria | 2963 |
| 48 | Ga0070708_100098664 | 3300005445 | Bacteria | 2671 |
| 49 | Ga0070708_100169442 | 3300005445 | Bacteria | 2038 |
| 50 | Ga0070708_100426916 | 3300005445 | Bacteria | 1250 |
| 51 | Ga0070681_10038246 | 3300005458 | Bacteria | 4810 |
| 52 | Ga0070681_10066912 | 3300005458 | Bacteria | 3562 |
| 53 | Ga0068867_100254163 | 3300005459 | Bacteria | 1430 |
| 54 | Ga0070706_100001465 | 3300005467 | Bacteria | 24824 |
| 55 | Ga0070706_100001640 | 3300005467 | Bacteria | 23302 |
| 56 | Ga0070706_100002806 | 3300005467 | Bacteria | 17428 |
| 57 | Ga0070706_100050195 | 3300005467 | Bacteria | 3850 |
| 58 | Ga0070706_100126413 | 3300005467 | Bacteria | 2384 |
| 59 | Ga0070707_100003063 | 3300005468 | Bacteria | 15838 |
| 60 | Ga0070707_100008458 | 3300005468 | Bacteria | 9558 |
| 61 | Ga0070707_100013999 | 3300005468 | Bacteria | 7515 |
| 62 | Ga0070707_100027539 | 3300005468 | Bacteria | 5408 |
| 63 | Ga0070707_100324621 | 3300005468 | Unclassified | 1496 |
| 64 | Ga0070698_100000542 | 3300005471 | Bacteria | 40354 |
| 65 | Ga0070698_100003505 | 3300005471 | Bacteria | 17262 |
| 66 | Ga0070698_100228583 | 3300005471 | Bacteria | 1793 |
| 67 | Ga0070699_100037296 | 3300005518 | Bacteria | 4205 |
| 68 | Ga0070699_100143169 | 3300005518 | Bacteria | 2112 |
| 69 | Ga0070699_100290096 | 3300005518 | Bacteria | 1467 |
| 70 | Ga0070679_100228695 | 3300005530 | Bacteria | 1820 |
| 71 | Ga0070679_100281651 | 3300005530 | Bacteria | 1615 |
| 72 | Ga0070679_100304806 | 3300005530 | Bacteria | 1543 |
| 73 | Ga0070679_100352556 | 3300005530 | Unclassified | 1419 |
| 74 | Ga0070684_100273172 | 3300005535 | Bacteria | 1548 |
| 75 | Ga0070697_100000141 | 3300005536 | Bacteria | 58102 |
| 76 | Ga0070697_100001137 | 3300005536 | Bacteria | 20128 |
| 77 | Ga0070697_100006676 | 3300005536 | Bacteria | 8953 |
| 78 | Ga0070697_100010121 | 3300005536 | Bacteria | 7356 |
| 79 | Ga0070697_100010650 | 3300005536 | Bacteria | 7175 |
| 80 | Ga0070697_100084093 | 3300005536 | Bacteria | 2624 |
| 81 | Ga0070697_100131295 | 3300005536 | Bacteria | 2101 |
| 82 | Ga0070697_100199516 | 3300005536 | Bacteria | 1700 |
| 83 | Ga0070697_100398982 | 3300005536 | Bacteria | 1193 |
| 84 | Ga0070697_100401874 | 3300005536 | Bacteria | 1189 |
| 85 | Ga0068853_100000008 | 3300005539 | Bacteria | 259050 |
| 86 | Ga0068853_100116775 | 3300005539 | Unclassified | 2376 |
| 87 | Ga0070686_100000163 | 3300005544 | Bacteria | 46117 |
| 88 | Ga0070695_100198777 | 3300005545 | Bacteria | 1431 |
| 89 | Ga0070693_100158628 | 3300005547 | Bacteria | 1439 |
| 90 | Ga0070665_100157717 | 3300005548 | Bacteria | 2271 |
| 91 | Ga0070704_100004479 | 3300005549 | Bacteria | 8067 |
| 92 | Ga0070704_100911316 | 3300005549 | Bacteria | 791 |
| 93 | Ga0068855_100029747 | 3300005563 | Bacteria | 6531 |
| 94 | Ga0068855_100103972 | 3300005563 | Bacteria | 3267 |
| 95 | Ga0068855_100136229 | 3300005563 | Unclassified | 2802 |
| 96 | Ga0068855_100308243 | 3300005563 | Bacteria | 1752 |
| 97 | Ga0068855_100342030 | 3300005563 | Bacteria | 1649 |
| 98 | Ga0068857_100571570 | 3300005577 | Bacteria | 1066 |
| 99 | Ga0068854_100054071 | 3300005578 | Bacteria | 2886 |
| 100 | Ga0068854_100613280 | 3300005578 | Bacteria | 930 |
| 101 | Ga0068856_100000067 | 3300005614 | Bacteria | 98357 |
| 102 | Ga0068856_100120798 | 3300005614 | Bacteria | 2621 |
| 103 | Ga0068856_100510393 | 3300005614 | Bacteria | 1223 |
| 104 | Ga0068856_100816558 | 3300005614 | Bacteria | 952 |
| 105 | Ga0068852_100019153 | 3300005616 | Bacteria | 5409 |
| 106 | Ga0068863_100077387 | 3300005841 | Bacteria | 3148 |
| 107 | Ga0068863_101141657 | 3300005841 | Bacteria | 784 |
| 108 | Ga0068858_100007767 | 3300005842 | Bacteria | 10357 |
| 109 | Ga0068858_100067237 | 3300005842 | Bacteria | 3319 |
| 110 | Ga0068860_100692976 | 3300005843 | Bacteria | 1028 |
| 111 | Ga0068862_100953590 | 3300005844 | Unclassified | 846 |
| 112 | Ga0081455_10020720 | 3300005937 | Bacteria | 6183 |
| 113 | Ga0081540_1066650 | 3300005983 | Bacteria | 1686 |
| 114 | Ga0081539_10000732 | 3300005985 | Bacteria | 65756 |
| 115 | Ga0081539_10002589 | 3300005985 | Bacteria | 24876 |
| 116 | Ga0081539_10010453 | 3300005985 | Bacteria | 7534 |
| 117 | Ga0081539_10054207 | 3300005985 | Bacteria | 2240 |
| 118 | Ga0070717_10001440 | 3300006028 | Bacteria | 16406 |
| 119 | Ga0070717_10004886 | 3300006028 | Bacteria | 9755 |
| 120 | Ga0070717_10006680 | 3300006028 | Bacteria | 8507 |
| 121 | Ga0070717_10013997 | 3300006028 | Bacteria | 6162 |
| 122 | Ga0070717_10162500 | 3300006028 | Bacteria | 1938 |
| 123 | Ga0070717_10346135 | 3300006028 | Bacteria | 1328 |
| 124 | Ga0070717_10517605 | 3300006028 | Unclassified | 1079 |
| 125 | Ga0070717_10981039 | 3300006028 | Bacteria | 769 |
| 126 | Ga0075365_10434701 | 3300006038 | Bacteria | 927 |
| 127 | Ga0070715_10080937 | 3300006163 | Bacteria | 1474 |
| 128 | Ga0070716_100004067 | 3300006173 | Bacteria | 6942 |
| 129 | Ga0070716_100248028 | 3300006173 | Bacteria | 1211 |
| 130 | Ga0070712_100006976 | 3300006175 | Bacteria | 7043 |
| 131 | Ga0070712_100804026 | 3300006175 | Unclassified | 807 |
| 132 | Ga0097621_100353627 | 3300006237 | Bacteria | 1307 |
| 133 | Ga0075428_100713920 | 3300006844 | Bacteria | 1068 |
| 134 | Ga0075431_100027479 | 3300006847 | Bacteria | 5839 |
| 135 | Ga0075431_100027752 | 3300006847 | Bacteria | 5810 |
| 136 | Ga0075431_100093647 | 3300006847 | Bacteria | 3100 |
| 137 | Ga0075431_100122793 | 3300006847 | Bacteria | 2679 |
| 138 | Ga0075431_100282042 | 3300006847 | Bacteria | 1682 |
| 139 | Ga0075431_100439389 | 3300006847 | Bacteria | 1302 |
| 140 | Ga0075433_10009731 | 3300006852 | Bacteria | 7700 |
| 141 | Ga0075433_10015987 | 3300006852 | Bacteria | 6172 |
| 142 | Ga0075433_10087811 | 3300006852 | Bacteria | 2747 |
| 143 | Ga0075433_10708706 | 3300006852 | Bacteria | 881 |
| 144 | Ga0075434_100012176 | 3300006871 | Bacteria | 8148 |
| 145 | Ga0075434_100262767 | 3300006871 | Bacteria | 1745 |
| 146 | Ga0075434_100326860 | 3300006871 | Bacteria | 1554 |
| 147 | Ga0075429_100257221 | 3300006880 | Bacteria | 1529 |
| 148 | Ga0075429_100483979 | 3300006880 | Bacteria | 1084 |
| 149 | Ga0075436_100013666 | 3300006914 | Bacteria | 5562 |
| 150 | Ga0075435_100002261 | 3300007076 | Bacteria | 12724 |
| 151 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 152 | Ga0105240_10000069 | 3300009093 | Bacteria | 205335 |
| 153 | Ga0105240_10014910 | 3300009093 | Bacteria | 10588 |
| 154 | Ga0105240_10042688 | 3300009093 | Bacteria | 5777 |
| 155 | Ga0105240_10060316 | 3300009093 | Unclassified | 4729 |
| 156 | Ga0105240_10115009 | 3300009093 | Unclassified | 3249 |
| 157 | Ga0105240_10195867 | 3300009093 | Bacteria | 2373 |
| 158 | Ga0105240_10769176 | 3300009093 | Bacteria | 1045 |
| 159 | Ga0111539_10508634 | 3300009094 | Bacteria | 1403 |
| 160 | Ga0111539_10778031 | 3300009094 | Bacteria | 1114 |
| 161 | Ga0105245_10043635 | 3300009098 | Bacteria | 4000 |
| 162 | Ga0105247_10021561 | 3300009101 | Bacteria | 3877 |
| 163 | Ga0114129_10131044 | 3300009147 | Bacteria | 3443 |
| 164 | Ga0105241_10256852 | 3300009174 | Bacteria | 1484 |
| 165 | Ga0105248_10090097 | 3300009177 | Bacteria | 3453 |
| 166 | Ga0105248_10225002 | 3300009177 | Bacteria | 2112 |
| 167 | Ga0105237_10001617 | 3300009545 | Bacteria | 29249 |
| 168 | Ga0105237_10113701 | 3300009545 | Bacteria | 2699 |
| 169 | Ga0105238_10040158 | 3300009551 | Bacteria | 4742 |
| 170 | Ga0105238_10100993 | 3300009551 | Bacteria | 2867 |
| 171 | Ga0105239_10000032 | 3300010375 | Bacteria | 225528 |
| 172 | Ga0105239_10198187 | 3300010375 | Unclassified | 2249 |
| 173 | Ga0105239_10314228 | 3300010375 | Bacteria | 1766 |
| 174 | Ga0157370_10006891 | 3300013104 | Bacteria | 12438 |
| 175 | Ga0157370_10018779 | 3300013104 | Bacteria | 6951 |
| 176 | Ga0157370_10105317 | 3300013104 | Bacteria | 2640 |
| 177 | Ga0157370_10151673 | 3300013104 | Bacteria | 2156 |
| 178 | Ga0157369_10011151 | 3300013105 | Bacteria | 10218 |
| 179 | Ga0157369_10069219 | 3300013105 | Bacteria | 3792 |
| 180 | Ga0157369_10177447 | 3300013105 | Bacteria | 2242 |
| 181 | Ga0157369_10539049 | 3300013105 | Bacteria | 1207 |
| 182 | Ga0157374_10217384 | 3300013296 | Bacteria | 1875 |
| 183 | Ga0157374_10372176 | 3300013296 | Bacteria | 1422 |
| 184 | Ga0157378_10084464 | 3300013297 | Bacteria | 2874 |
| 185 | Ga0157378_10104125 | 3300013297 | Bacteria | 2594 |
| 186 | Ga0157378_10444529 | 3300013297 | Bacteria | 1286 |
| 187 | Ga0163162_10004081 | 3300013306 | Bacteria | 14013 |
| 188 | Ga0157372_10012429 | 3300013307 | Bacteria | 9075 |
| 189 | Ga0157372_10018353 | 3300013307 | Bacteria | 7519 |
| 190 | Ga0157372_10050439 | 3300013307 | Unclassified | 4629 |
| 191 | Ga0157372_10175085 | 3300013307 | Unclassified | 2483 |
| 192 | Ga0157372_10175986 | 3300013307 | Bacteria | 2477 |
| 193 | Ga0163163_10361420 | 3300014325 | Bacteria | 1508 |
| 194 | Ga0157379_10014712 | 3300014968 | Bacteria | 6863 |
| 195 | Ga0197907_11192561 | 3300020069 | Bacteria | 873 |
| 196 | Ga0213873_10003483 | 3300021358 | Bacteria | 2835 |
| 197 | Ga0213874_10010809 | 3300021377 | Bacteria | 2295 |
| 198 | Ga0213874_10177721 | 3300021377 | Unclassified | 756 |
| 199 | Ga0213876_10027624 | 3300021384 | Bacteria | 2993 |
| 200 | Ga0213871_10014732 | 3300021441 | Bacteria | 1860 |
| 201 | Ga0209437_100043 | 3300025233 | Bacteria | 440454 |
| 202 | Ga0207692_10000177 | 3300025898 | Bacteria | 20491 |
| 203 | Ga0207692_10155037 | 3300025898 | Bacteria | 1315 |
| 204 | Ga0207692_10167431 | 3300025898 | Bacteria | 1271 |
| 205 | Ga0207710_10031468 | 3300025900 | Bacteria | 2320 |
| 206 | Ga0207685_10169256 | 3300025905 | Bacteria | 1004 |
| 207 | Ga0207699_10016052 | 3300025906 | Bacteria | 3907 |
| 208 | Ga0207699_10047872 | 3300025906 | Bacteria | 2509 |
| 209 | Ga0207699_10155136 | 3300025906 | Bacteria | 1519 |
| 210 | Ga0207699_10653389 | 3300025906 | Bacteria | 768 |
| 211 | Ga0207705_10003558 | 3300025909 | Bacteria | 11862 |
| 212 | Ga0207705_10017092 | 3300025909 | Bacteria | 5197 |
| 213 | Ga0207705_10037857 | 3300025909 | Bacteria | 3452 |
| 214 | Ga0207684_10016658 | 3300025910 | Bacteria | 6311 |
| 215 | Ga0207684_10021279 | 3300025910 | Bacteria | 5537 |
| 216 | Ga0207684_10260789 | 3300025910 | Bacteria | 1495 |
| 217 | Ga0207684_10360288 | 3300025910 | Bacteria | 1251 |
| 218 | Ga0207684_10456220 | 3300025910 | Bacteria | 1097 |
| 219 | Ga0207654_10131762 | 3300025911 | Bacteria | 1583 |
| 220 | Ga0207707_10011303 | 3300025912 | Bacteria | 7771 |
| 221 | Ga0207707_10078351 | 3300025912 | Bacteria | 2886 |
| 222 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 223 | Ga0207695_10000186 | 3300025913 | Bacteria | 179847 |
| 224 | Ga0207695_10011398 | 3300025913 | Bacteria | 10776 |
| 225 | Ga0207695_10025305 | 3300025913 | Bacteria | 6649 |
| 226 | Ga0207695_10332463 | 3300025913 | Bacteria | 1408 |
| 227 | Ga0207695_10696049 | 3300025913 | Bacteria | 897 |
| 228 | Ga0207671_10002113 | 3300025914 | Bacteria | 21691 |
| 229 | Ga0207693_10090981 | 3300025915 | Bacteria | 2392 |
| 230 | Ga0207693_10316308 | 3300025915 | Bacteria | 1222 |
| 231 | Ga0207660_10142381 | 3300025917 | Bacteria | 1834 |
| 232 | Ga0207660_10467731 | 3300025917 | Bacteria | 1021 |
| 233 | Ga0207662_10116533 | 3300025918 | Bacteria | 1671 |
| 234 | Ga0207657_10029570 | 3300025919 | Bacteria | 4985 |
| 235 | Ga0207657_10326593 | 3300025919 | Bacteria | 1212 |
| 236 | Ga0207652_10066034 | 3300025921 | Bacteria | 3134 |
| 237 | Ga0207652_10267012 | 3300025921 | Bacteria | 1543 |
| 238 | Ga0207652_10284807 | 3300025921 | Unclassified | 1491 |
| 239 | Ga0207652_10854829 | 3300025921 | Bacteria | 805 |
| 240 | Ga0207646_10063970 | 3300025922 | Bacteria | 3284 |
| 241 | Ga0207646_10091098 | 3300025922 | Bacteria | 2729 |
| 242 | Ga0207646_10105674 | 3300025922 | Bacteria | 2525 |
| 243 | Ga0207646_10145866 | 3300025922 | Bacteria | 2133 |
| 244 | Ga0207646_10278726 | 3300025922 | Unclassified | 1511 |
| 245 | Ga0207646_10577261 | 3300025922 | Bacteria | 1010 |
| 246 | Ga0207694_10009926 | 3300025924 | Bacteria | 7184 |
| 247 | Ga0207694_10022721 | 3300025924 | Bacteria | 4758 |
| 248 | Ga0207687_10074701 | 3300025927 | Bacteria | 2430 |
| 249 | Ga0207700_10011144 | 3300025928 | Bacteria | 5718 |
| 250 | Ga0207700_10019772 | 3300025928 | Bacteria | 4555 |
| 251 | Ga0207700_10020103 | 3300025928 | Bacteria | 4526 |
| 252 | Ga0207700_10086061 | 3300025928 | Bacteria | 2469 |
| 253 | Ga0207700_10093505 | 3300025928 | Bacteria | 2380 |
| 254 | Ga0207700_10175662 | 3300025928 | Bacteria | 1790 |
| 255 | Ga0207700_10332290 | 3300025928 | Bacteria | 1319 |
| 256 | Ga0207664_10180738 | 3300025929 | Bacteria | 1811 |
| 257 | Ga0207664_10290530 | 3300025929 | Unclassified | 1436 |
| 258 | Ga0207664_10386268 | 3300025929 | Bacteria | 1243 |
| 259 | Ga0207664_10502543 | 3300025929 | Bacteria | 1086 |
| 260 | Ga0207670_10268637 | 3300025936 | Bacteria | 1325 |
| 261 | Ga0207665_10000256 | 3300025939 | Bacteria | 36790 |
| 262 | Ga0207665_10085376 | 3300025939 | Bacteria | 2179 |
| 263 | Ga0207665_10129970 | 3300025939 | Bacteria | 1786 |
| 264 | Ga0207665_10135221 | 3300025939 | Bacteria | 1754 |
| 265 | Ga0207661_10230774 | 3300025944 | Bacteria | 1639 |
| 266 | Ga0207667_10022219 | 3300025949 | Bacteria | 7014 |
| 267 | Ga0207667_10027314 | 3300025949 | Bacteria | 6214 |
| 268 | Ga0207667_10041664 | 3300025949 | Bacteria | 4882 |
| 269 | Ga0207667_10158262 | 3300025949 | Unclassified | 2331 |
| 270 | Ga0207667_10158989 | 3300025949 | Bacteria | 2325 |
| 271 | Ga0207667_10219234 | 3300025949 | Bacteria | 1949 |
| 272 | Ga0207667_10230221 | 3300025949 | Bacteria | 1898 |
| 273 | Ga0207640_10636026 | 3300025981 | Bacteria | 907 |
| 274 | Ga0207703_10009512 | 3300026035 | Bacteria | 7626 |
| 275 | Ga0207703_10031274 | 3300026035 | Bacteria | 4208 |
| 276 | Ga0207703_10104739 | 3300026035 | Bacteria | 2404 |
| 277 | Ga0207703_10780837 | 3300026035 | Bacteria | 911 |
| 278 | Ga0207639_10000014 | 3300026041 | Bacteria | 274629 |
| 279 | Ga0207639_10092481 | 3300026041 | Bacteria | 2424 |
| 280 | Ga0207708_10019777 | 3300026075 | Bacteria | 5077 |
| 281 | Ga0207702_10001092 | 3300026078 | Bacteria | 27756 |
| 282 | Ga0207702_10104069 | 3300026078 | Bacteria | 2511 |
| 283 | Ga0207702_10596229 | 3300026078 | Bacteria | 1084 |
| 284 | Ga0207641_10003313 | 3300026088 | Bacteria | 14328 |
| 285 | Ga0207674_10596126 | 3300026116 | Bacteria | 1067 |
| 286 | Ga0207698_10007154 | 3300026142 | Bacteria | 6991 |
| 287 | Ga0268266_10493521 | 3300028379 | Bacteria | 1168 |
| 288 | Ga0265337_1027920 | 3300028556 | Bacteria | 1697 |
| 289 | Ga0265326_10009140 | 3300028558 | Bacteria | 2966 |
| 290 | Ga0265336_10000551 | 3300028666 | Bacteria | 21372 |
| 291 | Ga0265338_10001482 | 3300028800 | Bacteria | 38038 |
| 292 | Ga0265338_10003414 | 3300028800 | Bacteria | 22405 |
| 293 | Ga0265338_10007107 | 3300028800 | Bacteria | 14026 |
| 294 | Ga0265338_10014683 | 3300028800 | Bacteria | 8682 |
| 295 | Ga0265338_10022214 | 3300028800 | Bacteria | 6578 |
| 296 | Ga0265338_10030729 | 3300028800 | Bacteria | 5282 |
| 297 | Ga0265338_10232689 | 3300028800 | Bacteria | 1369 |
| 298 | Ga0265324_10000110 | 3300029957 | Bacteria | 65065 |
| 299 | Ga0265330_10018645 | 3300031235 | Bacteria | 3186 |
| 300 | Ga0265332_10014628 | 3300031238 | Bacteria | 3470 |
| 301 | Ga0265320_10032981 | 3300031240 | Bacteria | 2647 |
| 302 | Ga0265320_10117778 | 3300031240 | Bacteria | 1213 |
| 303 | Ga0265325_10001302 | 3300031241 | Bacteria | 17663 |
| 304 | Ga0265339_10028241 | 3300031249 | Bacteria | 3192 |
| 305 | Ga0265339_10141341 | 3300031249 | Bacteria | 1224 |
| 306 | Ga0265331_10004464 | 3300031250 | Bacteria | 8738 |
| 307 | Ga0265327_10003537 | 3300031251 | Bacteria | 14808 |
| 308 | Ga0265316_10002940 | 3300031344 | Bacteria | 17440 |
| 309 | Ga0265316_10102836 | 3300031344 | Bacteria | 2170 |
| 310 | Ga0265313_10083366 | 3300031595 | Bacteria | 1448 |
| 311 | Ga0265314_10000406 | 3300031711 | Bacteria | 58465 |
| 312 | Ga0265314_10001380 | 3300031711 | Bacteria | 27286 |
| 313 | Ga0265314_10172228 | 3300031711 | Bacteria | 1305 |
| 314 | Ga0265314_10187481 | 3300031711 | Bacteria | 1233 |
| 315 | Ga0265342_10119863 | 3300031712 | Bacteria | 1482 |
| 316 | Ga0265342_10253951 | 3300031712 | Bacteria | 937 |
| 317 | Ga0316576_10012737 | 3300031727 | Bacteria | 5564 |
| 318 | Ga0316577_10011132 | 3300031733 | Bacteria | 4867 |
| 319 | Ga0307406_10057503 | 3300031901 | Unclassified | 2495 |
| 320 | Ga0373926_0010673 | 3300035083 | Bacteria | 3081 |
| 321 | Ga0373926_0034270 | 3300035083 | Bacteria | 1796 |
| 322 | Ga0373944_0033597 | 3300035089 | Unclassified | 1555 |
| 323 | Ga0373923_0125403 | 3300035111 | Bacteria | 1150 |
| 324 | Ga0373936_0005665 | 3300035113 | Bacteria | 4711 |
| 325 | Ga0373945_0007027 | 3300035116 | Bacteria | 3641 |
| 326 | Ga0373953_0001890 | 3300035117 | Bacteria | 6207 |
| 327 | Ga0373954_0016125 | 3300035118 | Bacteria | 3343 |
| 328 | Ga0373956_0138950 | 3300035119 | Bacteria | 1140 |
| 329 | Ga0373943_0009015 | 3300035170 | Bacteria | 4472 |
| 330 | Ga0373946_0010701 | 3300035171 | Bacteria | 3405 |
| 331 | Ga0373946_0022107 | 3300035171 | Bacteria | 2473 |
| 332 | Ga0373955_0057096 | 3300035172 | Bacteria | 2143 |
| 333 | Ga0373924_0000007 | 3300035410 | Bacteria | 54976 |
| 334 | Ga0373924_0013082 | 3300035410 | Bacteria | 3114 |
| 335 | Ga0373935_0006457 | 3300035692 | Bacteria | 7002 |
| 336 | Ga0373935_0017263 | 3300035692 | Unclassified | 4376 |
| 337 | Ga0373935_0018970 | 3300035692 | Bacteria | 4193 |
| 338 | Ga0373935_0122110 | 3300035692 | Bacteria | 1742 |
| 339 | Ga0373927_0030961 | 3300035695 | Bacteria | 3490 |
| 340 | Ga0373927_0037768 | 3300035695 | Bacteria | 3137 |
| 341 | Ga0373927_0294937 | 3300035695 | Bacteria | 1067 |
| 342 | Ga0373933_0006560 | 3300035724 | Bacteria | 6341 |
| 343 | Ga0373947_0001475 | 3300035725 | Bacteria | 14477 |
| 344 | Ga0373947_0002508 | 3300035725 | Bacteria | 11028 |
| 345 | Ga0373947_0377883 | 3300035725 | Bacteria | 953 |
| 346 | Ga0373947_0423678 | 3300035725 | Bacteria | 900 |
| 347 | Ga0373937_0059851 | 3300036401 | Bacteria | 3500 |
| 348 | Ga0373937_0172963 | 3300036401 | Bacteria | 2027 |
| 349 | Ga0373937_0409143 | 3300036401 | Unclassified | 1287 |
| 350 | Ga0373937_0418167 | 3300036401 | Bacteria | 1272 |
| 351 | Ga0316584_0515836 | 3300036712 | Bacteria | 838 |
| 352 | Ga0373925_0001183 | 3300037068 | Bacteria | 23049 |
| 353 | Ga0373925_0001474 | 3300037068 | Bacteria | 20256 |
| 354 | Ga0373925_0259002 | 3300037068 | Bacteria | 1397 |
| 355 | Ga0373925_0347353 | 3300037068 | Bacteria | 1204 |
| 356 | Ga0373925_0354472 | 3300037068 | Bacteria | 1192 |
| 357 | Ga0395905_0078196 | 3300037471 | Bacteria | 3100 |
| 358 | Ga0395905_0079643 | 3300037471 | Bacteria | 3071 |
| 359 | Ga0395905_0713976 | 3300037471 | Unclassified | 905 |
| 360 | Ga0436364_0372361 | 3300037853 | Bacteria | 1649 |
| 361 | Ga0436364_1465067 | 3300037853 | Unclassified | 795 |
| 362 | Ga0395901_0119465 | 3300038443 | Bacteria | 2770 |
| 363 | Ga0395901_0162050 | 3300038443 | Bacteria | 2349 |
| 364 | Ga0395901_0218494 | 3300038443 | Bacteria | 1993 |
| 365 | Ga0436365_0816722 | 3300039437 | Bacteria | 1658 |
| 366 | Ga0436365_1183338 | 3300039437 | Bacteria | 3840 |
| 367 | Ga0436365_1217298 | 3300039437 | Bacteria | 3002 |
| 368 | Ga0436360_0774108 | 3300039438 | Unclassified | 1670 |
| 369 | Ga0436361_0050405 | 3300039447 | Bacteria | 1792 |
| 370 | Ga0436361_0723366 | 3300039447 | Bacteria | 804 |
| 371 | Ga0436363_0220347 | 3300039450 | Bacteria | 933 |
| 372 | Ga0436363_0272652 | 3300039450 | Bacteria | 1143 |
| 373 | Ga0436363_0357605 | 3300039450 | Unclassified | 1720 |
| 374 | Ga0436362_1127703 | 3300039453 | Bacteria | 9079 |
| 375 | Ga0451853_3163402 | 3300041512 | Bacteria | 1951 |
| 376 | Ga0453683_0001529 | 3300044673 | Bacteria | 19727 |
| 377 | Ga0453683_0050690 | 3300044673 | Bacteria | 2601 |
| 378 | Ga0453683_0377908 | 3300044673 | Bacteria | 912 |
| 379 | Ga0466966_0058134 | 3300044684 | Bacteria | 2445 |
| 380 | Ga0453684_0781648 | 3300044712 | Bacteria | 1031 |
| 381 | Ga0466968_0334656 | 3300044735 | Bacteria | 733 |
| 382 | Ga0466959_0258856 | 3300045049 | Bacteria | 1198 |
| 383 | Ga0451576_0003294 | 3300045051 | Bacteria | 22423 |
| 384 | Ga0451576_0429091 | 3300045051 | Bacteria | 1387 |
| 385 | Ga0451576_0442983 | 3300045051 | Unclassified | 1363 |
| 386 | Ga0451576_0576130 | 3300045051 | Bacteria | 1183 |
| 387 | Ga0451576_1039546 | 3300045051 | Bacteria | 858 |
| 388 | Ga0495629_0230376 | 3300046459 | Bacteria | 1277 |
| 389 | Ga0495651_0015402 | 3300046462 | Bacteria | 5913 |
| 390 | Ga0495580_0011364 | 3300046472 | Bacteria | 6890 |
| 391 | Ga0495580_0017063 | 3300046472 | Bacteria | 5439 |
| 392 | Ga0495580_0028282 | 3300046472 | Bacteria | 4076 |
| 393 | Ga0495580_0056939 | 3300046472 | Bacteria | 2752 |
| 394 | Ga0495580_0147354 | 3300046472 | Bacteria | 1631 |
| 395 | Ga0495580_0243914 | 3300046472 | Bacteria | 1231 |
| 396 | Ga0495582_0007506 | 3300046473 | Bacteria | 6029 |
| 397 | Ga0495639_0124982 | 3300046475 | Bacteria | 1229 |
| 398 | Ga0495664_0006147 | 3300046477 | Bacteria | 6628 |
| 399 | Ga0495664_0043765 | 3300046477 | Bacteria | 2653 |
| 400 | Ga0495664_0220235 | 3300046477 | Bacteria | 1149 |
| 401 | Ga0495618_0002180 | 3300046514 | Bacteria | 12798 |
| 402 | Ga0495620_0034806 | 3300046515 | Bacteria | 2272 |
| 403 | Ga0495628_0000972 | 3300046516 | Bacteria | 26183 |
| 404 | Ga0495628_0029864 | 3300046516 | Unclassified | 4418 |
| 405 | Ga0495630_0000090 | 3300046517 | Bacteria | 71226 |
| 406 | Ga0495630_0067519 | 3300046517 | Bacteria | 2688 |
| 407 | Ga0495666_0000375 | 3300046526 | Bacteria | 19632 |
| 408 | Ga0495666_0082367 | 3300046526 | Bacteria | 1521 |
| 409 | Ga0495652_0287037 | 3300046529 | Unclassified | 1202 |
| 410 | Ga0495640_0086623 | 3300046533 | Bacteria | 2073 |
| 411 | Ga0495586_0000059 | 3300046535 | Bacteria | 66207 |
| 412 | Ga0495586_0001134 | 3300046535 | Bacteria | 14970 |
| 413 | Ga0495586_0303533 | 3300046535 | Bacteria | 915 |
| 414 | Ga0495645_0002653 | 3300046543 | Bacteria | 12162 |
| 415 | Ga0495634_0122166 | 3300046642 | Bacteria | 1667 |
| 416 | Ga0495599_0003376 | 3300046678 | Bacteria | 9336 |
| 417 | Ga0495599_0092197 | 3300046678 | Unclassified | 1890 |
| 418 | Ga0495623_0218210 | 3300046679 | Bacteria | 1088 |
| 419 | Ga0495646_0106355 | 3300046680 | Unclassified | 1602 |
| 420 | Ga0495658_0004835 | 3300046683 | Bacteria | 6609 |
| 421 | Ga0495658_0010975 | 3300046683 | Bacteria | 4542 |
| 422 | Ga0495613_0136147 | 3300046689 | Unclassified | 1757 |
| 423 | Ga0495613_0350977 | 3300046689 | Bacteria | 1013 |
| 424 | Ga0495624_0100630 | 3300046690 | Bacteria | 1779 |
| 425 | Ga0495624_0470874 | 3300046690 | Bacteria | 752 |
| 426 | Ga0495600_0030238 | 3300046809 | Bacteria | 3508 |
| 427 | Ga0495581_0179002 | 3300047315 | Bacteria | 1240 |
| 428 | Ga0495674_0000212 | 3300047319 | Bacteria | 48127 |
| 429 | Ga0495674_0010402 | 3300047319 | Bacteria | 8809 |
| 430 | Ga0495674_0273263 | 3300047319 | Bacteria | 1386 |
| 431 | Ga0495676_0242498 | 3300047321 | Bacteria | 1233 |
| 432 | Ga0495675_0137035 | 3300047444 | Unclassified | 1519 |
| 433 | Ga0495684_0028209 | 3300047471 | Bacteria | 4310 |
| 434 | Ga0495684_0075738 | 3300047471 | Bacteria | 2556 |
| 435 | Ga0495684_0464290 | 3300047471 | Bacteria | 877 |
| 436 | Ga0495686_0039296 | 3300047472 | Bacteria | 3023 |
| 437 | Ga0495602_0070786 | 3300048088 | Bacteria | 2982 |
| 438 | Ga0495602_0194988 | 3300048088 | Unclassified | 1550 |
| 439 | Ga0496102_0002856 | 3300048905 | Bacteria | 14671 |
| 440 | Ga0496103_0066838 | 3300048906 | Bacteria | 2244 |
| 441 | Ga0496106_0076073 | 3300048909 | Bacteria | 2573 |
| 442 | Ga0496107_0391153 | 3300048910 | Bacteria | 1034 |
| 443 | Ga0496109_0000107 | 3300048912 | Bacteria | 86168 |
| 444 | Ga0496115_0566063 | 3300048918 | Bacteria | 907 |
| 445 | Ga0496119_0190295 | 3300048922 | Bacteria | 1070 |
| 446 | Ga0496125_0403007 | 3300048928 | Bacteria | 799 |
| 447 | Ga0496126_0003335 | 3300048929 | Bacteria | 20410 |
| 448 | Ga0496126_0162715 | 3300048929 | Bacteria | 1906 |
| 449 | Ga0496126_0238352 | 3300048929 | Bacteria | 1521 |
| 450 | Ga0501031_0013420 | 3300049568 | Bacteria | 5344 |
| 451 | Ga0501032_0090270 | 3300049569 | Bacteria | 2033 |
| 452 | Ga0501033_0098932 | 3300049570 | Bacteria | 2130 |
| 453 | Ga0501034_0062462 | 3300049571 | Bacteria | 3740 |
| 454 | Ga0501038_0035407 | 3300049574 | Bacteria | 4383 |
| 455 | Ga0501046_0002062 | 3300049580 | Bacteria | 19066 |
| 456 | Ga0501047_0019360 | 3300049581 | Bacteria | 6529 |
| 457 | Ga0501047_0090675 | 3300049581 | Bacteria | 2934 |
| 458 | Ga0501047_0528231 | 3300049581 | Bacteria | 1005 |
| 459 | Ga0501070_0000031 | 3300049586 | Bacteria | 138137 |
| 460 | Ga0501070_0049651 | 3300049586 | Bacteria | 3484 |
| 461 | Ga0501070_0145249 | 3300049586 | Bacteria | 1958 |
| 462 | Ga0501070_0726119 | 3300049586 | Bacteria | 784 |
| 463 | Ga0501080_0005230 | 3300049742 | Bacteria | 11560 |
| 464 | Ga0501080_0124897 | 3300049742 | Bacteria | 2384 |
| 465 | Ga0501080_0290686 | 3300049742 | Bacteria | 1484 |
| 466 | Ga0501044_0069415 | 3300049823 | Bacteria | 3587 |
| 467 | Ga0501044_0152796 | 3300049823 | Bacteria | 2290 |
| 468 | Ga0501045_0275618 | 3300049824 | Bacteria | 1252 |
| 469 | nmdc:mga0yw44_186854_c1 | 3300050492 | Bacteria | 1365 |
| 470 | nmdc:mga05p37_1196_c1 | 3300050507 | Bacteria | 29998 |
| 471 | nmdc:mga09592_196910_c1 | 3300050508 | Bacteria | 1744 |
| 472 | nmdc:mga0qj67_265494_c1 | 3300050509 | Bacteria | 1392 |
| 473 | nmdc:mga06r32_421064_c1 | 3300050510 | Bacteria | 1317 |
| 474 | nmdc:mga06r32_425020_c1 | 3300050510 | Bacteria | 1310 |
| 475 | nmdc:mga06r32_4831_c2 | 3300050510 | Bacteria | 8793 |
| 476 | nmdc:mga06r32_741432_c1 | 3300050510 | Bacteria | 946 |
| 477 | nmdc:mga08y16_407647_c1 | 3300050511 | Bacteria | 1390 |
| 478 | nmdc:mga08y16_429199_c1 | 3300050511 | Bacteria | 1350 |
| 479 | nmdc:mga08y16_596178_c1 | 3300050511 | Bacteria | 1114 |
| 480 | nmdc:mga0n895_159694_c1 | 3300050512 | Unclassified | 2285 |
| 481 | nmdc:mga0n895_321109_c1 | 3300050512 | Bacteria | 1569 |
| 482 | nmdc:mga0n895_368751_c1 | 3300050512 | Bacteria | 1454 |
| 483 | nmdc:mga0rr50_167_c1 | 3300050513 | Bacteria | 31282 |
| 484 | nmdc:mga08x19_8082_c1 | 3300050514 | Bacteria | 6251 |
| 485 | nmdc:mga0a205_101951_c1 | 3300050515 | Bacteria | 2769 |
| 486 | nmdc:mga0a205_127657_c1 | 3300050515 | Bacteria | 2443 |
| 487 | nmdc:mga0a205_464328_c1 | 3300050515 | Bacteria | 1125 |
| 488 | nmdc:mga0a205_4746_c1 | 3300050515 | Bacteria | 12212 |
| 489 | Ga0500562_091688 | 3300053108 | Bacteria | 825 |
| 490 | Ga0500595_008643 | 3300053119 | Bacteria | 4154 |
| 491 | Ga0587077_053961 | 3300059493 | Bacteria | 850 |
| 492 | Ga0587080_044112 | 3300059503 | Bacteria | 822 |
| 493 | Ga0587076_024485 | 3300059645 | Bacteria | 1024 |
| 494 | Ga0501082_0310925 | 3300060353 | Bacteria | 1372 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037853 | Ga0436364_1465067 | Ga0436364_1465067_220_783 | 184 |
| 2 | 3300039447 | Ga0436361_0050405 | Ga0436361_0050405_803_1468 | 206 |
| 3 | 3300046515 | Ga0495620_0034806 | Ga0495620_0034806_405_1073 | 206 |
| 4 | 3300028800 | Ga0265338_10007107 | Ga0265338_1000710711 | 212 |
| 5 | 3300035695 | Ga0373927_0294937 | Ga0373927_0294937_20_676 | 212 |
| 6 | 3300047315 | Ga0495581_0179002 | Ga0495581_0179002_580_1227 | 212 |
| 7 | iso_pu_bacteria | 2837183177 | 2837183852 | 215 |
| 8 | 3300045051 | Ga0451576_0576130 | Ga0451576_0576130_17_667 | 216 |
| 9 | iso_pu_bacteria | 2643221561 | 2643826586 | 217 |
| 10 | iso_pu_bacteria | 2643221696 | 2644535622 | 217 |
| 11 | 3300037068 | Ga0373925_0259002 | Ga0373925_0259002_373_1053 | 218 |
| 12 | 3300046459 | Ga0495629_0230376 | Ga0495629_0230376_383_1063 | 218 |
| 13 | 3300046517 | Ga0495630_0000090 | Ga0495630_0000090_28515_29195 | 218 |
| 14 | 3300046526 | Ga0495666_0000375 | Ga0495666_0000375_5531_6211 | 218 |
| 15 | 3300046535 | Ga0495586_0000059 | Ga0495586_0000059_23496_24176 | 218 |
| 16 | 3300046690 | Ga0495624_0470874 | Ga0495624_0470874_43_723 | 218 |
| 17 | 3300047319 | Ga0495674_0000212 | Ga0495674_0000212_35109_35789 | 218 |
| 18 | 3300047471 | Ga0495684_0464290 | Ga0495684_0464290_85_765 | 218 |
| 19 | 3300031240 | Ga0265320_10032981 | Ga0265320_100329812 | 219 |
| 20 | 3300005437 | Ga0070710_10255054 | Ga0070710_102550542 | 220 |
| 21 | 3300041512 | Ga0451853_3163402 | Ga0451853_3163402_767_1429 | 220 |
| 22 | 3300045051 | Ga0451576_0003294 | Ga0451576_0003294_1648_2313 | 220 |
| 23 | 3300048922 | Ga0496119_0190295 | Ga0496119_0190295_370_1038 | 220 |
| 24 | iso_pu_bacteria | 2919497567 | 2919500950 | 220 |
| 25 | 3300005441 | Ga0070700_100054630 | Ga0070700_1000546304 | 221 |
| 26 | 3300005441 | Ga0070700_100226791 | Ga0070700_1002267912 | 221 |
| 27 | 3300006038 | Ga0075365_10434701 | Ga0075365_104347011 | 221 |
| 28 | 3300009093 | Ga0105240_10042688 | Ga0105240_100426882 | 221 |
| 29 | 3300009094 | Ga0111539_10508634 | Ga0111539_105086342 | 221 |
| 30 | 3300025910 | Ga0207684_10360288 | Ga0207684_103602882 | 221 |
| 31 | 3300025918 | Ga0207662_10116533 | Ga0207662_101165333 | 221 |
| 32 | 3300026075 | Ga0207708_10019777 | Ga0207708_100197772 | 221 |
| 33 | 3300044684 | Ga0466966_0058134 | Ga0466966_0058134_1021_1701 | 221 |
| 34 | 3300048918 | Ga0496115_0566063 | Ga0496115_0566063_200_877 | 221 |
| 35 | 3300048928 | Ga0496125_0403007 | Ga0496125_0403007_47_724 | 221 |
| 36 | 3300048929 | Ga0496126_0003335 | Ga0496126_0003335_3185_3862 | 221 |
| 37 | 3300048929 | Ga0496126_0162715 | Ga0496126_0162715_82_750 | 221 |
| 38 | 3300048929 | Ga0496126_0238352 | Ga0496126_0238352_584_1258 | 221 |
| 39 | 3300050492 | nmdc:mga0yw44_186854_c1 | nmdc:mga0yw44_186854_c1_316_984 | 221 |
| 40 | 3300050511 | nmdc:mga08y16_407647_c1 | nmdc:mga08y16_407647_c1_450_1118 | 221 |
| 41 | 3300005445 | Ga0070708_100079677 | Ga0070708_1000796772 | 222 |
| 42 | 3300005468 | Ga0070707_100003063 | Ga0070707_1000030639 | 222 |
| 43 | 3300005536 | Ga0070697_100199516 | Ga0070697_1001995162 | 222 |
| 44 | 3300006847 | Ga0075431_100027752 | Ga0075431_1000277528 | 222 |
| 45 | 3300006852 | Ga0075433_10087811 | Ga0075433_100878112 | 222 |
| 46 | 3300006871 | Ga0075434_100262767 | Ga0075434_1002627672 | 222 |
| 47 | 3300021441 | Ga0213871_10014732 | Ga0213871_100147322 | 222 |
| 48 | 3300025939 | Ga0207665_10135221 | Ga0207665_101352212 | 222 |
| 49 | 3300039438 | Ga0436360_0774108 | Ga0436360_0774108_677_1354 | 222 |
| 50 | 3300050510 | nmdc:mga06r32_4831_c2 | nmdc:mga06r32_4831_c2_2495_3172 | 222 |
| 51 | 3300050511 | nmdc:mga08y16_429199_c1 | nmdc:mga08y16_429199_c1_343_1020 | 222 |
| 52 | 3300050512 | nmdc:mga0n895_368751_c1 | nmdc:mga0n895_368751_c1_49_726 | 222 |
| 53 | 3300003203 | JGI25406J46586_10006217 | JGI25406J46586_100062173 | 223 |
| 54 | 3300003320 | rootH2_10035222 | rootH2_100352225 | 223 |
| 55 | 3300003320 | rootH2_10234348 | rootH2_102343482 | 223 |
| 56 | 3300003323 | rootH1_10186427 | rootH1_101864276 | 223 |
| 57 | 3300004803 | Ga0058862_10260855 | Ga0058862_102608552 | 223 |
| 58 | 3300005327 | Ga0070658_10000306 | Ga0070658_1000030616 | 223 |
| 59 | 3300005327 | Ga0070658_10021685 | Ga0070658_100216852 | 223 |
| 60 | 3300005327 | Ga0070658_10030299 | Ga0070658_100302993 | 223 |
| 61 | 3300005329 | Ga0070683_100348244 | Ga0070683_1003482442 | 223 |
| 62 | 3300005336 | Ga0070680_100347295 | Ga0070680_1003472952 | 223 |
| 63 | 3300005339 | Ga0070660_100005362 | Ga0070660_1000053625 | 223 |
| 64 | 3300005354 | Ga0070675_100312288 | Ga0070675_1003122882 | 223 |
| 65 | 3300005366 | Ga0070659_100225060 | Ga0070659_1002250602 | 223 |
| 66 | 3300005434 | Ga0070709_10023133 | Ga0070709_100231333 | 223 |
| 67 | 3300005434 | Ga0070709_10053563 | Ga0070709_100535631 | 223 |
| 68 | 3300005434 | Ga0070709_10130017 | Ga0070709_101300171 | 223 |
| 69 | 3300005435 | Ga0070714_100244391 | Ga0070714_1002443912 | 223 |
| 70 | 3300005436 | Ga0070713_100004439 | Ga0070713_1000044392 | 223 |
| 71 | 3300005436 | Ga0070713_100028023 | Ga0070713_1000280233 | 223 |
| 72 | 3300005436 | Ga0070713_100097123 | Ga0070713_1000971232 | 223 |
| 73 | 3300005436 | Ga0070713_100120915 | Ga0070713_1001209152 | 223 |
| 74 | 3300005436 | Ga0070713_100127909 | Ga0070713_1001279091 | 223 |
| 75 | 3300005436 | Ga0070713_100156943 | Ga0070713_1001569432 | 223 |
| 76 | 3300005436 | Ga0070713_100173094 | Ga0070713_1001730942 | 223 |
| 77 | 3300005436 | Ga0070713_100227341 | Ga0070713_1002273413 | 223 |
| 78 | 3300005436 | Ga0070713_100286343 | Ga0070713_1002863432 | 223 |
| 79 | 3300005437 | Ga0070710_10000357 | Ga0070710_100003574 | 223 |
| 80 | 3300005437 | Ga0070710_10094262 | Ga0070710_100942622 | 223 |
| 81 | 3300005439 | Ga0070711_100557740 | Ga0070711_1005577402 | 223 |
| 82 | 3300005444 | Ga0070694_100000726 | Ga0070694_10000072611 | 223 |
| 83 | 3300005445 | Ga0070708_100005254 | Ga0070708_1000052545 | 223 |
| 84 | 3300005445 | Ga0070708_100010340 | Ga0070708_1000103408 | 223 |
| 85 | 3300005445 | Ga0070708_100016008 | Ga0070708_1000160088 | 223 |
| 86 | 3300005445 | Ga0070708_100028494 | Ga0070708_1000284944 | 223 |
| 87 | 3300005445 | Ga0070708_100049696 | Ga0070708_1000496964 | 223 |
| 88 | 3300005445 | Ga0070708_100070582 | Ga0070708_1000705824 | 223 |
| 89 | 3300005445 | Ga0070708_100098664 | Ga0070708_1000986642 | 223 |
| 90 | 3300005445 | Ga0070708_100169442 | Ga0070708_1001694421 | 223 |
| 91 | 3300005445 | Ga0070708_100426916 | Ga0070708_1004269162 | 223 |
| 92 | 3300005458 | Ga0070681_10038246 | Ga0070681_100382463 | 223 |
| 93 | 3300005458 | Ga0070681_10066912 | Ga0070681_100669123 | 223 |
| 94 | 3300005459 | Ga0068867_100254163 | Ga0068867_1002541631 | 223 |
| 95 | 3300005467 | Ga0070706_100001465 | Ga0070706_10000146515 | 223 |
| 96 | 3300005467 | Ga0070706_100001640 | Ga0070706_10000164010 | 223 |
| 97 | 3300005467 | Ga0070706_100002806 | Ga0070706_10000280611 | 223 |
| 98 | 3300005467 | Ga0070706_100050195 | Ga0070706_1000501953 | 223 |
| 99 | 3300005467 | Ga0070706_100126413 | Ga0070706_1001264132 | 223 |
| 100 | 3300005468 | Ga0070707_100008458 | Ga0070707_1000084583 | 223 |
| 101 | 3300005468 | Ga0070707_100013999 | Ga0070707_1000139993 | 223 |
| 102 | 3300005468 | Ga0070707_100027539 | Ga0070707_1000275392 | 223 |
| 103 | 3300005468 | Ga0070707_100324621 | Ga0070707_1003246212 | 223 |
| 104 | 3300005471 | Ga0070698_100000542 | Ga0070698_10000054211 | 223 |
| 105 | 3300005471 | Ga0070698_100003505 | Ga0070698_10000350510 | 223 |
| 106 | 3300005471 | Ga0070698_100228583 | Ga0070698_1002285833 | 223 |
| 107 | 3300005518 | Ga0070699_100143169 | Ga0070699_1001431693 | 223 |
| 108 | 3300005518 | Ga0070699_100290096 | Ga0070699_1002900963 | 223 |
| 109 | 3300005530 | Ga0070679_100228695 | Ga0070679_1002286951 | 223 |
| 110 | 3300005530 | Ga0070679_100281651 | Ga0070679_1002816512 | 223 |
| 111 | 3300005530 | Ga0070679_100304806 | Ga0070679_1003048062 | 223 |
| 112 | 3300005530 | Ga0070679_100352556 | Ga0070679_1003525562 | 223 |
| 113 | 3300005535 | Ga0070684_100273172 | Ga0070684_1002731722 | 223 |
| 114 | 3300005536 | Ga0070697_100000141 | Ga0070697_10000014127 | 223 |
| 115 | 3300005536 | Ga0070697_100001137 | Ga0070697_1000011375 | 223 |
| 116 | 3300005536 | Ga0070697_100006676 | Ga0070697_1000066763 | 223 |
| 117 | 3300005536 | Ga0070697_100010121 | Ga0070697_1000101214 | 223 |
| 118 | 3300005536 | Ga0070697_100084093 | Ga0070697_1000840931 | 223 |
| 119 | 3300005536 | Ga0070697_100131295 | Ga0070697_1001312952 | 223 |
| 120 | 3300005536 | Ga0070697_100398982 | Ga0070697_1003989822 | 223 |
| 121 | 3300005536 | Ga0070697_100401874 | Ga0070697_1004018742 | 223 |
| 122 | 3300005539 | Ga0068853_100000008 | Ga0068853_100000008144 | 223 |
| 123 | 3300005539 | Ga0068853_100116775 | Ga0068853_1001167752 | 223 |
| 124 | 3300005544 | Ga0070686_100000163 | Ga0070686_10000016310 | 223 |
| 125 | 3300005545 | Ga0070695_100198777 | Ga0070695_1001987771 | 223 |
| 126 | 3300005547 | Ga0070693_100158628 | Ga0070693_1001586282 | 223 |
| 127 | 3300005548 | Ga0070665_100157717 | Ga0070665_1001577172 | 223 |
| 128 | 3300005549 | Ga0070704_100911316 | Ga0070704_1009113161 | 223 |
| 129 | 3300005563 | Ga0068855_100029747 | Ga0068855_1000297475 | 223 |
| 130 | 3300005563 | Ga0068855_100103972 | Ga0068855_1001039722 | 223 |
| 131 | 3300005563 | Ga0068855_100136229 | Ga0068855_1001362293 | 223 |
| 132 | 3300005563 | Ga0068855_100308243 | Ga0068855_1003082432 | 223 |
| 133 | 3300005563 | Ga0068855_100342030 | Ga0068855_1003420302 | 223 |
| 134 | 3300005577 | Ga0068857_100571570 | Ga0068857_1005715701 | 223 |
| 135 | 3300005578 | Ga0068854_100054071 | Ga0068854_1000540712 | 223 |
| 136 | 3300005578 | Ga0068854_100613280 | Ga0068854_1006132801 | 223 |
| 137 | 3300005614 | Ga0068856_100000067 | Ga0068856_10000006733 | 223 |
| 138 | 3300005614 | Ga0068856_100120798 | Ga0068856_1001207983 | 223 |
| 139 | 3300005614 | Ga0068856_100510393 | Ga0068856_1005103932 | 223 |
| 140 | 3300005614 | Ga0068856_100816558 | Ga0068856_1008165581 | 223 |
| 141 | 3300005616 | Ga0068852_100019153 | Ga0068852_1000191532 | 223 |
| 142 | 3300005841 | Ga0068863_100077387 | Ga0068863_1000773872 | 223 |
| 143 | 3300005841 | Ga0068863_101141657 | Ga0068863_1011416571 | 223 |
| 144 | 3300005842 | Ga0068858_100067237 | Ga0068858_1000672373 | 223 |
| 145 | 3300005843 | Ga0068860_100692976 | Ga0068860_1006929762 | 223 |
| 146 | 3300005844 | Ga0068862_100953590 | Ga0068862_1009535902 | 223 |
| 147 | 3300005937 | Ga0081455_10020720 | Ga0081455_100207203 | 223 |
| 148 | 3300005985 | Ga0081539_10000732 | Ga0081539_1000073254 | 223 |
| 149 | 3300005985 | Ga0081539_10002589 | Ga0081539_1000258918 | 223 |
| 150 | 3300005985 | Ga0081539_10010453 | Ga0081539_100104534 | 223 |
| 151 | 3300005985 | Ga0081539_10054207 | Ga0081539_100542072 | 223 |
| 152 | 3300006028 | Ga0070717_10001440 | Ga0070717_100014404 | 223 |
| 153 | 3300006028 | Ga0070717_10004886 | Ga0070717_100048862 | 223 |
| 154 | 3300006028 | Ga0070717_10006680 | Ga0070717_100066806 | 223 |
| 155 | 3300006028 | Ga0070717_10013997 | Ga0070717_100139975 | 223 |
| 156 | 3300006028 | Ga0070717_10162500 | Ga0070717_101625002 | 223 |
| 157 | 3300006028 | Ga0070717_10346135 | Ga0070717_103461352 | 223 |
| 158 | 3300006028 | Ga0070717_10517605 | Ga0070717_105176052 | 223 |
| 159 | 3300006028 | Ga0070717_10981039 | Ga0070717_109810392 | 223 |
| 160 | 3300006163 | Ga0070715_10080937 | Ga0070715_100809372 | 223 |
| 161 | 3300006173 | Ga0070716_100004067 | Ga0070716_1000040673 | 223 |
| 162 | 3300006173 | Ga0070716_100248028 | Ga0070716_1002480283 | 223 |
| 163 | 3300006175 | Ga0070712_100006976 | Ga0070712_1000069764 | 223 |
| 164 | 3300006175 | Ga0070712_100804026 | Ga0070712_1008040262 | 223 |
| 165 | 3300006237 | Ga0097621_100353627 | Ga0097621_1003536272 | 223 |
| 166 | 3300006844 | Ga0075428_100713920 | Ga0075428_1007139202 | 223 |
| 167 | 3300006847 | Ga0075431_100027479 | Ga0075431_1000274792 | 223 |
| 168 | 3300006847 | Ga0075431_100093647 | Ga0075431_1000936472 | 223 |
| 169 | 3300006847 | Ga0075431_100122793 | Ga0075431_1001227933 | 223 |
| 170 | 3300006847 | Ga0075431_100282042 | Ga0075431_1002820422 | 223 |
| 171 | 3300006847 | Ga0075431_100439389 | Ga0075431_1004393892 | 223 |
| 172 | 3300006852 | Ga0075433_10009731 | Ga0075433_100097312 | 223 |
| 173 | 3300006852 | Ga0075433_10015987 | Ga0075433_100159873 | 223 |
| 174 | 3300006852 | Ga0075433_10708706 | Ga0075433_107087062 | 223 |
| 175 | 3300006871 | Ga0075434_100012176 | Ga0075434_1000121764 | 223 |
| 176 | 3300006871 | Ga0075434_100326860 | Ga0075434_1003268604 | 223 |
| 177 | 3300006880 | Ga0075429_100257221 | Ga0075429_1002572212 | 223 |
| 178 | 3300006880 | Ga0075429_100483979 | Ga0075429_1004839792 | 223 |
| 179 | 3300006914 | Ga0075436_100013666 | Ga0075436_1000136663 | 223 |
| 180 | 3300007076 | Ga0075435_100002261 | Ga0075435_1000022615 | 223 |
| 181 | 3300009093 | Ga0105240_10000001 | Ga0105240_10000001766 | 223 |
| 182 | 3300009093 | Ga0105240_10014910 | Ga0105240_100149105 | 223 |
| 183 | 3300009093 | Ga0105240_10060316 | Ga0105240_100603165 | 223 |
| 184 | 3300009093 | Ga0105240_10115009 | Ga0105240_101150093 | 223 |
| 185 | 3300009093 | Ga0105240_10195867 | Ga0105240_101958672 | 223 |
| 186 | 3300009093 | Ga0105240_10769176 | Ga0105240_107691762 | 223 |
| 187 | 3300009094 | Ga0111539_10778031 | Ga0111539_107780311 | 223 |
| 188 | 3300009098 | Ga0105245_10043635 | Ga0105245_100436353 | 223 |
| 189 | 3300009101 | Ga0105247_10021561 | Ga0105247_100215614 | 223 |
| 190 | 3300009147 | Ga0114129_10131044 | Ga0114129_101310444 | 223 |
| 191 | 3300009174 | Ga0105241_10256852 | Ga0105241_102568522 | 223 |
| 192 | 3300009177 | Ga0105248_10090097 | Ga0105248_100900972 | 223 |
| 193 | 3300009177 | Ga0105248_10225002 | Ga0105248_102250022 | 223 |
| 194 | 3300009545 | Ga0105237_10001617 | Ga0105237_100016178 | 223 |
| 195 | 3300009551 | Ga0105238_10040158 | Ga0105238_100401586 | 223 |
| 196 | 3300009551 | Ga0105238_10100993 | Ga0105238_101009932 | 223 |
| 197 | 3300010375 | Ga0105239_10198187 | Ga0105239_101981872 | 223 |
| 198 | 3300010375 | Ga0105239_10314228 | Ga0105239_103142281 | 223 |
| 199 | 3300013104 | Ga0157370_10006891 | Ga0157370_100068912 | 223 |
| 200 | 3300013104 | Ga0157370_10018779 | Ga0157370_100187794 | 223 |
| 201 | 3300013104 | Ga0157370_10105317 | Ga0157370_101053172 | 223 |
| 202 | 3300013104 | Ga0157370_10151673 | Ga0157370_101516732 | 223 |
| 203 | 3300013105 | Ga0157369_10011151 | Ga0157369_100111517 | 223 |
| 204 | 3300013105 | Ga0157369_10069219 | Ga0157369_100692192 | 223 |
| 205 | 3300013105 | Ga0157369_10177447 | Ga0157369_101774472 | 223 |
| 206 | 3300013105 | Ga0157369_10539049 | Ga0157369_105390492 | 223 |
| 207 | 3300013296 | Ga0157374_10217384 | Ga0157374_102173842 | 223 |
| 208 | 3300013296 | Ga0157374_10372176 | Ga0157374_103721762 | 223 |
| 209 | 3300013297 | Ga0157378_10084464 | Ga0157378_100844642 | 223 |
| 210 | 3300013297 | Ga0157378_10104125 | Ga0157378_101041253 | 223 |
| 211 | 3300013297 | Ga0157378_10444529 | Ga0157378_104445291 | 223 |
| 212 | 3300013307 | Ga0157372_10012429 | Ga0157372_100124295 | 223 |
| 213 | 3300013307 | Ga0157372_10018353 | Ga0157372_100183532 | 223 |
| 214 | 3300013307 | Ga0157372_10050439 | Ga0157372_100504392 | 223 |
| 215 | 3300013307 | Ga0157372_10175085 | Ga0157372_101750852 | 223 |
| 216 | 3300013307 | Ga0157372_10175986 | Ga0157372_101759862 | 223 |
| 217 | 3300014325 | Ga0163163_10361420 | Ga0163163_103614202 | 223 |
| 218 | 3300014968 | Ga0157379_10014712 | Ga0157379_1001471211 | 223 |
| 219 | 3300020069 | Ga0197907_11192561 | Ga0197907_111925612 | 223 |
| 220 | 3300021358 | Ga0213873_10003483 | Ga0213873_100034832 | 223 |
| 221 | 3300021377 | Ga0213874_10010809 | Ga0213874_100108092 | 223 |
| 222 | 3300021377 | Ga0213874_10177721 | Ga0213874_101777211 | 223 |
| 223 | 3300021384 | Ga0213876_10027624 | Ga0213876_100276242 | 223 |
| 224 | 3300025898 | Ga0207692_10000177 | Ga0207692_100001776 | 223 |
| 225 | 3300025898 | Ga0207692_10155037 | Ga0207692_101550372 | 223 |
| 226 | 3300025898 | Ga0207692_10167431 | Ga0207692_101674311 | 223 |
| 227 | 3300025900 | Ga0207710_10031468 | Ga0207710_100314682 | 223 |
| 228 | 3300025905 | Ga0207685_10169256 | Ga0207685_101692562 | 223 |
| 229 | 3300025906 | Ga0207699_10016052 | Ga0207699_100160522 | 223 |
| 230 | 3300025906 | Ga0207699_10047872 | Ga0207699_100478722 | 223 |
| 231 | 3300025906 | Ga0207699_10155136 | Ga0207699_101551362 | 223 |
| 232 | 3300025906 | Ga0207699_10653389 | Ga0207699_106533891 | 223 |
| 233 | 3300025909 | Ga0207705_10003558 | Ga0207705_100035583 | 223 |
| 234 | 3300025909 | Ga0207705_10017092 | Ga0207705_100170923 | 223 |
| 235 | 3300025909 | Ga0207705_10037857 | Ga0207705_100378572 | 223 |
| 236 | 3300025910 | Ga0207684_10016658 | Ga0207684_100166582 | 223 |
| 237 | 3300025910 | Ga0207684_10021279 | Ga0207684_100212792 | 223 |
| 238 | 3300025910 | Ga0207684_10260789 | Ga0207684_102607892 | 223 |
| 239 | 3300025910 | Ga0207684_10456220 | Ga0207684_104562202 | 223 |
| 240 | 3300025911 | Ga0207654_10131762 | Ga0207654_101317621 | 223 |
| 241 | 3300025912 | Ga0207707_10011303 | Ga0207707_100113032 | 223 |
| 242 | 3300025912 | Ga0207707_10078351 | Ga0207707_100783512 | 223 |
| 243 | 3300025913 | Ga0207695_10000001 | Ga0207695_10000001767 | 223 |
| 244 | 3300025913 | Ga0207695_10000186 | Ga0207695_1000018663 | 223 |
| 245 | 3300025913 | Ga0207695_10011398 | Ga0207695_100113985 | 223 |
| 246 | 3300025913 | Ga0207695_10025305 | Ga0207695_100253053 | 223 |
| 247 | 3300025913 | Ga0207695_10332463 | Ga0207695_103324632 | 223 |
| 248 | 3300025913 | Ga0207695_10696049 | Ga0207695_106960491 | 223 |
| 249 | 3300025914 | Ga0207671_10002113 | Ga0207671_1000211312 | 223 |
| 250 | 3300025915 | Ga0207693_10090981 | Ga0207693_100909813 | 223 |
| 251 | 3300025915 | Ga0207693_10316308 | Ga0207693_103163082 | 223 |
| 252 | 3300025917 | Ga0207660_10142381 | Ga0207660_101423812 | 223 |
| 253 | 3300025917 | Ga0207660_10467731 | Ga0207660_104677311 | 223 |
| 254 | 3300025919 | Ga0207657_10029570 | Ga0207657_100295703 | 223 |
| 255 | 3300025919 | Ga0207657_10326593 | Ga0207657_103265932 | 223 |
| 256 | 3300025921 | Ga0207652_10066034 | Ga0207652_100660342 | 223 |
| 257 | 3300025921 | Ga0207652_10267012 | Ga0207652_102670122 | 223 |
| 258 | 3300025921 | Ga0207652_10284807 | Ga0207652_102848072 | 223 |
| 259 | 3300025921 | Ga0207652_10854829 | Ga0207652_108548292 | 223 |
| 260 | 3300025922 | Ga0207646_10063970 | Ga0207646_100639702 | 223 |
| 261 | 3300025922 | Ga0207646_10091098 | Ga0207646_100910982 | 223 |
| 262 | 3300025922 | Ga0207646_10105674 | Ga0207646_101056741 | 223 |
| 263 | 3300025922 | Ga0207646_10145866 | Ga0207646_101458662 | 223 |
| 264 | 3300025922 | Ga0207646_10278726 | Ga0207646_102787261 | 223 |
| 265 | 3300025922 | Ga0207646_10577261 | Ga0207646_105772611 | 223 |
| 266 | 3300025924 | Ga0207694_10009926 | Ga0207694_100099266 | 223 |
| 267 | 3300025924 | Ga0207694_10022721 | Ga0207694_100227212 | 223 |
| 268 | 3300025927 | Ga0207687_10074701 | Ga0207687_100747012 | 223 |
| 269 | 3300025928 | Ga0207700_10011144 | Ga0207700_100111443 | 223 |
| 270 | 3300025928 | Ga0207700_10019772 | Ga0207700_100197722 | 223 |
| 271 | 3300025928 | Ga0207700_10020103 | Ga0207700_100201033 | 223 |
| 272 | 3300025928 | Ga0207700_10086061 | Ga0207700_100860612 | 223 |
| 273 | 3300025928 | Ga0207700_10093505 | Ga0207700_100935052 | 223 |
| 274 | 3300025928 | Ga0207700_10175662 | Ga0207700_101756623 | 223 |
| 275 | 3300025928 | Ga0207700_10332290 | Ga0207700_103322902 | 223 |
| 276 | 3300025929 | Ga0207664_10180738 | Ga0207664_101807382 | 223 |
| 277 | 3300025929 | Ga0207664_10290530 | Ga0207664_102905302 | 223 |
| 278 | 3300025929 | Ga0207664_10386268 | Ga0207664_103862682 | 223 |
| 279 | 3300025929 | Ga0207664_10502543 | Ga0207664_105025432 | 223 |
| 280 | 3300025939 | Ga0207665_10000256 | Ga0207665_1000025622 | 223 |
| 281 | 3300025939 | Ga0207665_10085376 | Ga0207665_100853762 | 223 |
| 282 | 3300025939 | Ga0207665_10129970 | Ga0207665_101299702 | 223 |
| 283 | 3300025944 | Ga0207661_10230774 | Ga0207661_102307742 | 223 |
| 284 | 3300025949 | Ga0207667_10022219 | Ga0207667_100222195 | 223 |
| 285 | 3300025949 | Ga0207667_10027314 | Ga0207667_100273141 | 223 |
| 286 | 3300025949 | Ga0207667_10041664 | Ga0207667_100416643 | 223 |
| 287 | 3300025949 | Ga0207667_10158262 | Ga0207667_101582624 | 223 |
| 288 | 3300025949 | Ga0207667_10158989 | Ga0207667_101589892 | 223 |
| 289 | 3300025949 | Ga0207667_10219234 | Ga0207667_102192343 | 223 |
| 290 | 3300025949 | Ga0207667_10230221 | Ga0207667_102302211 | 223 |
| 291 | 3300025981 | Ga0207640_10636026 | Ga0207640_106360262 | 223 |
| 292 | 3300026035 | Ga0207703_10104739 | Ga0207703_101047392 | 223 |
| 293 | 3300026035 | Ga0207703_10780837 | Ga0207703_107808372 | 223 |
| 294 | 3300026041 | Ga0207639_10000014 | Ga0207639_1000001445 | 223 |
| 295 | 3300026041 | Ga0207639_10092481 | Ga0207639_100924814 | 223 |
| 296 | 3300026078 | Ga0207702_10001092 | Ga0207702_1000109212 | 223 |
| 297 | 3300026078 | Ga0207702_10104069 | Ga0207702_101040692 | 223 |
| 298 | 3300026088 | Ga0207641_10003313 | Ga0207641_100033134 | 223 |
| 299 | 3300026116 | Ga0207674_10596126 | Ga0207674_105961262 | 223 |
| 300 | 3300026142 | Ga0207698_10007154 | Ga0207698_100071542 | 223 |
| 301 | 3300028379 | Ga0268266_10493521 | Ga0268266_104935211 | 223 |
| 302 | 3300028556 | Ga0265337_1027920 | Ga0265337_10279202 | 223 |
| 303 | 3300028558 | Ga0265326_10009140 | Ga0265326_100091403 | 223 |
| 304 | 3300028666 | Ga0265336_10000551 | Ga0265336_100005514 | 223 |
| 305 | 3300028800 | Ga0265338_10001482 | Ga0265338_1000148214 | 223 |
| 306 | 3300028800 | Ga0265338_10003414 | Ga0265338_100034143 | 223 |
| 307 | 3300028800 | Ga0265338_10014683 | Ga0265338_100146835 | 223 |
| 308 | 3300028800 | Ga0265338_10022214 | Ga0265338_100222143 | 223 |
| 309 | 3300028800 | Ga0265338_10030729 | Ga0265338_100307293 | 223 |
| 310 | 3300028800 | Ga0265338_10232689 | Ga0265338_102326892 | 223 |
| 311 | 3300029957 | Ga0265324_10000110 | Ga0265324_1000011037 | 223 |
| 312 | 3300031240 | Ga0265320_10117778 | Ga0265320_101177782 | 223 |
| 313 | 3300031249 | Ga0265339_10141341 | Ga0265339_101413412 | 223 |
| 314 | 3300031250 | Ga0265331_10004464 | Ga0265331_100044645 | 223 |
| 315 | 3300031251 | Ga0265327_10003537 | Ga0265327_100035374 | 223 |
| 316 | 3300031344 | Ga0265316_10002940 | Ga0265316_1000294011 | 223 |
| 317 | 3300031711 | Ga0265314_10000406 | Ga0265314_100004063 | 223 |
| 318 | 3300031711 | Ga0265314_10172228 | Ga0265314_101722281 | 223 |
| 319 | 3300031711 | Ga0265314_10187481 | Ga0265314_101874812 | 223 |
| 320 | 3300031712 | Ga0265342_10253951 | Ga0265342_102539511 | 223 |
| 321 | 3300031727 | Ga0316576_10012737 | Ga0316576_100127374 | 223 |
| 322 | 3300031901 | Ga0307406_10057503 | Ga0307406_100575033 | 223 |
| 323 | 3300035083 | Ga0373926_0010673 | Ga0373926_0010673_2132_2812 | 223 |
| 324 | 3300035083 | Ga0373926_0034270 | Ga0373926_0034270_836_1516 | 223 |
| 325 | 3300035089 | Ga0373944_0033597 | Ga0373944_0033597_834_1520 | 223 |
| 326 | 3300035111 | Ga0373923_0125403 | Ga0373923_0125403_219_899 | 223 |
| 327 | 3300035113 | Ga0373936_0005665 | Ga0373936_0005665_3813_4493 | 223 |
| 328 | 3300035116 | Ga0373945_0007027 | Ga0373945_0007027_2866_3546 | 223 |
| 329 | 3300035117 | Ga0373953_0001890 | Ga0373953_0001890_787_1467 | 223 |
| 330 | 3300035118 | Ga0373954_0016125 | Ga0373954_0016125_1221_1901 | 223 |
| 331 | 3300035119 | Ga0373956_0138950 | Ga0373956_0138950_441_1121 | 223 |
| 332 | 3300035170 | Ga0373943_0009015 | Ga0373943_0009015_3064_3744 | 223 |
| 333 | 3300035171 | Ga0373946_0010701 | Ga0373946_0010701_2200_2880 | 223 |
| 334 | 3300035171 | Ga0373946_0022107 | Ga0373946_0022107_860_1540 | 223 |
| 335 | 3300035172 | Ga0373955_0057096 | Ga0373955_0057096_879_1559 | 223 |
| 336 | 3300035410 | Ga0373924_0000007 | Ga0373924_0000007_45992_46669 | 223 |
| 337 | 3300035410 | Ga0373924_0013082 | Ga0373924_0013082_1415_2095 | 223 |
| 338 | 3300035692 | Ga0373935_0017263 | Ga0373935_0017263_3123_3803 | 223 |
| 339 | 3300035692 | Ga0373935_0018970 | Ga0373935_0018970_2672_3352 | 223 |
| 340 | 3300035692 | Ga0373935_0122110 | Ga0373935_0122110_82_768 | 223 |
| 341 | 3300035695 | Ga0373927_0030961 | Ga0373927_0030961_1734_2414 | 223 |
| 342 | 3300035695 | Ga0373927_0037768 | Ga0373927_0037768_1497_2177 | 223 |
| 343 | 3300035724 | Ga0373933_0006560 | Ga0373933_0006560_4219_4899 | 223 |
| 344 | 3300035725 | Ga0373947_0001475 | Ga0373947_0001475_3001_3681 | 223 |
| 345 | 3300035725 | Ga0373947_0002508 | Ga0373947_0002508_3157_3837 | 223 |
| 346 | 3300035725 | Ga0373947_0377883 | Ga0373947_0377883_42_722 | 223 |
| 347 | 3300035725 | Ga0373947_0423678 | Ga0373947_0423678_187_867 | 223 |
| 348 | 3300036401 | Ga0373937_0059851 | Ga0373937_0059851_951_1631 | 223 |
| 349 | 3300036401 | Ga0373937_0172963 | Ga0373937_0172963_990_1679 | 223 |
| 350 | 3300036401 | Ga0373937_0409143 | Ga0373937_0409143_270_950 | 223 |
| 351 | 3300037068 | Ga0373925_0001474 | Ga0373925_0001474_2013_2693 | 223 |
| 352 | 3300037068 | Ga0373925_0347353 | Ga0373925_0347353_322_1011 | 223 |
| 353 | 3300037068 | Ga0373925_0354472 | Ga0373925_0354472_465_1145 | 223 |
| 354 | 3300037471 | Ga0395905_0078196 | Ga0395905_0078196_498_1178 | 223 |
| 355 | 3300037471 | Ga0395905_0713976 | Ga0395905_0713976_182_862 | 223 |
| 356 | 3300037853 | Ga0436364_0372361 | Ga0436364_0372361_190_870 | 223 |
| 357 | 3300038443 | Ga0395901_0119465 | Ga0395901_0119465_357_1034 | 223 |
| 358 | 3300038443 | Ga0395901_0218494 | Ga0395901_0218494_732_1412 | 223 |
| 359 | 3300039437 | Ga0436365_1183338 | Ga0436365_1183338_2229_2912 | 223 |
| 360 | 3300039447 | Ga0436361_0723366 | Ga0436361_0723366_48_728 | 223 |
| 361 | 3300039450 | Ga0436363_0220347 | Ga0436363_0220347_52_732 | 223 |
| 362 | 3300039450 | Ga0436363_0272652 | Ga0436363_0272652_253_936 | 223 |
| 363 | 3300039450 | Ga0436363_0357605 | Ga0436363_0357605_686_1366 | 223 |
| 364 | 3300039453 | Ga0436362_1127703 | Ga0436362_1127703_3242_3922 | 223 |
| 365 | 3300044673 | Ga0453683_0001529 | Ga0453683_0001529_7222_7896 | 223 |
| 366 | 3300044673 | Ga0453683_0050690 | Ga0453683_0050690_1651_2331 | 223 |
| 367 | 3300044673 | Ga0453683_0377908 | Ga0453683_0377908_85_765 | 223 |
| 368 | 3300044712 | Ga0453684_0781648 | Ga0453684_0781648_258_938 | 223 |
| 369 | 3300044735 | Ga0466968_0334656 | Ga0466968_0334656_26_706 | 223 |
| 370 | 3300045049 | Ga0466959_0258856 | Ga0466959_0258856_224_904 | 223 |
| 371 | 3300045051 | Ga0451576_0429091 | Ga0451576_0429091_11_694 | 223 |
| 372 | 3300045051 | Ga0451576_0442983 | Ga0451576_0442983_267_947 | 223 |
| 373 | 3300045051 | Ga0451576_1039546 | Ga0451576_1039546_34_714 | 223 |
| 374 | 3300046462 | Ga0495651_0015402 | Ga0495651_0015402_1791_2471 | 223 |
| 375 | 3300046472 | Ga0495580_0017063 | Ga0495580_0017063_461_1144 | 223 |
| 376 | 3300046472 | Ga0495580_0028282 | Ga0495580_0028282_2185_2865 | 223 |
| 377 | 3300046472 | Ga0495580_0056939 | Ga0495580_0056939_437_1117 | 223 |
| 378 | 3300046472 | Ga0495580_0147354 | Ga0495580_0147354_724_1407 | 223 |
| 379 | 3300046472 | Ga0495580_0243914 | Ga0495580_0243914_512_1192 | 223 |
| 380 | 3300046475 | Ga0495639_0124982 | Ga0495639_0124982_39_719 | 223 |
| 381 | 3300046477 | Ga0495664_0006147 | Ga0495664_0006147_2762_3442 | 223 |
| 382 | 3300046477 | Ga0495664_0043765 | Ga0495664_0043765_1625_2305 | 223 |
| 383 | 3300046514 | Ga0495618_0002180 | Ga0495618_0002180_10301_10981 | 223 |
| 384 | 3300046516 | Ga0495628_0000972 | Ga0495628_0000972_17432_18112 | 223 |
| 385 | 3300046516 | Ga0495628_0029864 | Ga0495628_0029864_3354_4034 | 223 |
| 386 | 3300046517 | Ga0495630_0067519 | Ga0495630_0067519_844_1524 | 223 |
| 387 | 3300046526 | Ga0495666_0082367 | Ga0495666_0082367_137_817 | 223 |
| 388 | 3300046529 | Ga0495652_0287037 | Ga0495652_0287037_245_925 | 223 |
| 389 | 3300046533 | Ga0495640_0086623 | Ga0495640_0086623_753_1433 | 223 |
| 390 | 3300046535 | Ga0495586_0001134 | Ga0495586_0001134_3666_4346 | 223 |
| 391 | 3300046535 | Ga0495586_0303533 | Ga0495586_0303533_144_824 | 223 |
| 392 | 3300046543 | Ga0495645_0002653 | Ga0495645_0002653_5373_6053 | 223 |
| 393 | 3300046642 | Ga0495634_0122166 | Ga0495634_0122166_450_1130 | 223 |
| 394 | 3300046678 | Ga0495599_0003376 | Ga0495599_0003376_1209_1889 | 223 |
| 395 | 3300046678 | Ga0495599_0092197 | Ga0495599_0092197_161_841 | 223 |
| 396 | 3300046679 | Ga0495623_0218210 | Ga0495623_0218210_313_993 | 223 |
| 397 | 3300046680 | Ga0495646_0106355 | Ga0495646_0106355_18_698 | 223 |
| 398 | 3300046683 | Ga0495658_0010975 | Ga0495658_0010975_888_1574 | 223 |
| 399 | 3300046689 | Ga0495613_0136147 | Ga0495613_0136147_352_1032 | 223 |
| 400 | 3300046690 | Ga0495624_0100630 | Ga0495624_0100630_405_1085 | 223 |
| 401 | 3300046809 | Ga0495600_0030238 | Ga0495600_0030238_473_1153 | 223 |
| 402 | 3300047319 | Ga0495674_0010402 | Ga0495674_0010402_1909_2589 | 223 |
| 403 | 3300047319 | Ga0495674_0273263 | Ga0495674_0273263_202_882 | 223 |
| 404 | 3300047321 | Ga0495676_0242498 | Ga0495676_0242498_118_798 | 223 |
| 405 | 3300047444 | Ga0495675_0137035 | Ga0495675_0137035_793_1473 | 223 |
| 406 | 3300047471 | Ga0495684_0028209 | Ga0495684_0028209_2289_2969 | 223 |
| 407 | 3300047471 | Ga0495684_0075738 | Ga0495684_0075738_589_1275 | 223 |
| 408 | 3300048088 | Ga0495602_0070786 | Ga0495602_0070786_639_1319 | 223 |
| 409 | 3300048905 | Ga0496102_0002856 | Ga0496102_0002856_7393_8076 | 223 |
| 410 | 3300048906 | Ga0496103_0066838 | Ga0496103_0066838_132_815 | 223 |
| 411 | 3300048909 | Ga0496106_0076073 | Ga0496106_0076073_179_862 | 223 |
| 412 | 3300048910 | Ga0496107_0391153 | Ga0496107_0391153_144_827 | 223 |
| 413 | 3300048912 | Ga0496109_0000107 | Ga0496109_0000107_82089_82769 | 223 |
| 414 | 3300049586 | Ga0501070_0726119 | Ga0501070_0726119_33_713 | 223 |
| 415 | 3300049824 | Ga0501045_0275618 | Ga0501045_0275618_245_925 | 223 |
| 416 | 3300050507 | nmdc:mga05p37_1196_c1 | nmdc:mga05p37_1196_c1_4021_4701 | 223 |
| 417 | 3300050508 | nmdc:mga09592_196910_c1 | nmdc:mga09592_196910_c1_602_1282 | 223 |
| 418 | 3300050509 | nmdc:mga0qj67_265494_c1 | nmdc:mga0qj67_265494_c1_268_948 | 223 |
| 419 | 3300050510 | nmdc:mga06r32_421064_c1 | nmdc:mga06r32_421064_c1_244_924 | 223 |
| 420 | 3300050510 | nmdc:mga06r32_425020_c1 | nmdc:mga06r32_425020_c1_482_1162 | 223 |
| 421 | 3300050510 | nmdc:mga06r32_741432_c1 | nmdc:mga06r32_741432_c1_69_749 | 223 |
| 422 | 3300050511 | nmdc:mga08y16_596178_c1 | nmdc:mga08y16_596178_c1_299_979 | 223 |
| 423 | 3300050512 | nmdc:mga0n895_159694_c1 | nmdc:mga0n895_159694_c1_160_843 | 223 |
| 424 | 3300050512 | nmdc:mga0n895_321109_c1 | nmdc:mga0n895_321109_c1_875_1555 | 223 |
| 425 | 3300050513 | nmdc:mga0rr50_167_c1 | nmdc:mga0rr50_167_c1_5168_5848 | 223 |
| 426 | 3300050514 | nmdc:mga08x19_8082_c1 | nmdc:mga08x19_8082_c1_4046_4726 | 223 |
| 427 | 3300050515 | nmdc:mga0a205_101951_c1 | nmdc:mga0a205_101951_c1_667_1347 | 223 |
| 428 | 3300050515 | nmdc:mga0a205_127657_c1 | nmdc:mga0a205_127657_c1_1513_2193 | 223 |
| 429 | 3300050515 | nmdc:mga0a205_464328_c1 | nmdc:mga0a205_464328_c1_171_854 | 223 |
| 430 | 3300050515 | nmdc:mga0a205_4746_c1 | nmdc:mga0a205_4746_c1_852_1532 | 223 |
| 431 | 3300053108 | Ga0500562_091688 | Ga0500562_091688_117_797 | 223 |
| 432 | 3300053119 | Ga0500595_008643 | Ga0500595_008643_2001_2678 | 223 |
| 433 | 3300059493 | Ga0587077_053961 | Ga0587077_053961_132_812 | 223 |
| 434 | 3300059503 | Ga0587080_044112 | Ga0587080_044112_108_785 | 223 |
| 435 | 3300059645 | Ga0587076_024485 | Ga0587076_024485_313_993 | 223 |
| 436 | 3300005288 | Ga0065714_10069362 | Ga0065714_100693623 | 224 |
| 437 | 3300005329 | Ga0070683_100823218 | Ga0070683_1008232182 | 224 |
| 438 | 3300005437 | Ga0070710_10182765 | Ga0070710_101827652 | 224 |
| 439 | 3300005439 | Ga0070711_100264786 | Ga0070711_1002647861 | 224 |
| 440 | 3300005445 | Ga0070708_100004780 | Ga0070708_1000047806 | 224 |
| 441 | 3300005518 | Ga0070699_100037296 | Ga0070699_1000372964 | 224 |
| 442 | 3300005536 | Ga0070697_100010650 | Ga0070697_1000106502 | 224 |
| 443 | 3300005549 | Ga0070704_100004479 | Ga0070704_1000044792 | 224 |
| 444 | 3300005842 | Ga0068858_100007767 | Ga0068858_1000077674 | 224 |
| 445 | 3300005983 | Ga0081540_1066650 | Ga0081540_10666501 | 224 |
| 446 | 3300009093 | Ga0105240_10000069 | Ga0105240_1000006973 | 224 |
| 447 | 3300009545 | Ga0105237_10113701 | Ga0105237_101137012 | 224 |
| 448 | 3300013306 | Ga0163162_10004081 | Ga0163162_1000408118 | 224 |
| 449 | 3300025936 | Ga0207670_10268637 | Ga0207670_102686372 | 224 |
| 450 | 3300026035 | Ga0207703_10009512 | Ga0207703_100095122 | 224 |
| 451 | 3300026035 | Ga0207703_10031274 | Ga0207703_100312745 | 224 |
| 452 | 3300026078 | Ga0207702_10596229 | Ga0207702_105962292 | 224 |
| 453 | 3300037471 | Ga0395905_0079643 | Ga0395905_0079643_919_1647 | 224 |
| 454 | 3300038443 | Ga0395901_0162050 | Ga0395901_0162050_1393_2121 | 224 |
| 455 | 3300039437 | Ga0436365_0816722 | Ga0436365_0816722_581_1285 | 224 |
| 456 | 3300039437 | Ga0436365_1217298 | Ga0436365_1217298_1605_2282 | 224 |
| 457 | 3300046477 | Ga0495664_0220235 | Ga0495664_0220235_304_1002 | 224 |
| 458 | 3300048088 | Ga0495602_0194988 | Ga0495602_0194988_395_1108 | 224 |
| 459 | 3300003911 | JGI25405J52794_10011653 | JGI25405J52794_100116532 | 225 |
| 460 | 3300031235 | Ga0265330_10018645 | Ga0265330_100186455 | 225 |
| 461 | 3300031238 | Ga0265332_10014628 | Ga0265332_100146282 | 225 |
| 462 | 3300031241 | Ga0265325_10001302 | Ga0265325_1000130212 | 225 |
| 463 | 3300031249 | Ga0265339_10028241 | Ga0265339_100282412 | 225 |
| 464 | 3300031344 | Ga0265316_10102836 | Ga0265316_101028364 | 225 |
| 465 | 3300031595 | Ga0265313_10083366 | Ga0265313_100833662 | 225 |
| 466 | 3300031711 | Ga0265314_10001380 | Ga0265314_1000138023 | 225 |
| 467 | 3300031712 | Ga0265342_10119863 | Ga0265342_101198633 | 225 |
| 468 | 3300031733 | Ga0316577_10011132 | Ga0316577_100111322 | 225 |
| 469 | 3300035692 | Ga0373935_0006457 | Ga0373935_0006457_5003_5701 | 225 |
| 470 | 3300036401 | Ga0373937_0418167 | Ga0373937_0418167_145_843 | 225 |
| 471 | 3300036712 | Ga0316584_0515836 | Ga0316584_0515836_109_798 | 225 |
| 472 | 3300037068 | Ga0373925_0001183 | Ga0373925_0001183_19479_20177 | 225 |
| 473 | 3300046472 | Ga0495580_0011364 | Ga0495580_0011364_4645_5343 | 225 |
| 474 | 3300046473 | Ga0495582_0007506 | Ga0495582_0007506_1699_2397 | 225 |
| 475 | 3300046683 | Ga0495658_0004835 | Ga0495658_0004835_1284_1982 | 225 |
| 476 | 3300046689 | Ga0495613_0350977 | Ga0495613_0350977_24_722 | 225 |
| 477 | 3300049568 | Ga0501031_0013420 | Ga0501031_0013420_4336_5040 | 225 |
| 478 | 3300049569 | Ga0501032_0090270 | Ga0501032_0090270_475_1179 | 225 |
| 479 | 3300049570 | Ga0501033_0098932 | Ga0501033_0098932_107_817 | 225 |
| 480 | 3300049571 | Ga0501034_0062462 | Ga0501034_0062462_1090_1800 | 225 |
| 481 | 3300049574 | Ga0501038_0035407 | Ga0501038_0035407_172_876 | 225 |
| 482 | 3300049580 | Ga0501046_0002062 | Ga0501046_0002062_780_1490 | 225 |
| 483 | 3300049581 | Ga0501047_0019360 | Ga0501047_0019360_606_1316 | 225 |
| 484 | 3300049581 | Ga0501047_0090675 | Ga0501047_0090675_787_1491 | 225 |
| 485 | 3300049581 | Ga0501047_0528231 | Ga0501047_0528231_248_958 | 225 |
| 486 | 3300049586 | Ga0501070_0000031 | Ga0501070_0000031_121512_122216 | 225 |
| 487 | 3300049586 | Ga0501070_0049651 | Ga0501070_0049651_1046_1768 | 225 |
| 488 | 3300049586 | Ga0501070_0145249 | Ga0501070_0145249_502_1212 | 225 |
| 489 | 3300049742 | Ga0501080_0005230 | Ga0501080_0005230_4527_5231 | 225 |
| 490 | 3300049742 | Ga0501080_0124897 | Ga0501080_0124897_83_793 | 225 |
| 491 | 3300049742 | Ga0501080_0290686 | Ga0501080_0290686_503_1207 | 225 |
| 492 | 3300049823 | Ga0501044_0069415 | Ga0501044_0069415_2145_2855 | 225 |
| 493 | 3300049823 | Ga0501044_0152796 | Ga0501044_0152796_1377_2087 | 225 |
| 494 | 3300060353 | Ga0501082_0310925 | Ga0501082_0310925_128_832 | 225 |
| 495 | 3300002737 | JGI25162J39368_1000005 | JGI25162J39368_1000005296 | 226 |
| 496 | 3300010375 | Ga0105239_10000032 | Ga0105239_10000032136 | 226 |
| 497 | 3300025233 | Ga0209437_100043 | Ga0209437_100043111 | 226 |
| 498 | 3300047472 | Ga0495686_0039296 | Ga0495686_0039296_1683_2363 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.9764 | 1 | 119 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9712 | 3 | 119 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9706 | 1 | 121 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9705 | 3 | 119 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9695 | 3 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9907 | 1 | 80 | 3.40.50.2300 |
| af_P30843_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9875 | 3 | 80 | 3.40.50.2300 |
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9844 | 3 | 84 | 3.40.50.2300 |
| af_P52076_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9809 | 3 | 80 | 3.40.50.2300 |
| af_P23836_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9766 | 3 | 80 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849NIE5-F1-model_v4 | Response regulator | 0.9773 | 1 | 127 |
GO:0000156
GO:0000976 GO:0004016 GO:0005829 GO:0006355 GO:0009190 GO:0032993 |
| AF-A0A6I5QSI8-F1-model_v4 | Response regulator | 0.9773 | 1 | 126 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A6I5QSI8-F1-model_v4 | Response regulator | 0.955 | 1 | 126 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A060VDP9-F1-model_v4 | DNA-binding response regulator CreB | 0.8343 | 1 | 162 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A6B1I0J4-F1-model_v4 | Response regulator transcription factor | 0.8325 | 1 | 146 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar