F455030

General Info

Members Datasets Scaffolds Average Seq Length
497 271 994 123

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10415561|Ga0105248_104155612
Length 148
Sequence VAKPAYFAGPSAKIKDHIMKHSEGFLSLVDDAKSRIREVTVAETQDRLKQNPQAKLIDVREDNEFAAAHAAGAAHLGKGIIERDIETQVPDKDAELILYCGGGYRSALAADVLQKMGYTNVWSMAGGWRAWNEAGGEIEKGNPQITQK

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
161 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
162 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
163 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
187 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
202 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
239 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
240 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
241 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
242 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
243 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
244 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
245 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
246 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
247 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
248 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
249 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
250 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
251 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
252 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
253 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
254 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
255 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
256 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
257 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
258 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
259 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
260 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
261 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.41
Rhizosphere 96.58
Stem 0
Stem Tuber 0
Unclassified 21.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10415561 3300009177 Unclassified 1515
2 MRS1b_contig_2950096 2162886011 Bacteria 1339
3 MBSR1b_contig_12340576 2162886012 Unclassified 1273
4 MBSR1b_contig_6969273 2162886012 Unclassified 1273
5 JGI25406J46586_10034856 3300003203 Bacteria 1842
6 JGI25406J46586_10093637 3300003203 Bacteria 903
7 Ga0065715_10168773 3300005293 Unclassified 1558
8 Ga0065707_10499148 3300005295 Bacteria 759
9 Ga0070658_10005969 3300005327 Bacteria 9875
10 Ga0070658_11113136 3300005327 Unclassified 687
11 Ga0070676_10199664 3300005328 Bacteria 1310
12 Ga0070676_10575390 3300005328 Bacteria 809
13 Ga0070683_100176341 3300005329 Bacteria 2029
14 Ga0070683_100193719 3300005329 Bacteria 1930
15 Ga0070670_100035426 3300005331 Bacteria 4297
16 Ga0070670_100215057 3300005331 Unclassified 1672
17 Ga0070670_100822252 3300005331 Bacteria 840
18 Ga0068869_100020966 3300005334 Bacteria 4491
19 Ga0068869_100082036 3300005334 Bacteria 2409
20 Ga0068869_100189119 3300005334 Bacteria 1618
21 Ga0068869_100992654 3300005334 Unclassified 731
22 Ga0068869_101183123 3300005334 Unclassified 671
23 Ga0068869_101259176 3300005334 Bacteria 651
24 Ga0070682_100000330 3300005337 Bacteria 32533
25 Ga0068868_100835724 3300005338 Unclassified 833
26 Ga0068868_101538190 3300005338 Unclassified 624
27 Ga0070689_100141636 3300005340 Unclassified 1934
28 Ga0070687_100314803 3300005343 Unclassified 998
29 Ga0070687_100429188 3300005343 Bacteria 874
30 Ga0070661_101019203 3300005344 Bacteria 687
31 Ga0070692_10000693 3300005345 Bacteria 10830
32 Ga0070692_10189842 3300005345 Bacteria 1196
33 Ga0070668_100000481 3300005347 Bacteria 26509
34 Ga0070669_100003176 3300005353 Bacteria 11812
35 Ga0070669_100037177 3300005353 Unclassified 3531
36 Ga0070675_100197132 3300005354 Bacteria 1747
37 Ga0070675_101168315 3300005354 Bacteria 708
38 Ga0070671_100662534 3300005355 Bacteria 904
39 Ga0070674_100066798 3300005356 Bacteria 2528
40 Ga0070673_100244163 3300005364 Unclassified 1563
41 Ga0070688_100705575 3300005365 Unclassified 782
42 Ga0070688_101284833 3300005365 Unclassified 590
43 Ga0070659_100684011 3300005366 Bacteria 886
44 Ga0070659_100988461 3300005366 Bacteria 738
45 Ga0070667_100880117 3300005367 Bacteria 833
46 Ga0070667_101313871 3300005367 Bacteria 678
47 Ga0070709_10019596 3300005434 Bacteria 3913
48 Ga0070710_10004132 3300005437 Bacteria 6890
49 Ga0070701_10102786 3300005438 Unclassified 1585
50 Ga0070701_11186503 3300005438 Bacteria 541
51 Ga0070705_100103630 3300005440 Bacteria 1802
52 Ga0070700_100032646 3300005441 Unclassified 3130
53 Ga0070700_101412990 3300005441 Unclassified 589
54 Ga0070694_100001708 3300005444 Bacteria 12935
55 Ga0070694_100081512 3300005444 Bacteria 2251
56 Ga0070694_100610590 3300005444 Unclassified 879
57 Ga0070708_100011702 3300005445 Bacteria 7142
58 Ga0070708_100185386 3300005445 Unclassified 1946
59 Ga0070708_100226355 3300005445 Bacteria 1754
60 Ga0070708_100349736 3300005445 Bacteria 1393
61 Ga0070708_100804745 3300005445 Unclassified 883
62 Ga0070663_100005383 3300005455 Bacteria 7603
63 Ga0070662_100026077 3300005457 Bacteria 4044
64 Ga0070662_100316028 3300005457 Bacteria 1272
65 Ga0070681_10003956 3300005458 Bacteria 13969
66 Ga0070681_10008246 3300005458 Bacteria 10193
67 Ga0070681_10500279 3300005458 Unclassified 1128
68 Ga0068867_100146313 3300005459 Bacteria 1852
69 Ga0068867_100173300 3300005459 Unclassified 1710
70 Ga0070685_10265050 3300005466 Bacteria 1144
71 Ga0070706_100525992 3300005467 Bacteria 1100
72 Ga0070706_100864858 3300005467 Bacteria 836
73 Ga0070707_100117135 3300005468 Bacteria 2586
74 Ga0070707_100423859 3300005468 Bacteria 1291
75 Ga0070698_100002464 3300005471 Bacteria 20433
76 Ga0070698_100091744 3300005471 Unclassified 3019
77 Ga0070698_100114044 3300005471 Bacteria 2668
78 Ga0070698_100167109 3300005471 Bacteria 2142
79 Ga0070698_101626714 3300005471 Unclassified 598
80 Ga0070699_100230583 3300005518 Bacteria 1651
81 Ga0070699_100401783 3300005518 Bacteria 1239
82 Ga0070699_100428671 3300005518 Unclassified 1198
83 Ga0070699_100611292 3300005518 Bacteria 994
84 Ga0070679_100007513 3300005530 Bacteria 10193
85 Ga0070679_100357793 3300005530 Bacteria 1407
86 Ga0070697_100054746 3300005536 Bacteria 3243
87 Ga0070697_100209312 3300005536 Bacteria 1660
88 Ga0070697_100389051 3300005536 Bacteria 1209
89 Ga0070697_100456311 3300005536 Unclassified 1114
90 Ga0070697_100459087 3300005536 Bacteria 1110
91 Ga0070697_100532855 3300005536 Bacteria 1029
92 Ga0070697_100950779 3300005536 Bacteria 763
93 Ga0070672_100011243 3300005543 Bacteria 6242
94 Ga0070686_100011312 3300005544 Bacteria 5059
95 Ga0070695_100046984 3300005545 Bacteria 2756
96 Ga0070695_100070015 3300005545 Bacteria 2293
97 Ga0070695_100532908 3300005545 Bacteria 913
98 Ga0070695_100776729 3300005545 Bacteria 766
99 Ga0070696_100249122 3300005546 Unclassified 1343
100 Ga0070693_101065763 3300005547 Bacteria 615
101 Ga0070665_100001184 3300005548 Bacteria 31842
102 Ga0070704_100037921 3300005549 Bacteria 3297
103 Ga0070704_100334912 3300005549 Bacteria 1272
104 Ga0070704_100559147 3300005549 Bacteria 1001
105 Ga0070704_100789762 3300005549 Bacteria 848
106 Ga0070704_101133256 3300005549 Bacteria 711
107 Ga0068855_100036289 3300005563 Bacteria 5869
108 Ga0068855_100382630 3300005563 Unclassified 1545
109 Ga0068855_101776691 3300005563 Bacteria 627
110 Ga0070664_100386177 3300005564 Bacteria 1279
111 Ga0070664_100935878 3300005564 Bacteria 813
112 Ga0068857_100340617 3300005577 Unclassified 1387
113 Ga0068857_101257655 3300005577 Bacteria 718
114 Ga0068857_102107853 3300005577 Bacteria 553
115 Ga0068854_100032755 3300005578 Unclassified 3618
116 Ga0068854_100565705 3300005578 Unclassified 966
117 Ga0070702_100045708 3300005615 Bacteria 2479
118 Ga0070702_100449170 3300005615 Bacteria 935
119 Ga0070702_100499742 3300005615 Unclassified 893
120 Ga0068852_101409157 3300005616 Bacteria 719
121 Ga0068859_100125198 3300005617 Bacteria 2639
122 Ga0068859_100549642 3300005617 Bacteria 1249
123 Ga0068859_102283294 3300005617 Unclassified 597
124 Ga0068864_100301849 3300005618 Bacteria 1499
125 Ga0068864_100519301 3300005618 Bacteria 1148
126 Ga0068864_100701900 3300005618 Bacteria 988
127 Ga0068864_101052406 3300005618 Bacteria 808
128 Ga0068861_100037004 3300005719 Bacteria 3626
129 Ga0068861_102228199 3300005719 Bacteria 549
130 Ga0068863_100273206 3300005841 Unclassified 1636
131 Ga0068863_100380455 3300005841 Bacteria 1378
132 Ga0068863_100798224 3300005841 Unclassified 941
133 Ga0068863_100839069 3300005841 Bacteria 917
134 Ga0068863_101054526 3300005841 Viruses 817
135 Ga0068863_101679815 3300005841 Unclassified 644
136 Ga0068858_100024874 3300005842 Bacteria 5575
137 Ga0068858_100131180 3300005842 Bacteria 2350
138 Ga0068858_100143315 3300005842 Bacteria 2244
139 Ga0068860_100021273 3300005843 Bacteria 6283
140 Ga0068860_100135550 3300005843 Bacteria 2364
141 Ga0068860_102775035 3300005843 Bacteria 508
142 Ga0068862_100019298 3300005844 Bacteria 5689
143 Ga0068862_100132284 3300005844 Bacteria 2207
144 Ga0068862_100911590 3300005844 Bacteria 865
145 Ga0081539_10000480 3300005985 Bacteria 84478
146 Ga0081539_10042717 3300005985 Bacteria 2637
147 Ga0070716_100028304 3300006173 Bacteria 3018
148 Ga0070716_100429913 3300006173 Unclassified 957
149 Ga0070716_100643265 3300006173 Unclassified 803
150 Ga0070716_100917535 3300006173 Unclassified 687
151 Ga0070712_100006188 3300006175 Bacteria 7405
152 Ga0097621_100097650 3300006237 Unclassified 2466
153 Ga0097621_100426577 3300006237 Bacteria 1191
154 Ga0075430_100224248 3300006846 Bacteria 1559
155 Ga0075430_101433717 3300006846 Bacteria 567
156 Ga0075431_100084653 3300006847 Bacteria 3273
157 Ga0075433_10089072 3300006852 Bacteria 2728
158 Ga0075433_10352386 3300006852 Bacteria 1301
159 Ga0075433_10817989 3300006852 Bacteria 814
160 Ga0075434_100002929 3300006871 Bacteria 15172
161 Ga0075429_100304686 3300006880 Bacteria 1395
162 Ga0068865_101008856 3300006881 Unclassified 729
163 Ga0075436_100010818 3300006914 Bacteria 6260
164 Ga0075436_101440926 3300006914 Bacteria 522
165 Ga0097620_100125193 3300006931 Bacteria 2639
166 Ga0097620_100549652 3300006931 Bacteria 1249
167 Ga0097620_102282978 3300006931 Unclassified 597
168 Ga0075435_100083196 3300007076 Bacteria 2631
169 Ga0075435_100365684 3300007076 Bacteria 1238
170 Ga0075435_101246176 3300007076 Unclassified 651
171 Ga0075435_101719561 3300007076 Unclassified 550
172 Ga0105251_10230403 3300009011 Bacteria 834
173 Ga0105250_10399805 3300009092 Bacteria 609
174 Ga0105240_10188657 3300009093 Bacteria 2426
175 Ga0111539_10107098 3300009094 Unclassified 3280
176 Ga0105245_10339239 3300009098 Bacteria 1485
177 Ga0114129_10065947 3300009147 Bacteria 5050
178 Ga0114129_10100275 3300009147 Unclassified 4007
179 Ga0114129_10337644 3300009147 Bacteria 1999
180 Ga0114129_10368385 3300009147 Bacteria 1900
181 Ga0114129_10873863 3300009147 Bacteria 1141
182 Ga0114129_11828434 3300009147 Unclassified 738
183 Ga0105243_10015071 3300009148 Bacteria 5851
184 Ga0105243_10528080 3300009148 Bacteria 1123
185 Ga0105243_12737376 3300009148 Bacteria 534
186 Ga0105243_12917786 3300009148 Bacteria 518
187 Ga0105241_10980296 3300009174 Unclassified 790
188 Ga0105242_10166791 3300009176 Unclassified 1932
189 Ga0105237_10001052 3300009545 Bacteria 37056
190 Ga0105237_11737823 3300009545 Unclassified 631
191 Ga0105238_10205912 3300009551 Bacteria 1943
192 Ga0105238_10945097 3300009551 Bacteria 882
193 Ga0105249_10000136 3300009553 Bacteria 96659
194 Ga0105249_10002505 3300009553 Bacteria 15890
195 Ga0105249_10005248 3300009553 Bacteria 11184
196 Ga0105249_10044310 3300009553 Bacteria 4046
197 Ga0105249_10559460 3300009553 Bacteria 1195
198 Ga0105249_11076632 3300009553 Bacteria 874
199 Ga0105249_12131207 3300009553 Unclassified 633
200 Ga0105239_10338098 3300010375 Bacteria 1699
201 Ga0105246_10005442 3300011119 Bacteria 7756
202 Ga0105246_10265266 3300011119 Bacteria 1370
203 Ga0105246_12464900 3300011119 Bacteria 511
204 Ga0157373_10004551 3300013100 Bacteria 10424
205 Ga0157373_10710297 3300013100 Bacteria 737
206 Ga0157374_10971832 3300013296 Unclassified 868
207 Ga0157378_10036845 3300013297 Bacteria 4329
208 Ga0157378_10202227 3300013297 Bacteria 1879
209 Ga0157378_10518614 3300013297 Bacteria 1193
210 Ga0157378_11597731 3300013297 Bacteria 698
211 Ga0163162_10000001 3300013306 Bacteria 751833
212 Ga0163162_10020989 3300013306 Bacteria 6426
213 Ga0163162_10053133 3300013306 Bacteria 4071
214 Ga0163162_10403128 3300013306 Bacteria 1500
215 Ga0163162_11545408 3300013306 Unclassified 756
216 Ga0157372_10025937 3300013307 Bacteria 6375
217 Ga0157372_11077257 3300013307 Bacteria 930
218 Ga0157375_10166956 3300013308 Bacteria 2346
219 Ga0157375_11004203 3300013308 Bacteria 974
220 Ga0163163_10226744 3300014325 Unclassified 1917
221 Ga0157380_10003176 3300014326 Bacteria 11216
222 Ga0157380_10226301 3300014326 Bacteria 1677
223 Ga0157380_11656829 3300014326 Unclassified 696
224 Ga0157380_11856858 3300014326 Bacteria 662
225 Ga0157380_13330024 3300014326 Bacteria 514
226 Ga0182008_10329597 3300014497 Bacteria 805
227 Ga0157377_10220979 3300014745 Unclassified 1213
228 Ga0157379_10142507 3300014968 Bacteria 2161
229 Ga0157379_10217811 3300014968 Bacteria 1729
230 Ga0157379_10240493 3300014968 Bacteria 1642
231 Ga0157379_10682654 3300014968 Bacteria 963
232 Ga0157379_12429507 3300014968 Bacteria 523
233 Ga0157376_10000154 3300014969 Bacteria 47198
234 Ga0163161_10384448 3300017792 Bacteria 1122
235 Ga0206352_11263972 3300020078 Bacteria 987
236 Ga0207653_10294126 3300025885 Unclassified 628
237 Ga0207692_10353725 3300025898 Bacteria 906
238 Ga0207647_10306320 3300025904 Bacteria 904
239 Ga0207699_10139962 3300025906 Bacteria 1589
240 Ga0207699_10441823 3300025906 Bacteria 932
241 Ga0207645_10088267 3300025907 Bacteria 1993
242 Ga0207705_10052092 3300025909 Bacteria 2946
243 Ga0207684_10870810 3300025910 Bacteria 758
244 Ga0207707_10006389 3300025912 Bacteria 10289
245 Ga0207707_10009603 3300025912 Bacteria 8394
246 Ga0207695_10003780 3300025913 Bacteria 21003
247 Ga0207695_10349821 3300025913 Bacteria 1365
248 Ga0207671_10022285 3300025914 Bacteria 4790
249 Ga0207671_10861994 3300025914 Bacteria 717
250 Ga0207693_10017713 3300025915 Bacteria 5680
251 Ga0207663_10549480 3300025916 Bacteria 903
252 Ga0207662_10212243 3300025918 Bacteria 1257
253 Ga0207649_10095777 3300025920 Bacteria 1954
254 Ga0207652_10005485 3300025921 Bacteria 10289
255 Ga0207652_10312384 3300025921 Bacteria 1419
256 Ga0207646_10000131 3300025922 Bacteria 101819
257 Ga0207646_10157540 3300025922 Bacteria 2049
258 Ga0207646_10183667 3300025922 Bacteria 1889
259 Ga0207681_10005397 3300025923 Bacteria 7851
260 Ga0207681_10375544 3300025923 Bacteria 1143
261 Ga0207681_10551102 3300025923 Unclassified 949
262 Ga0207681_10552154 3300025923 Bacteria 948
263 Ga0207694_10139489 3300025924 Bacteria 1949
264 Ga0207650_10002116 3300025925 Bacteria 13877
265 Ga0207650_10206743 3300025925 Bacteria 1575
266 Ga0207659_10239645 3300025926 Bacteria 1467
267 Ga0207659_10558975 3300025926 Unclassified 973
268 Ga0207659_11116062 3300025926 Unclassified 678
269 Ga0207687_10260535 3300025927 Bacteria 1382
270 Ga0207644_10462011 3300025931 Bacteria 1044
271 Ga0207690_10752809 3300025932 Bacteria 803
272 Ga0207706_10006143 3300025933 Bacteria 11154
273 Ga0207706_10277682 3300025933 Bacteria 1461
274 Ga0207706_10396812 3300025933 Bacteria 1196
275 Ga0207686_10000374 3300025934 Bacteria 31268
276 Ga0207686_10126188 3300025934 Unclassified 1749
277 Ga0207709_10034851 3300025935 Bacteria 2970
278 Ga0207709_10166450 3300025935 Bacteria 1543
279 Ga0207709_10406034 3300025935 Bacteria 1043
280 Ga0207709_11740838 3300025935 Bacteria 518
281 Ga0207670_10228847 3300025936 Bacteria 1427
282 Ga0207669_10074556 3300025937 Bacteria 2146
283 Ga0207704_10939769 3300025938 Unclassified 729
284 Ga0207665_10000496 3300025939 Bacteria 26621
285 Ga0207665_10198267 3300025939 Bacteria 1462
286 Ga0207665_10699896 3300025939 Archaea 797
287 Ga0207691_10024304 3300025940 Bacteria 5698
288 Ga0207691_10507777 3300025940 Bacteria 1023
289 Ga0207689_10008674 3300025942 Bacteria 8850
290 Ga0207689_10046562 3300025942 Bacteria 3584
291 Ga0207689_10141589 3300025942 Bacteria 1981
292 Ga0207689_10184181 3300025942 Bacteria 1722
293 Ga0207689_10814684 3300025942 Bacteria 788
294 Ga0207689_11275367 3300025942 Bacteria 618
295 Ga0207661_10069169 3300025944 Unclassified 2878
296 Ga0207679_11125366 3300025945 Bacteria 720
297 Ga0207667_10043413 3300025949 Bacteria 4771
298 Ga0207651_10484126 3300025960 Bacteria 1067
299 Ga0207651_10590858 3300025960 Unclassified 970
300 Ga0207651_11743537 3300025960 Unclassified 561
301 Ga0207712_10000092 3300025961 Bacteria 103502
302 Ga0207712_10043430 3300025961 Bacteria 3101
303 Ga0207712_10225914 3300025961 Bacteria 1500
304 Ga0207668_10000937 3300025972 Bacteria 17546
305 Ga0207668_10489561 3300025972 Bacteria 1056
306 Ga0207658_10944916 3300025986 Bacteria 786
307 Ga0207677_10038102 3300026023 Bacteria 3148
308 Ga0207703_10065550 3300026035 Bacteria 2985
309 Ga0207703_11859566 3300026035 Unclassified 578
310 Ga0207639_11015372 3300026041 Bacteria 777
311 Ga0207639_11361257 3300026041 Bacteria 666
312 Ga0207678_10014232 3300026067 Bacteria 6994
313 Ga0207708_10005090 3300026075 Bacteria 9698
314 Ga0207702_10199734 3300026078 Bacteria 1853
315 Ga0207641_10019680 3300026088 Bacteria 5542
316 Ga0207641_10090133 3300026088 Bacteria 2681
317 Ga0207641_10201022 3300026088 Bacteria 1837
318 Ga0207648_10337982 3300026089 Unclassified 1356
319 Ga0207676_10120511 3300026095 Bacteria 2211
320 Ga0207676_10249677 3300026095 Bacteria 1596
321 Ga0207676_10475720 3300026095 Bacteria 1182
322 Ga0207674_10050099 3300026116 Bacteria 4268
323 Ga0207674_10671892 3300026116 Bacteria 1000
324 Ga0207675_100007423 3300026118 Bacteria 10359
325 Ga0207698_10878140 3300026142 Bacteria 903
326 Ga0268266_10000194 3300028379 Bacteria 106020
327 Ga0268265_10046071 3300028380 Bacteria 3257
328 Ga0268265_11093099 3300028380 Bacteria 791
329 Ga0268264_10662934 3300028381 Bacteria 1033
330 Ga0316177_1175622 3300030731 Bacteria 1004
331 Ga0316176_1068559 3300030732 Bacteria 1006
332 Ga0314311_1138019 3300030733 Bacteria 1838
333 Ga0316178_1181381 3300030735 Bacteria 1061
334 Ga0265325_10102028 3300031241 Bacteria 1403
335 Ga0265340_10009296 3300031247 Bacteria 5279
336 Ga0265316_10491499 3300031344 Unclassified 877
337 Ga0307513_10007110 3300031456 Bacteria 14551
338 Ga0307513_10162543 3300031456 Bacteria 2123
339 Ga0307408_100024576 3300031548 Bacteria 4116
340 Ga0307408_101280076 3300031548 Bacteria 687
341 Ga0307408_101517413 3300031548 Unclassified 634
342 Ga0265313_10033331 3300031595 Bacteria 2619
343 Ga0307405_10282829 3300031731 Bacteria 1249
344 Ga0307405_10304796 3300031731 Bacteria 1210
345 Ga0307405_10736033 3300031731 Bacteria 820
346 Ga0307410_10111180 3300031852 Bacteria 1982
347 Ga0307410_10181928 3300031852 Bacteria 1592
348 Ga0307406_10040236 3300031901 Bacteria 2906
349 Ga0307406_10148853 3300031901 Bacteria 1667
350 Ga0307407_10154603 3300031903 Bacteria 1494
351 Ga0307412_10034174 3300031911 Bacteria 3239
352 Ga0307409_100131206 3300031995 Bacteria 2141
353 Ga0307409_100169655 3300031995 Bacteria 1919
354 Ga0307416_100533710 3300032002 Bacteria 1244
355 Ga0307416_101033731 3300032002 Bacteria 925
356 Ga0307416_101522846 3300032002 Bacteria 774
357 Ga0307414_10045155 3300032004 Bacteria 3015
358 Ga0307414_10446223 3300032004 Bacteria 1134
359 Ga0307411_10130790 3300032005 Bacteria 1834
360 Ga0307411_10161336 3300032005 Bacteria 1679
361 Ga0307415_100001788 3300032126 Bacteria 10525
362 Ga0307415_100021766 3300032126 Bacteria 3948
363 Ga0307510_10383538 3300033180 Unclassified 850
364 Ga0373948_0156232 3300034817 Bacteria 573
365 Ga0373929_0107785 3300035085 Bacteria 709
366 Ga0373939_0487270 3300035114 Unclassified 524
367 Ga0373941_0006827 3300035115 Bacteria 2767
368 Ga0373960_0014675 3300035121 Bacteria 1989
369 Ga0373961_0050103 3300035241 Unclassified 1236
370 Ga0373961_0075765 3300035241 Bacteria 1049
371 Ga0373962_0202890 3300035242 Unclassified 672
372 Ga0373931_0175974 3300035691 Bacteria 1264
373 Ga0373931_0190476 3300035691 Unclassified 1220
374 Ga0373927_0006755 3300035695 Bacteria 7804
375 Ga0373947_0933530 3300035725 Unclassified 592
376 Ga0373937_0954024 3300036401 Bacteria 806
377 Ga0373925_0065021 3300037068 Bacteria 2747
378 Ga0373925_0175185 3300037068 Bacteria 1695
379 Ga0373925_1552432 3300037068 Unclassified 541
380 Ga0395900_0635579 3300037418 Bacteria 1005
381 Ga0395900_1057132 3300037418 Bacteria 730
382 Ga0395898_1177759 3300037466 Unclassified 698
383 Ga0395905_0035972 3300037471 Bacteria 4650
384 Ga0395905_0140083 3300037471 Bacteria 2276
385 Ga0395905_0596096 3300037471 Bacteria 1007
386 Ga0395905_0745400 3300037471 Bacteria 882
387 Ga0436364_1224251 3300037853 Bacteria 13125
388 Ga0395901_0191963 3300038443 Unclassified 2142
389 Ga0395901_0244492 3300038443 Bacteria 1871
390 Ga0395901_0713084 3300038443 Unclassified 1000
391 Ga0436365_1511929 3300039437 Bacteria 730
392 Ga0439439_0007862 3300041406 Bacteria 2505
393 Ga0451807_1986783 3300041486 Unclassified 599
394 Ga0439431_0116235 3300041997 Bacteria 744
395 Ga0439457_191015 3300042014 Bacteria 502
396 Ga0451577_0021803 3300042876 Bacteria 5858
397 Ga0451577_0051877 3300042876 Bacteria 3662
398 Ga0451577_0073508 3300042876 Bacteria 3050
399 Ga0451577_1242039 3300042876 Unclassified 664
400 Ga0451577_1383184 3300042876 Unclassified 624
401 Ga0453683_0000346 3300044673 Bacteria 56371
402 Ga0453683_0265480 3300044673 Bacteria 1095
403 Ga0453683_0280329 3300044673 Bacteria 1064
404 Ga0453683_1073543 3300044673 Unclassified 536
405 Ga0453683_1180836 3300044673 Unclassified 512
406 Ga0466963_0693765 3300044694 Unclassified 718
407 Ga0466963_0929168 3300044694 Unclassified 613
408 Ga0453684_0113499 3300044712 Unclassified 3286
409 Ga0453684_0311943 3300044712 Bacteria 1784
410 Ga0453684_0590596 3300044712 Bacteria 1218
411 Ga0466959_0089300 3300045049 Bacteria 2214
412 Ga0451576_0057702 3300045051 Bacteria 4058
413 Ga0451576_0191497 3300045051 Bacteria 2136
414 Ga0451576_0228048 3300045051 Bacteria 1945
415 Ga0451576_0393594 3300045051 Bacteria 1453
416 Ga0451576_1388967 3300045051 Bacteria 731
417 Ga0466967_0422379 3300045976 Bacteria 1300
418 Ga0495603_0142620 3300046455 Bacteria 1393
419 Ga0495629_0013886 3300046459 Bacteria 5808
420 Ga0495580_0055347 3300046472 Bacteria 2796
421 Ga0495580_0248761 3300046472 Unclassified 1217
422 Ga0495582_0097109 3300046473 Bacteria 1647
423 Ga0495639_0084875 3300046475 Bacteria 1479
424 Ga0495662_0017692 3300046476 Bacteria 3451
425 Ga0495620_0422975 3300046515 Bacteria 504
426 Ga0495666_0116370 3300046526 Unclassified 1254
427 Ga0495665_0357042 3300046531 Unclassified 744
428 Ga0495640_0855167 3300046533 Unclassified 540
429 Ga0495586_0020195 3300046535 Bacteria 3548
430 Ga0495667_0011602 3300046559 Bacteria 5967
431 Ga0495658_0053213 3300046683 Bacteria 2298
432 Ga0495624_0155696 3300046690 Unclassified 1397
433 Ga0495674_0054077 3300047319 Bacteria 3527
434 Ga0495676_0143010 3300047321 Bacteria 1712
435 Ga0495684_0042873 3300047471 Bacteria 3465
436 Ga0496102_0049658 3300048905 Bacteria 3817
437 Ga0496103_0045426 3300048906 Bacteria 2711
438 Ga0496103_0913318 3300048906 Bacteria 550
439 Ga0496105_0630544 3300048908 Bacteria 829
440 Ga0496106_0012043 3300048909 Bacteria 6383
441 Ga0496107_0176588 3300048910 Bacteria 1586
442 Ga0496112_0091184 3300048915 Bacteria 3016
443 Ga0496113_0239993 3300048916 Bacteria 1446
444 Ga0496113_1232076 3300048916 Unclassified 583
445 Ga0496114_0363346 3300048917 Bacteria 1280
446 Ga0496115_0030010 3300048918 Bacteria 4274
447 Ga0501040_0034062 3300049576 Unclassified 3451
448 Ga0501069_0894031 3300049585 Unclassified 540
449 Ga0501202_030968 3300049652 Bacteria 1116
450 Ga0501209_114485 3300049656 Bacteria 797
451 Ga0501217_119595 3300049661 Bacteria 763
452 Ga0501223_046929 3300049663 Bacteria 838
453 Ga0501224_038202 3300049664 Bacteria 724
454 Ga0501227_040801 3300049665 Bacteria 1146
455 Ga0501230_072622 3300049667 Bacteria 710
456 Ga0501235_115392 3300049669 Bacteria 667
457 Ga0501236_009308 3300049670 Bacteria 1266
458 Ga0501239_000919 3300049672 Bacteria 2404
459 Ga0501247_002586 3300049677 Bacteria 1888
460 Ga0501249_012528 3300049679 Bacteria 1793
461 Ga0501249_071595 3300049679 Bacteria 810
462 Ga0501249_186065 3300049679 Unclassified 539
463 Ga0501257_052687 3300049686 Bacteria 1017
464 Ga0501258_017197 3300049687 Bacteria 823
465 Ga0501221_017967 3300049704 Bacteria 1356
466 Ga0501245_019807 3300049708 Bacteria 1045
467 Ga0501262_047809 3300049759 Bacteria 655
468 Ga0501263_016542 3300049760 Bacteria 961
469 Ga0501267_001045 3300049764 Bacteria 2298
470 Ga0501267_057828 3300049764 Unclassified 518
471 Ga0501268_001929 3300049765 Bacteria 2655
472 Ga0501270_000665 3300049767 Bacteria 3022
473 Ga0501270_105276 3300049767 Bacteria 595
474 Ga0501271_013162 3300049768 Bacteria 904
475 Ga0501272_002588 3300049769 Bacteria 1798
476 Ga0501273_007052 3300049770 Bacteria 1315
477 nmdc:mga05p37_143896_c1 3300050507 Bacteria 2920
478 nmdc:mga05p37_68636_c1 3300050507 Bacteria 3157
479 nmdc:mga05p37_73390_c1 3300050507 Bacteria 4211
480 nmdc:mga0qj67_788529_c1 3300050509 Bacteria 753
481 nmdc:mga06r32_1104545_c1 3300050510 Bacteria 742
482 nmdc:mga08y16_1079770_c1 3300050511 Bacteria 779
483 nmdc:mga0n895_1105778_c1 3300050512 Unclassified 770
484 nmdc:mga0n895_401250_c1 3300050512 Unclassified 1387
485 nmdc:mga0n895_58482_c1 3300050512 Unclassified 3801
486 nmdc:mga0rr50_131253_c1 3300050513 Bacteria 2006
487 nmdc:mga0rr50_1481313_c1 3300050513 Unclassified 574
488 nmdc:mga0rr50_453284_c1 3300050513 Unclassified 1087
489 nmdc:mga08x19_1085872_c1 3300050514 Bacteria 568
490 nmdc:mga08x19_201205_c1 3300050514 Unclassified 1365
491 nmdc:mga08x19_298766_c1 3300050514 Bacteria 1118
492 nmdc:mga08x19_693632_c1 3300050514 Unclassified 723
493 nmdc:mga0a205_119008_c1 3300050515 Bacteria 2540
494 nmdc:mga0a205_46834_c1 3300050515 Bacteria 4171
495 nmdc:mga0a205_512114_c1 3300050515 Bacteria 1057
496 Ga0501084_0794998 3300054114 Unclassified 797
497 Ga0530510_1057883 3300061734 Unclassified 621
498 Ga0105248_10415561
499 MRS1b_contig_2950096
500 MBSR1b_contig_12340576
501 MBSR1b_contig_6969273
502 JGI25406J46586_10034856
503 JGI25406J46586_10093637
504 Ga0065715_10168773
505 Ga0065707_10499148
506 Ga0070658_10005969
507 Ga0070658_11113136
508 Ga0070676_10199664
509 Ga0070676_10575390
510 Ga0070683_100176341
511 Ga0070683_100193719
512 Ga0070670_100035426
513 Ga0070670_100215057
514 Ga0070670_100822252
515 Ga0068869_100020966
516 Ga0068869_100082036
517 Ga0068869_100189119
518 Ga0068869_100992654
519 Ga0068869_101183123
520 Ga0068869_101259176
521 Ga0070682_100000330
522 Ga0068868_100835724
523 Ga0068868_101538190
524 Ga0070689_100141636
525 Ga0070687_100314803
526 Ga0070687_100429188
527 Ga0070661_101019203
528 Ga0070692_10000693
529 Ga0070692_10189842
530 Ga0070668_100000481
531 Ga0070669_100003176
532 Ga0070669_100037177
533 Ga0070675_100197132
534 Ga0070675_101168315
535 Ga0070671_100662534
536 Ga0070674_100066798
537 Ga0070673_100244163
538 Ga0070688_100705575
539 Ga0070688_101284833
540 Ga0070659_100684011
541 Ga0070659_100988461
542 Ga0070667_100880117
543 Ga0070667_101313871
544 Ga0070709_10019596
545 Ga0070710_10004132
546 Ga0070701_10102786
547 Ga0070701_11186503
548 Ga0070705_100103630
549 Ga0070700_100032646
550 Ga0070700_101412990
551 Ga0070694_100001708
552 Ga0070694_100081512
553 Ga0070694_100610590
554 Ga0070708_100011702
555 Ga0070708_100185386
556 Ga0070708_100226355
557 Ga0070708_100349736
558 Ga0070708_100804745
559 Ga0070663_100005383
560 Ga0070662_100026077
561 Ga0070662_100316028
562 Ga0070681_10003956
563 Ga0070681_10008246
564 Ga0070681_10500279
565 Ga0068867_100146313
566 Ga0068867_100173300
567 Ga0070685_10265050
568 Ga0070706_100525992
569 Ga0070706_100864858
570 Ga0070707_100117135
571 Ga0070707_100423859
572 Ga0070698_100002464
573 Ga0070698_100091744
574 Ga0070698_100114044
575 Ga0070698_100167109
576 Ga0070698_101626714
577 Ga0070699_100230583
578 Ga0070699_100401783
579 Ga0070699_100428671
580 Ga0070699_100611292
581 Ga0070679_100007513
582 Ga0070679_100357793
583 Ga0070697_100054746
584 Ga0070697_100209312
585 Ga0070697_100389051
586 Ga0070697_100456311
587 Ga0070697_100459087
588 Ga0070697_100532855
589 Ga0070697_100950779
590 Ga0070672_100011243
591 Ga0070686_100011312
592 Ga0070695_100046984
593 Ga0070695_100070015
594 Ga0070695_100532908
595 Ga0070695_100776729
596 Ga0070696_100249122
597 Ga0070693_101065763
598 Ga0070665_100001184
599 Ga0070704_100037921
600 Ga0070704_100334912
601 Ga0070704_100559147
602 Ga0070704_100789762
603 Ga0070704_101133256
604 Ga0068855_100036289
605 Ga0068855_100382630
606 Ga0068855_101776691
607 Ga0070664_100386177
608 Ga0070664_100935878
609 Ga0068857_100340617
610 Ga0068857_101257655
611 Ga0068857_102107853
612 Ga0068854_100032755
613 Ga0068854_100565705
614 Ga0070702_100045708
615 Ga0070702_100449170
616 Ga0070702_100499742
617 Ga0068852_101409157
618 Ga0068859_100125198
619 Ga0068859_100549642
620 Ga0068859_102283294
621 Ga0068864_100301849
622 Ga0068864_100519301
623 Ga0068864_100701900
624 Ga0068864_101052406
625 Ga0068861_100037004
626 Ga0068861_102228199
627 Ga0068863_100273206
628 Ga0068863_100380455
629 Ga0068863_100798224
630 Ga0068863_100839069
631 Ga0068863_101054526
632 Ga0068863_101679815
633 Ga0068858_100024874
634 Ga0068858_100131180
635 Ga0068858_100143315
636 Ga0068860_100021273
637 Ga0068860_100135550
638 Ga0068860_102775035
639 Ga0068862_100019298
640 Ga0068862_100132284
641 Ga0068862_100911590
642 Ga0081539_10000480
643 Ga0081539_10042717
644 Ga0070716_100028304
645 Ga0070716_100429913
646 Ga0070716_100643265
647 Ga0070716_100917535
648 Ga0070712_100006188
649 Ga0097621_100097650
650 Ga0097621_100426577
651 Ga0075430_100224248
652 Ga0075430_101433717
653 Ga0075431_100084653
654 Ga0075433_10089072
655 Ga0075433_10352386
656 Ga0075433_10817989
657 Ga0075434_100002929
658 Ga0075429_100304686
659 Ga0068865_101008856
660 Ga0075436_100010818
661 Ga0075436_101440926
662 Ga0097620_100125193
663 Ga0097620_100549652
664 Ga0097620_102282978
665 Ga0075435_100083196
666 Ga0075435_100365684
667 Ga0075435_101246176
668 Ga0075435_101719561
669 Ga0105251_10230403
670 Ga0105250_10399805
671 Ga0105240_10188657
672 Ga0111539_10107098
673 Ga0105245_10339239
674 Ga0114129_10065947
675 Ga0114129_10100275
676 Ga0114129_10337644
677 Ga0114129_10368385
678 Ga0114129_10873863
679 Ga0114129_11828434
680 Ga0105243_10015071
681 Ga0105243_10528080
682 Ga0105243_12737376
683 Ga0105243_12917786
684 Ga0105241_10980296
685 Ga0105242_10166791
686 Ga0105237_10001052
687 Ga0105237_11737823
688 Ga0105238_10205912
689 Ga0105238_10945097
690 Ga0105249_10000136
691 Ga0105249_10002505
692 Ga0105249_10005248
693 Ga0105249_10044310
694 Ga0105249_10559460
695 Ga0105249_11076632
696 Ga0105249_12131207
697 Ga0105239_10338098
698 Ga0105246_10005442
699 Ga0105246_10265266
700 Ga0105246_12464900
701 Ga0157373_10004551
702 Ga0157373_10710297
703 Ga0157374_10971832
704 Ga0157378_10036845
705 Ga0157378_10202227
706 Ga0157378_10518614
707 Ga0157378_11597731
708 Ga0163162_10000001
709 Ga0163162_10020989
710 Ga0163162_10053133
711 Ga0163162_10403128
712 Ga0163162_11545408
713 Ga0157372_10025937
714 Ga0157372_11077257
715 Ga0157375_10166956
716 Ga0157375_11004203
717 Ga0163163_10226744
718 Ga0157380_10003176
719 Ga0157380_10226301
720 Ga0157380_11656829
721 Ga0157380_11856858
722 Ga0157380_13330024
723 Ga0182008_10329597
724 Ga0157377_10220979
725 Ga0157379_10142507
726 Ga0157379_10217811
727 Ga0157379_10240493
728 Ga0157379_10682654
729 Ga0157379_12429507
730 Ga0157376_10000154
731 Ga0163161_10384448
732 Ga0206352_11263972
733 Ga0207653_10294126
734 Ga0207692_10353725
735 Ga0207647_10306320
736 Ga0207699_10139962
737 Ga0207699_10441823
738 Ga0207645_10088267
739 Ga0207705_10052092
740 Ga0207684_10870810
741 Ga0207707_10006389
742 Ga0207707_10009603
743 Ga0207695_10003780
744 Ga0207695_10349821
745 Ga0207671_10022285
746 Ga0207671_10861994
747 Ga0207693_10017713
748 Ga0207663_10549480
749 Ga0207662_10212243
750 Ga0207649_10095777
751 Ga0207652_10005485
752 Ga0207652_10312384
753 Ga0207646_10000131
754 Ga0207646_10157540
755 Ga0207646_10183667
756 Ga0207681_10005397
757 Ga0207681_10375544
758 Ga0207681_10551102
759 Ga0207681_10552154
760 Ga0207694_10139489
761 Ga0207650_10002116
762 Ga0207650_10206743
763 Ga0207659_10239645
764 Ga0207659_10558975
765 Ga0207659_11116062
766 Ga0207687_10260535
767 Ga0207644_10462011
768 Ga0207690_10752809
769 Ga0207706_10006143
770 Ga0207706_10277682
771 Ga0207706_10396812
772 Ga0207686_10000374
773 Ga0207686_10126188
774 Ga0207709_10034851
775 Ga0207709_10166450
776 Ga0207709_10406034
777 Ga0207709_11740838
778 Ga0207670_10228847
779 Ga0207669_10074556
780 Ga0207704_10939769
781 Ga0207665_10000496
782 Ga0207665_10198267
783 Ga0207665_10699896
784 Ga0207691_10024304
785 Ga0207691_10507777
786 Ga0207689_10008674
787 Ga0207689_10046562
788 Ga0207689_10141589
789 Ga0207689_10184181
790 Ga0207689_10814684
791 Ga0207689_11275367
792 Ga0207661_10069169
793 Ga0207679_11125366
794 Ga0207667_10043413
795 Ga0207651_10484126
796 Ga0207651_10590858
797 Ga0207651_11743537
798 Ga0207712_10000092
799 Ga0207712_10043430
800 Ga0207712_10225914
801 Ga0207668_10000937
802 Ga0207668_10489561
803 Ga0207658_10944916
804 Ga0207677_10038102
805 Ga0207703_10065550
806 Ga0207703_11859566
807 Ga0207639_11015372
808 Ga0207639_11361257
809 Ga0207678_10014232
810 Ga0207708_10005090
811 Ga0207702_10199734
812 Ga0207641_10019680
813 Ga0207641_10090133
814 Ga0207641_10201022
815 Ga0207648_10337982
816 Ga0207676_10120511
817 Ga0207676_10249677
818 Ga0207676_10475720
819 Ga0207674_10050099
820 Ga0207674_10671892
821 Ga0207675_100007423
822 Ga0207698_10878140
823 Ga0268266_10000194
824 Ga0268265_10046071
825 Ga0268265_11093099
826 Ga0268264_10662934
827 Ga0316177_1175622
828 Ga0316176_1068559
829 Ga0314311_1138019
830 Ga0316178_1181381
831 Ga0265325_10102028
832 Ga0265340_10009296
833 Ga0265316_10491499
834 Ga0307513_10007110
835 Ga0307513_10162543
836 Ga0307408_100024576
837 Ga0307408_101280076
838 Ga0307408_101517413
839 Ga0265313_10033331
840 Ga0307405_10282829
841 Ga0307405_10304796
842 Ga0307405_10736033
843 Ga0307410_10111180
844 Ga0307410_10181928
845 Ga0307406_10040236
846 Ga0307406_10148853
847 Ga0307407_10154603
848 Ga0307412_10034174
849 Ga0307409_100131206
850 Ga0307409_100169655
851 Ga0307416_100533710
852 Ga0307416_101033731
853 Ga0307416_101522846
854 Ga0307414_10045155
855 Ga0307414_10446223
856 Ga0307411_10130790
857 Ga0307411_10161336
858 Ga0307415_100001788
859 Ga0307415_100021766
860 Ga0307510_10383538
861 Ga0373948_0156232
862 Ga0373929_0107785
863 Ga0373939_0487270
864 Ga0373941_0006827
865 Ga0373960_0014675
866 Ga0373961_0050103
867 Ga0373961_0075765
868 Ga0373962_0202890
869 Ga0373931_0175974
870 Ga0373931_0190476
871 Ga0373927_0006755
872 Ga0373947_0933530
873 Ga0373937_0954024
874 Ga0373925_0065021
875 Ga0373925_0175185
876 Ga0373925_1552432
877 Ga0395900_0635579
878 Ga0395900_1057132
879 Ga0395898_1177759
880 Ga0395905_0035972
881 Ga0395905_0140083
882 Ga0395905_0596096
883 Ga0395905_0745400
884 Ga0436364_1224251
885 Ga0395901_0191963
886 Ga0395901_0244492
887 Ga0395901_0713084
888 Ga0436365_1511929
889 Ga0439439_0007862
890 Ga0451807_1986783
891 Ga0439431_0116235
892 Ga0439457_191015
893 Ga0451577_0021803
894 Ga0451577_0051877
895 Ga0451577_0073508
896 Ga0451577_1242039
897 Ga0451577_1383184
898 Ga0453683_0000346
899 Ga0453683_0265480
900 Ga0453683_0280329
901 Ga0453683_1073543
902 Ga0453683_1180836
903 Ga0466963_0693765
904 Ga0466963_0929168
905 Ga0453684_0113499
906 Ga0453684_0311943
907 Ga0453684_0590596
908 Ga0466959_0089300
909 Ga0451576_0057702
910 Ga0451576_0191497
911 Ga0451576_0228048
912 Ga0451576_0393594
913 Ga0451576_1388967
914 Ga0466967_0422379
915 Ga0495603_0142620
916 Ga0495629_0013886
917 Ga0495580_0055347
918 Ga0495580_0248761
919 Ga0495582_0097109
920 Ga0495639_0084875
921 Ga0495662_0017692
922 Ga0495620_0422975
923 Ga0495666_0116370
924 Ga0495665_0357042
925 Ga0495640_0855167
926 Ga0495586_0020195
927 Ga0495667_0011602
928 Ga0495658_0053213
929 Ga0495624_0155696
930 Ga0495674_0054077
931 Ga0495676_0143010
932 Ga0495684_0042873
933 Ga0496102_0049658
934 Ga0496103_0045426
935 Ga0496103_0913318
936 Ga0496105_0630544
937 Ga0496106_0012043
938 Ga0496107_0176588
939 Ga0496112_0091184
940 Ga0496113_0239993
941 Ga0496113_1232076
942 Ga0496114_0363346
943 Ga0496115_0030010
944 Ga0501040_0034062
945 Ga0501069_0894031
946 Ga0501202_030968
947 Ga0501209_114485
948 Ga0501217_119595
949 Ga0501223_046929
950 Ga0501224_038202
951 Ga0501227_040801
952 Ga0501230_072622
953 Ga0501235_115392
954 Ga0501236_009308
955 Ga0501239_000919
956 Ga0501247_002586
957 Ga0501249_012528
958 Ga0501249_071595
959 Ga0501249_186065
960 Ga0501257_052687
961 Ga0501258_017197
962 Ga0501221_017967
963 Ga0501245_019807
964 Ga0501262_047809
965 Ga0501263_016542
966 Ga0501267_001045
967 Ga0501267_057828
968 Ga0501268_001929
969 Ga0501270_000665
970 Ga0501270_105276
971 Ga0501271_013162
972 Ga0501272_002588
973 Ga0501273_007052
974 nmdc:mga05p37_143896_c1
975 nmdc:mga05p37_68636_c1
976 nmdc:mga05p37_73390_c1
977 nmdc:mga0qj67_788529_c1
978 nmdc:mga06r32_1104545_c1
979 nmdc:mga08y16_1079770_c1
980 nmdc:mga0n895_1105778_c1
981 nmdc:mga0n895_401250_c1
982 nmdc:mga0n895_58482_c1
983 nmdc:mga0rr50_131253_c1
984 nmdc:mga0rr50_1481313_c1
985 nmdc:mga0rr50_453284_c1
986 nmdc:mga08x19_1085872_c1
987 nmdc:mga08x19_201205_c1
988 nmdc:mga08x19_298766_c1
989 nmdc:mga08x19_693632_c1
990 nmdc:mga0a205_119008_c1
991 nmdc:mga0a205_46834_c1
992 nmdc:mga0a205_512114_c1
993 Ga0501084_0794998
994 Ga0530510_1057883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

40

134

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mxv-assembly1.cif.gz_A the crystal structure of a rhodanese-like family protein from francisella tularensis subsp. tularensis schu s4 0.9151 1 119
6mxv-assembly1.cif.gz_A the crystal structure of a rhodanese-like family protein from francisella tularensis subsp. tularensis schu s4 0.9079 1 119
3hix-assembly3.cif.gz_C crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.8891 33 119
3hix-assembly1.cif.gz_A crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.8876 33 119
5ve5-assembly2.cif.gz_B crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione 0.88 32 119
ID Description Score Start End Superfamily
af_Q38853_56_181_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9248 17 119 3.40.250.10
af_I1LP77_2_120_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9122 17 115 3.40.250.10
af_C4J4B7_337_476_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9101 19 113 3.40.250.10
af_D1ME28_2_123_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9091 17 115 3.40.250.10
af_Q9SR92_41_180_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8779 17 110 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A7W1FGQ6-F1-model_v4 Sulfurtransferase 0.9691 1 114 GO:0004792
AF-A0A517U233-F1-model_v4 Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1) 0.9579 1 119 GO:0004792
AF-A0A381WPD5-F1-model_v4 Rhodanese domain-containing protein 0.9566 10 119
AF-A0A1H2G749-F1-model_v4 Rhodanese-related sulfurtransferase 0.9564 1 119 GO:0004792
AF-A0A0A2WL79-F1-model_v4 Molybdopterin biosynthesis protein MoeB 0.956 18 119 GO:0004792
GO:0005524
GO:0005829
GO:0008146
GO:0008641
GO:0016779

Map