F454949

General Info

Members Datasets Scaffolds Average Seq Length
496 342 468 233

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0003855|Ga0496114_0003855_6905_7741
Length 278
Sequence MCSQAVGKTSLDSLLEQSIGSWLIYSITVQDHAARLTTPRSSAMITLRPAQARGHANHGWLDSWHSFSFANYFDDQHVHWGPLRVINEDRVAAGRGFGEHGHRDMEIISYVLEGALGHKDSMGNSSSIVPGDVQRMSAGTGVQHSEFNYNESGTTHFLQIWIIPDRQGVTPSYAEKAFPATEKQGRLRLVISPDGGDGSISIQQDARMYVGLFDGSEKAELPLAEGRLGYVHVARGEVTVNGKPLKAGDALLYDGEPLVSIERGIGSEVLVFDLPRMQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
6 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
7 2643221695 Lysobacter sp. Root494 Isolate Unclassified
8 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
9 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
10 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
11 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
12 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
13 2876601092 Pantoea endophytica 596 Isolate Unclassified
14 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
15 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
16 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
17 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
18 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
19 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
20 2904504865 Serratia marcescens 1822 Isolate Unclassified
21 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
22 2932406140 Serratia sp. 2723 Isolate Rhizosphere
23 2939577877 Serratia sp. 509 Isolate Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
97 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
144 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
196 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
199 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
200 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
201 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
202 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
203 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
204 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
205 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
206 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
207 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
208 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
209 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
210 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
211 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
212 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
213 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
275 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
276 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
277 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
278 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
283 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
284 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
307 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
308 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
309 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
310 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
321 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
322 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
323 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
328 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
329 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
330 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
331 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
332 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
333 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
337 640753048 Serratia proteamaculans 568 Isolate Endosphere
338 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
339 8004592986 Serratia sp. S119 Isolate Unclassified
340 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
341 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
342 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.55
Metatranscriptomes 0.81
Isolates 5.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.04
Nodule 0.4
Rhizoplane 2.62
Rhizosphere 84.07
Stem 0
Stem Tuber 0
Unclassified 7.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1851671 2162886007 Bacteria 4382
2 JGI24739J22299_10000107 3300001989 Bacteria 25402
3 JGI25162J39368_1000007 3300002737 Bacteria 403947
4 rootH2_10005386 3300003320 Bacteria 74798
5 rootH1_10078708 3300003323 Bacteria 1768
6 Ga0055536_1001684 3300003781 Bacteria 13103
7 Ga0065703_1020638 3300005272 Bacteria 1656
8 Ga0065704_10070919 3300005289 Bacteria 14652
9 Ga0068868_100211494 3300005338 Bacteria 1621
10 Ga0068868_100377429 3300005338 Bacteria 1219
11 Ga0070689_100186592 3300005340 Bacteria 1687
12 Ga0070689_100205843 3300005340 Bacteria 1609
13 Ga0070689_100737482 3300005340 Bacteria 863
14 Ga0070687_100290753 3300005343 Bacteria 1033
15 Ga0070692_10025021 3300005345 Bacteria 2940
16 Ga0070669_100458231 3300005353 Bacteria 1052
17 Ga0070675_100017058 3300005354 Bacteria 5772
18 Ga0070671_100253818 3300005355 Bacteria 1494
19 Ga0070673_100181525 3300005364 Bacteria 1802
20 Ga0070673_100494504 3300005364 Bacteria 1106
21 Ga0070688_100206852 3300005365 Bacteria 1376
22 Ga0070714_100001772 3300005435 Bacteria 15735
23 Ga0070714_100015965 3300005435 Bacteria 6055
24 Ga0070701_10305403 3300005438 Bacteria 979
25 Ga0070711_100458889 3300005439 Bacteria 1044
26 Ga0070705_100054401 3300005440 Bacteria 2348
27 Ga0070700_100014470 3300005441 Bacteria 4455
28 Ga0070694_100023136 3300005444 Bacteria 3992
29 Ga0070694_100150111 3300005444 Bacteria 1701
30 Ga0070663_100046329 3300005455 Bacteria 3076
31 Ga0070662_100008279 3300005457 Bacteria 6773
32 Ga0068867_100248830 3300005459 Bacteria 1445
33 Ga0070706_100114912 3300005467 Bacteria 2506
34 Ga0070707_100123106 3300005468 Bacteria 2518
35 Ga0070698_100123876 3300005471 Bacteria 2542
36 Ga0070699_100188003 3300005518 Bacteria 1834
37 Ga0070679_100026952 3300005530 Bacteria 5651
38 Ga0070679_100239762 3300005530 Bacteria 1771
39 Ga0070679_100972066 3300005530 Bacteria 793
40 Ga0070684_100048049 3300005535 Bacteria 3701
41 Ga0070697_100002781 3300005536 Bacteria 13474
42 Ga0070697_100126708 3300005536 Bacteria 2139
43 Ga0070686_100008505 3300005544 Bacteria 5748
44 Ga0070695_100011088 3300005545 Bacteria 5388
45 Ga0070695_100259892 3300005545 Bacteria 1268
46 Ga0070696_100269404 3300005546 Bacteria 1294
47 Ga0070693_100004415 3300005547 Bacteria 6649
48 Ga0070693_100120740 3300005547 Bacteria 1625
49 Ga0070693_100299893 3300005547 Bacteria 1083
50 Ga0070665_100299227 3300005548 Bacteria 1611
51 Ga0070704_100081562 3300005549 Bacteria 2383
52 Ga0070704_100666488 3300005549 Bacteria 920
53 Ga0070702_100038397 3300005615 Bacteria 2666
54 Ga0068859_101092046 3300005617 Bacteria 877
55 Ga0068864_100018648 3300005618 Bacteria 5799
56 Ga0068866_10376516 3300005718 Bacteria 909
57 Ga0068861_100139227 3300005719 Bacteria 1979
58 Ga0068861_100192116 3300005719 Bacteria 1707
59 Ga0068863_100669760 3300005841 Bacteria 1030
60 Ga0068860_100212677 3300005843 Bacteria 1876
61 Ga0068862_100014628 3300005844 Bacteria 6517
62 Ga0068862_100266416 3300005844 Bacteria 1565
63 Ga0081539_10000496 3300005985 Bacteria 82338
64 Ga0075365_10009131 3300006038 Bacteria 5680
65 Ga0075364_10000071 3300006051 Bacteria 39405
66 Ga0075364_10101648 3300006051 Bacteria 1914
67 Ga0075369_10013066 3300006186 Bacteria 3288
68 Ga0075366_10004427 3300006195 Bacteria 7539
69 Ga0075366_10066176 3300006195 Bacteria 2150
70 Ga0075366_10101187 3300006195 Bacteria 1729
71 Ga0097621_100001351 3300006237 Bacteria 16880
72 Ga0075428_100000107 3300006844 Bacteria 70381
73 Ga0075428_100008331 3300006844 Bacteria 11491
74 Ga0075428_100223646 3300006844 Bacteria 2032
75 Ga0075430_100069573 3300006846 Bacteria 2952
76 Ga0075430_100101971 3300006846 Bacteria 2396
77 Ga0075431_100153423 3300006847 Bacteria 2371
78 Ga0075433_10002934 3300006852 Bacteria 13090
79 Ga0075433_10019821 3300006852 Bacteria 5612
80 Ga0075433_10034636 3300006852 Bacteria 4338
81 Ga0075433_10500195 3300006852 Bacteria 1070
82 Ga0075434_100001090 3300006871 Bacteria 22240
83 Ga0075434_100011032 3300006871 Bacteria 8502
84 Ga0075434_100131120 3300006871 Bacteria 2525
85 Ga0075434_100480903 3300006871 Bacteria 1263
86 Ga0075429_100000317 3300006880 Bacteria 34568
87 Ga0075429_100002952 3300006880 Bacteria 14428
88 Ga0075436_100000593 3300006914 Bacteria 23748
89 Ga0075436_100001604 3300006914 Bacteria 15447
90 Ga0075436_100006924 3300006914 Bacteria 7756
91 Ga0075436_100016824 3300006914 Bacteria 5005
92 Ga0075436_100017307 3300006914 Bacteria 4934
93 Ga0075436_100040125 3300006914 Bacteria 3230
94 Ga0075436_100212591 3300006914 Bacteria 1371
95 Ga0097620_101092051 3300006931 Bacteria 877
96 Ga0079104_1002497 3300006946 Bacteria 9789
97 Ga0075435_100000229 3300007076 Bacteria 34254
98 Ga0075435_100073601 3300007076 Bacteria 2793
99 Ga0075435_100132387 3300007076 Bacteria 2087
100 Ga0075435_100573956 3300007076 Bacteria 977
101 Ga0075435_100757542 3300007076 Bacteria 845
102 Ga0099794_10016077 3300007265 Bacteria 3312
103 Ga0105251_10000230 3300009011 Bacteria 56255
104 Ga0105251_10000233 3300009011 Bacteria 55865
105 Ga0105251_10010612 3300009011 Bacteria 5326
106 Ga0105251_10016472 3300009011 Bacteria 3993
107 Ga0105244_10001361 3300009036 Bacteria 19852
108 Ga0105250_10000020 3300009092 Bacteria 242010
109 Ga0105250_10008877 3300009092 Bacteria 4252
110 Ga0111539_10005775 3300009094 Bacteria 15996
111 Ga0111539_10009312 3300009094 Bacteria 12402
112 Ga0111539_10018067 3300009094 Bacteria 8735
113 Ga0111539_10029811 3300009094 Bacteria 6639
114 Ga0111539_10226420 3300009094 Bacteria 2178
115 Ga0105247_10000396 3300009101 Bacteria 36915
116 Ga0114129_10001717 3300009147 Bacteria 29906
117 Ga0105243_10235286 3300009148 Bacteria 1627
118 Ga0105241_10000013 3300009174 Bacteria 172249
119 Ga0105242_10014042 3300009176 Bacteria 6198
120 Ga0105029_102780 3300009984 Bacteria 1148
121 Ga0105028_104845 3300009993 Bacteria 1403
122 Ga0105246_10019180 3300011119 Bacteria 4366
123 Ga0105246_10225459 3300011119 Bacteria 1472
124 Ga0157373_10000081 3300013100 Bacteria 82343
125 Ga0157373_10004744 3300013100 Bacteria 10228
126 Ga0157371_10003054 3300013102 Bacteria 15537
127 Ga0157374_10672242 3300013296 Unclassified 1048
128 Ga0157378_10085314 3300013297 Bacteria 2860
129 Ga0163162_10084587 3300013306 Bacteria 3248
130 Ga0157372_10050434 3300013307 Bacteria 4629
131 Ga0157372_10079938 3300013307 Bacteria 3698
132 Ga0157372_10084043 3300013307 Bacteria 3607
133 Ga0182008_10008294 3300014497 Bacteria 5677
134 Ga0157376_10425113 3300014969 Bacteria 1290
135 Ga0182006_1042856 3300015261 Bacteria 1771
136 Ga0163161_10000028 3300017792 Bacteria 197151
137 Ga0209676_1000024 3300025292 Bacteria 578839
138 Ga0209257_1000170 3300025304 Bacteria 169384
139 Ga0207696_1000036 3300025711 Bacteria 337736
140 Ga0207696_1000068 3300025711 Bacteria 228017
141 Ga0207696_1000557 3300025711 Bacteria 29652
142 Ga0207655_1000106 3300025728 Bacteria 181416
143 Ga0207655_1030501 3300025728 Bacteria 2506
144 Ga0207713_1000044 3300025735 Bacteria 238074
145 Ga0207713_1000062 3300025735 Bacteria 208832
146 Ga0207713_1006491 3300025735 Bacteria 7113
147 Ga0207713_1007196 3300025735 Bacteria 6630
148 Ga0207710_10000145 3300025900 Bacteria 80941
149 Ga0207685_10059237 3300025905 Bacteria 1509
150 Ga0207645_10026933 3300025907 Bacteria 3715
151 Ga0207654_10000016 3300025911 Bacteria 211550
152 Ga0207707_10013310 3300025912 Bacteria 7171
153 Ga0207707_10084896 3300025912 Bacteria 2766
154 Ga0207707_10501529 3300025912 Bacteria 1035
155 Ga0207663_10416295 3300025916 Bacteria 1031
156 Ga0207660_10374426 3300025917 Bacteria 1144
157 Ga0207652_10149805 3300025921 Bacteria 2088
158 Ga0207646_10453780 3300025922 Bacteria 1157
159 Ga0207659_10072424 3300025926 Bacteria 2519
160 Ga0207700_10261199 3300025928 Bacteria 1483
161 Ga0207664_10007528 3300025929 Bacteria 7555
162 Ga0207664_10907730 3300025929 Bacteria 791
163 Ga0207709_10093129 3300025935 Bacteria 1975
164 Ga0207670_10303116 3300025936 Bacteria 1251
165 Ga0207670_10444049 3300025936 Bacteria 1045
166 Ga0207689_10044295 3300025942 Bacteria 3678
167 Ga0207651_10232355 3300025960 Bacteria 1498
168 Ga0207712_10360919 3300025961 Bacteria 1210
169 Ga0207677_10201775 3300026023 Bacteria 1581
170 Ga0207703_10451565 3300026035 Bacteria 1201
171 Ga0207678_10034038 3300026067 Bacteria 4438
172 Ga0207708_10427962 3300026075 Bacteria 1099
173 Ga0207702_10076220 3300026078 Bacteria 2898
174 Ga0207641_10163450 3300026088 Bacteria 2026
175 Ga0207648_10327159 3300026089 Bacteria 1378
176 Ga0207676_10030973 3300026095 Bacteria 4020
177 Ga0207674_10794722 3300026116 Bacteria 913
178 Ga0207675_100158730 3300026118 Bacteria 2156
179 Ga0207675_100192107 3300026118 Bacteria 1959
180 Ga0207683_10115027 3300026121 Bacteria 2411
181 Ga0207683_10162721 3300026121 Bacteria 2018
182 Ga0207698_10111234 3300026142 Bacteria 2296
183 Ga0207698_10382077 3300026142 Bacteria 1340
184 Ga0209281_1000107 3300027111 Bacteria 218397
185 Ga0209969_1003492 3300027360 Bacteria 2175
186 Ga0209969_1004338 3300027360 Bacteria 1984
187 Ga0209967_1001392 3300027364 Bacteria 3099
188 Ga0209981_1001824 3300027378 Bacteria 2702
189 Ga0210000_1002695 3300027462 Bacteria 2529
190 Ga0210000_1010958 3300027462 Bacteria 1343
191 Ga0209995_1002834 3300027471 Bacteria 2747
192 Ga0209999_1002191 3300027543 Bacteria 3419
193 Ga0209999_1004623 3300027543 Bacteria 2472
194 Ga0209588_1049292 3300027671 Bacteria 1363
195 Ga0207428_10000179 3300027907 Bacteria 88854
196 Ga0207428_10020477 3300027907 Bacteria 5618
197 Ga0207428_10034099 3300027907 Bacteria 4174
198 Ga0207428_10209995 3300027907 Bacteria 1463
199 Ga0268264_10156428 3300028381 Bacteria 2049
200 Ga0265326_10031321 3300028558 Bacteria 1515
201 Ga0265334_10000017 3300028573 Bacteria 147461
202 Ga0265338_10026656 3300028800 Bacteria 5820
203 Ga0307511_10000108 3300030521 Bacteria 74238
204 Ga0307513_10053910 3300031456 Bacteria 4317
205 Ga0307513_10187057 3300031456 Bacteria 1927
206 Ga0307408_100486867 3300031548 Bacteria 1077
207 Ga0265313_10000022 3300031595 Bacteria 144838
208 Ga0265313_10077584 3300031595 Bacteria 1516
209 Ga0307516_10311996 3300031730 Bacteria 1246
210 Ga0307413_10065057 3300031824 Bacteria 2269
211 Ga0307410_10472055 3300031852 Bacteria 1027
212 Ga0307410_10530965 3300031852 Bacteria 972
213 Ga0307406_10182256 3300031901 Bacteria 1530
214 Ga0307409_100263865 3300031995 Bacteria 1582
215 Ga0307409_100269574 3300031995 Bacteria 1567
216 Ga0307409_100287702 3300031995 Bacteria 1522
217 Ga0307416_100022451 3300032002 Bacteria 4556
218 Ga0307416_100068295 3300032002 Bacteria 2936
219 Ga0307416_100225071 3300032002 Bacteria 1803
220 Ga0307416_100395218 3300032002 Bacteria 1418
221 Ga0307414_10003843 3300032004 Bacteria 8080
222 Ga0307414_10285570 3300032004 Bacteria 1389
223 Ga0307414_10505464 3300032004 Bacteria 1070
224 Ga0307414_10832818 3300032004 Bacteria 843
225 Ga0307414_10847184 3300032004 Bacteria 836
226 Ga0307415_100112153 3300032126 Bacteria 2026
227 Ga0307507_10025756 3300033179 Bacteria 6367
228 Ga0373930_0070381 3300034816 Bacteria 795
229 Ga0373926_0008847 3300035083 Bacteria 3354
230 Ga0373934_0051832 3300035086 Bacteria 1627
231 Ga0373932_0054421 3300035112 Bacteria 1197
232 Ga0373936_0024942 3300035113 Bacteria 2336
233 Ga0373939_0003944 3300035114 Bacteria 3491
234 Ga0373941_0008262 3300035115 Bacteria 2579
235 Ga0373941_0151685 3300035115 Bacteria 851
236 Ga0373945_0005768 3300035116 Bacteria 3973
237 Ga0373960_0058190 3300035121 Bacteria 1165
238 Ga0373943_0062728 3300035170 Bacteria 1861
239 Ga0373946_0036820 3300035171 Bacteria 1986
240 Ga0373942_0029070 3300035207 Bacteria 1448
241 Ga0373961_0139058 3300035241 Bacteria 819
242 Ga0373962_0035700 3300035242 Bacteria 1381
243 Ga0316574_0240123 3300035398 Bacteria 1158
244 Ga0316574_0468911 3300035398 Unclassified 788
245 Ga0373924_0078428 3300035410 Bacteria 1402
246 Ga0373931_0010935 3300035691 Bacteria 4372
247 Ga0373931_0025228 3300035691 Bacteria 3019
248 Ga0373931_0089954 3300035691 Bacteria 1709
249 Ga0373931_0215207 3300035691 Bacteria 1154
250 Ga0373931_0219763 3300035691 Bacteria 1143
251 Ga0373935_0036322 3300035692 Bacteria 3079
252 Ga0373927_0009707 3300035695 Bacteria 6453
253 Ga0373933_0710941 3300035724 Bacteria 661
254 Ga0373947_0075888 3300035725 Bacteria 2070
255 Ga0373925_0015285 3300037068 Bacteria 5550
256 Ga0395899_0170380 3300037312 Bacteria 1533
257 Ga0395898_0346624 3300037466 Bacteria 1416
258 Ga0237816_02012 3300039145 Bacteria 1602
259 Ga0436361_1102119 3300039447 Bacteria 1641
260 Ga0439436_0036455 3300041404 Bacteria 1419
261 Ga0439466_0019916 3300041411 Bacteria 2397
262 Ga0439466_0122546 3300041411 Bacteria 802
263 Ga0439465_0001020 3300041413 Bacteria 8908
264 Ga0439465_0021577 3300041413 Bacteria 2020
265 Ga0451791_0606939 3300041451 Bacteria 1515
266 Ga0451793_1630383 3300041452 Bacteria 2322
267 Ga0451797_1003378 3300041453 Bacteria 2171
268 Ga0451802_0724729 3300041460 Bacteria 985
269 Ga0451807_2152295 3300041486 Bacteria 2593
270 Ga0451807_2384151 3300041486 Bacteria 1032
271 Ga0451837_0571131 3300041494 Bacteria 2448
272 Ga0451843_0075458 3300041509 Bacteria 1654
273 Ga0451843_0662141 3300041509 Bacteria 1530
274 Ga0439431_0004092 3300041997 Bacteria 3208
275 Ga0439445_0003943 3300042004 Bacteria 3347
276 Ga0439445_0016603 3300042004 Bacteria 1812
277 Ga0439432_011274 3300042006 Bacteria 3082
278 Ga0439449_0000018 3300042007 Bacteria 46636
279 Ga0439449_0008520 3300042007 Bacteria 3896
280 Ga0439449_0009369 3300042007 Bacteria 3713
281 Ga0439449_0018214 3300042007 Bacteria 2635
282 Ga0439456_043083 3300042013 Bacteria 981
283 Ga0450923_019625 3300042125 Bacteria 1304
284 Ga0450896_020740 3300042133 Bacteria 963
285 Ga0439435_0007780 3300042436 Bacteria 2466
286 Ga0439460_0001673 3300042461 Bacteria 5255
287 Ga0451577_0015419 3300042876 Bacteria 7112
288 Ga0451577_0030922 3300042876 Bacteria 4834
289 Ga0451577_0229986 3300042876 Bacteria 1677
290 Ga0451577_0531029 3300042876 Bacteria 1068
291 Ga0466969_0005519 3300044656 Bacteria 6720
292 Ga0466965_0006319 3300044683 Bacteria 5370
293 Ga0466965_0128606 3300044683 Bacteria 1312
294 Ga0466966_0025545 3300044684 Bacteria 3857
295 Ga0466966_0276921 3300044684 Bacteria 1009
296 Ga0466961_0000186 3300044693 Bacteria 41739
297 Ga0453684_0001838 3300044712 Bacteria 55467
298 Ga0453684_0577436 3300044712 Bacteria 1235
299 Ga0453684_0882040 3300044712 Bacteria 959
300 Ga0466971_0057905 3300044719 Bacteria 1749
301 Ga0466959_0000908 3300045049 Bacteria 17509
302 Ga0451576_0003504 3300045051 Bacteria 21445
303 Ga0451576_0011469 3300045051 Bacteria 10062
304 Ga0451576_0080843 3300045051 Bacteria 3381
305 Ga0451576_0098067 3300045051 Bacteria 3048
306 Ga0451576_0422758 3300045051 Bacteria 1398
307 Ga0495627_000100 3300046453 Bacteria 106276
308 Ga0495592_0001600 3300046454 Bacteria 15847
309 Ga0495603_0117204 3300046455 Bacteria 1552
310 Ga0495650_0082873 3300046471 Bacteria 1233
311 Ga0495580_0000780 3300046472 Bacteria 27419
312 Ga0495582_0018378 3300046473 Bacteria 3824
313 Ga0495582_0135587 3300046473 Bacteria 1393
314 Ga0495662_0005281 3300046476 Bacteria 6470
315 Ga0495608_0000167 3300046511 Bacteria 46550
316 Ga0495620_0166566 3300046515 Bacteria 855
317 Ga0495628_0003674 3300046516 Bacteria 13697
318 Ga0495630_0001186 3300046517 Bacteria 17967
319 Ga0495630_0093027 3300046517 Bacteria 2279
320 Ga0495643_0238755 3300046522 Bacteria 853
321 Ga0495663_0011477 3300046525 Bacteria 2465
322 Ga0495666_0038565 3300046526 Bacteria 2323
323 Ga0495654_0000616 3300046530 Bacteria 28330
324 Ga0495640_0000309 3300046533 Bacteria 33726
325 Ga0495586_0000827 3300046535 Bacteria 17795
326 Ga0495586_0004233 3300046535 Bacteria 7682
327 Ga0495587_0050723 3300046536 Bacteria 2455
328 Ga0495667_0027587 3300046559 Bacteria 3825
329 Ga0495634_0005562 3300046642 Bacteria 9670
330 Ga0495625_0094104 3300046660 Bacteria 2068
331 Ga0495635_0315090 3300046663 Bacteria 1047
332 Ga0495588_0023299 3300046674 Bacteria 3065
333 Ga0495599_0002399 3300046678 Bacteria 10897
334 Ga0495623_0008104 3300046679 Bacteria 6831
335 Ga0495646_0308155 3300046680 Bacteria 836
336 Ga0495647_0001167 3300046681 Bacteria 8076
337 Ga0495658_0004579 3300046683 Bacteria 6804
338 Ga0495658_0023702 3300046683 Bacteria 3261
339 Ga0495669_0007483 3300046684 Bacteria 4580
340 Ga0495613_0002922 3300046689 Bacteria 12811
341 Ga0495624_0013677 3300046690 Bacteria 5526
342 Ga0495671_0007619 3300046692 Bacteria 6152
343 Ga0495589_0000010 3300046794 Bacteria 250407
344 Ga0495604_0002023 3300047317 Bacteria 16355
345 Ga0495604_0149970 3300047317 Bacteria 1658
346 Ga0495636_0008379 3300047318 Bacteria 4081
347 Ga0495676_0040690 3300047321 Bacteria 3833
348 Ga0495680_0001124 3300047322 Bacteria 29512
349 Ga0495687_118020 3300047443 Bacteria 962
350 Ga0495675_0032298 3300047444 Bacteria 3340
351 Ga0495684_0002525 3300047471 Bacteria 14591
352 Ga0495602_0017644 3300048088 Bacteria 7151
353 Ga0496100_0145498 3300048903 Bacteria 1685
354 Ga0496101_0000053 3300048904 Bacteria 139859
355 Ga0496102_0028701 3300048905 Bacteria 4972
356 Ga0496109_0284617 3300048912 Bacteria 1558
357 Ga0496109_0766254 3300048912 Bacteria 903
358 Ga0496110_0667090 3300048913 Bacteria 940
359 Ga0496114_0003855 3300048917 Bacteria 11564
360 Ga0496116_0000077 3300048919 Bacteria 227959
361 Ga0496117_0002611 3300048920 Bacteria 22395
362 Ga0496117_0254179 3300048920 Bacteria 956
363 Ga0496118_0008371 3300048921 Bacteria 10697
364 Ga0496118_0055479 3300048921 Bacteria 2990
365 Ga0496119_0001653 3300048922 Bacteria 26225
366 Ga0496119_0010401 3300048922 Bacteria 7838
367 Ga0496119_0395429 3300048922 Bacteria 660
368 Ga0496120_0000139 3300048923 Bacteria 120489
369 Ga0496120_0001587 3300048923 Bacteria 26441
370 Ga0496121_0027154 3300048924 Bacteria 5365
371 Ga0496122_0007780 3300048925 Bacteria 11787
372 Ga0496122_0058846 3300048925 Bacteria 2841
373 Ga0496123_0003349 3300048926 Bacteria 18135
374 Ga0496123_0064399 3300048926 Bacteria 2336
375 Ga0496124_0000100 3300048927 Bacteria 181404
376 Ga0496124_0019885 3300048927 Bacteria 6228
377 Ga0496126_0002981 3300048929 Bacteria 21979
378 Ga0501309_018677 3300049129 Unclassified 959
379 Ga0501305_025098 3300049161 Unclassified 902
380 Ga0501290_000646 3300049513 Bacteria 5225
381 Ga0501300_010037 3300049523 Bacteria 1381
382 Ga0501313_016454 3300049529 Unclassified 888
383 Ga0501315_006877 3300049531 Bacteria 1281
384 Ga0501032_0321361 3300049569 Bacteria 999
385 Ga0501034_0000122 3300049571 Bacteria 144085
386 Ga0501034_0057798 3300049571 Bacteria 3899
387 Ga0501034_0252256 3300049571 Bacteria 1709
388 Ga0501036_0185158 3300049572 Bacteria 1752
389 Ga0501037_0029800 3300049573 Bacteria 4032
390 Ga0501038_0228590 3300049574 Bacteria 1481
391 Ga0501039_0006328 3300049575 Bacteria 8989
392 Ga0501041_0008810 3300049577 Bacteria 5939
393 Ga0501041_0040479 3300049577 Bacteria 2828
394 Ga0501043_0000038 3300049579 Bacteria 128656
395 Ga0501043_0107972 3300049579 Bacteria 2186
396 Ga0501043_0138387 3300049579 Bacteria 1907
397 Ga0501046_0000049 3300049580 Bacteria 135088
398 Ga0501047_0000039 3300049581 Bacteria 187849
399 Ga0501047_0701068 3300049581 Bacteria 830
400 Ga0501048_0002594 3300049582 Bacteria 13846
401 Ga0501048_0145106 3300049582 Bacteria 1679
402 Ga0501068_0042549 3300049584 Bacteria 2732
403 Ga0501071_0082446 3300049587 Bacteria 2355
404 Ga0501072_0029736 3300049588 Bacteria 4269
405 Ga0501072_0038048 3300049588 Bacteria 3776
406 Ga0501075_0006548 3300049591 Bacteria 8023
407 Ga0501076_0002770 3300049592 Bacteria 12132
408 Ga0501076_0070188 3300049592 Bacteria 2801
409 Ga0501076_0177336 3300049592 Bacteria 1737
410 Ga0501077_0030345 3300049593 Bacteria 3440
411 Ga0501225_0011654 3300049705 Bacteria 2473
412 Ga0501079_0000379 3300049741 Bacteria 28580
413 Ga0501079_0162032 3300049741 Bacteria 1744
414 Ga0501080_0027036 3300049742 Bacteria 5335
415 Ga0501081_0000033 3300049743 Bacteria 51492
416 Ga0501265_005136 3300049762 Bacteria 1504
417 Ga0501270_032590 3300049767 Bacteria 868
418 Ga0501274_013342 3300049771 Bacteria 788
419 Ga0501275_002650 3300049772 Bacteria 1644
420 Ga0501035_0046012 3300049822 Bacteria 3925
421 Ga0501044_0120444 3300049823 Bacteria 2626
422 Ga0501045_0008121 3300049824 Bacteria 7311
423 Ga0501045_0098628 3300049824 Bacteria 2162
424 Ga0501045_0232574 3300049824 Bacteria 1372
425 Ga0501045_0262476 3300049824 Bacteria 1286
426 nmdc:mga00v17_55345_c1 3300050491 Bacteria 2423
427 nmdc:mga00v17_770_c1 3300050491 Bacteria 17418
428 nmdc:mga0yw44_22891_c1 3300050492 Bacteria 3511
429 nmdc:mga0k408_109930_c1 3300050493 Bacteria 1629
430 nmdc:mga0k408_175428_c1 3300050493 Bacteria 1278
431 nmdc:mga0k408_7176_c1 3300050493 Bacteria 5955
432 nmdc:mga05p37_1373_c1 3300050507 Bacteria 28308
433 nmdc:mga05p37_246269_c1 3300050507 Bacteria 2146
434 nmdc:mga09592_369_c1 3300050508 Bacteria 32912
435 nmdc:mga0qj67_329177_c1 3300050509 Bacteria 1236
436 nmdc:mga0qj67_78908_c1 3300050509 Bacteria 2636
437 nmdc:mga06r32_151794_c1 3300050510 Bacteria 2295
438 nmdc:mga06r32_454698_c1 3300050510 Bacteria 1260
439 nmdc:mga08y16_2408_c2 3300050511 Bacteria 8891
440 nmdc:mga08y16_3865_c1 3300050511 Bacteria 15580
441 nmdc:mga08y16_426710_c1 3300050511 Bacteria 1354
442 nmdc:mga08y16_88231_c1 3300050511 Bacteria 3232
443 nmdc:mga0n895_10479_c1 3300050512 Bacteria 8194
444 nmdc:mga0n895_272_c1 3300050512 Bacteria 33829
445 nmdc:mga0rr50_11608_c1 3300050513 Bacteria 5651
446 nmdc:mga0rr50_65_c1 3300050513 Bacteria 62915
447 nmdc:mga0rr50_730685_c1 3300050513 Bacteria 845
448 nmdc:mga08x19_10704_c2 3300050514 Bacteria 3490
449 nmdc:mga08x19_1118_c1 3300050514 Bacteria 16743
450 nmdc:mga08x19_1138_c1 3300050514 Bacteria 16598
451 nmdc:mga08x19_18797_c1 3300050514 Bacteria 4236
452 nmdc:mga08x19_8586_c1 3300050514 Bacteria 6088
453 nmdc:mga0a205_212894_c1 3300050515 Bacteria 1820
454 nmdc:mga0a205_38_c1 3300050515 Bacteria 73135
455 nmdc:mga0a205_72306_c1 3300050515 Bacteria 3332
456 nmdc:mga0a205_7368_c2 3300050515 Bacteria 5481
457 nmdc:mga0sz30_102402_c1 3300050516 Bacteria 1251
458 Ga0500646_0000390 3300053090 Bacteria 13179
459 Ga0500650_0074422 3300053098 Bacteria 1588
460 Ga0500593_000086 3300053117 Bacteria 33745
461 Ga0500652_000940 3300053131 Bacteria 9635
462 Ga0500604_0017031 3300053151 Bacteria 2006
463 Ga0500619_000159 3300053154 Bacteria 16357
464 Ga0501084_0117761 3300054114 Bacteria 2233
465 Ga0501082_0001333 3300060353 Bacteria 21634
466 Ga0501082_0548646 3300060353 Bacteria 1011
467 Ga0466962_0084418 3300061719 Bacteria 1519
468 Ga0530510_0762317 3300061734 Bacteria 738

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0710941 Ga0373933_0710941_40_636 197
2 3300047317 Ga0495604_0149970 Ga0495604_0149970_38_634 197
3 3300048922 Ga0496119_0395429 Ga0496119_0395429_20_613 197
4 iso_pu_bacteria 2506520007 2506580851 227
5 iso_pu_bacteria 2506520008 2506585990 227
6 iso_pu_bacteria 2508501071 2508854658 227
7 iso_pu_bacteria 2654587920 2656276691 227
8 iso_pu_bacteria 2687453601 2689447407 227
9 iso_pu_bacteria 2806310673 2807180284 227
10 iso_pu_bacteria 2808606414 2809126712 227
11 iso_pu_bacteria 2852103415 2852106794 227
12 iso_pu_bacteria 2876601092 2876602550 227
13 iso_pu_bacteria 2888366609 2888371339 227
14 iso_pu_bacteria 2904504865 2904508255 227
15 iso_pu_bacteria 2932406140 2932409350 227
16 iso_pu_bacteria 2939577877 2939581145 227
17 iso_pu_bacteria 640753048 640940219 227
18 iso_pu_bacteria 8004592986 8004593995 227
19 iso_pu_bacteria 8015394850 8015395174 227
20 iso_pu_bacteria 8016733728 8016737605 227
21 iso_pu_bacteria 8019499862 8019504231 227
22 3300003320 rootH2_10005386 rootH2_100053866 228
23 iso_pu_bacteria 2889415604 2889418479 228
24 3300005338 Ga0068868_100211494 Ga0068868_1002114942 230
25 3300005340 Ga0070689_100205843 Ga0070689_1002058432 230
26 3300005340 Ga0070689_100737482 Ga0070689_1007374821 230
27 3300005354 Ga0070675_100017058 Ga0070675_1000170585 230
28 3300005364 Ga0070673_100494504 Ga0070673_1004945042 230
29 3300005365 Ga0070688_100206852 Ga0070688_1002068522 230
30 3300005438 Ga0070701_10305403 Ga0070701_103054032 230
31 3300005441 Ga0070700_100014470 Ga0070700_1000144704 230
32 3300005459 Ga0068867_100248830 Ga0068867_1002488302 230
33 3300005615 Ga0070702_100038397 Ga0070702_1000383972 230
34 3300005617 Ga0068859_101092046 Ga0068859_1010920461 230
35 3300005719 Ga0068861_100192116 Ga0068861_1001921162 230
36 3300005844 Ga0068862_100266416 Ga0068862_1002664162 230
37 3300006852 Ga0075433_10500195 Ga0075433_105001952 230
38 3300006871 Ga0075434_100011032 Ga0075434_1000110322 230
39 3300006931 Ga0097620_101092051 Ga0097620_1010920511 230
40 3300007076 Ga0075435_100132387 Ga0075435_1001323871 230
41 3300009094 Ga0111539_10029811 Ga0111539_100298112 230
42 3300009094 Ga0111539_10226420 Ga0111539_102264202 230
43 3300025907 Ga0207645_10026933 Ga0207645_100269332 230
44 3300025926 Ga0207659_10072424 Ga0207659_100724242 230
45 3300025936 Ga0207670_10303116 Ga0207670_103031162 230
46 3300025936 Ga0207670_10444049 Ga0207670_104440492 230
47 3300025942 Ga0207689_10044295 Ga0207689_100442954 230
48 3300026075 Ga0207708_10427962 Ga0207708_104279622 230
49 3300026118 Ga0207675_100192107 Ga0207675_1001921072 230
50 3300026121 Ga0207683_10115027 Ga0207683_101150274 230
51 3300027360 Ga0209969_1003492 Ga0209969_10034923 230
52 3300027462 Ga0210000_1010958 Ga0210000_10109582 230
53 3300027543 Ga0209999_1004623 Ga0209999_10046234 230
54 3300027907 Ga0207428_10209995 Ga0207428_102099952 230
55 3300035410 Ga0373924_0078428 Ga0373924_0078428_472_1164 230
56 3300035691 Ga0373931_0219763 Ga0373931_0219763_408_1100 230
57 3300042125 Ga0450923_019625 Ga0450923_019625_454_1146 230
58 3300044683 Ga0466965_0128606 Ga0466965_0128606_118_810 230
59 3300045051 Ga0451576_0422758 Ga0451576_0422758_543_1235 230
60 3300046454 Ga0495592_0001600 Ga0495592_0001600_788_1480 230
61 3300046473 Ga0495582_0135587 Ga0495582_0135587_35_727 230
62 3300046476 Ga0495662_0005281 Ga0495662_0005281_5734_6426 230
63 3300046511 Ga0495608_0000167 Ga0495608_0000167_29581_30273 230
64 3300046516 Ga0495628_0003674 Ga0495628_0003674_12680_13372 230
65 3300046517 Ga0495630_0001186 Ga0495630_0001186_14748_15440 230
66 3300046533 Ga0495640_0000309 Ga0495640_0000309_14623_15315 230
67 3300046535 Ga0495586_0000827 Ga0495586_0000827_2852_3544 230
68 3300046536 Ga0495587_0050723 Ga0495587_0050723_736_1428 230
69 3300046559 Ga0495667_0027587 Ga0495667_0027587_1852_2544 230
70 3300046642 Ga0495634_0005562 Ga0495634_0005562_2258_2950 230
71 3300046663 Ga0495635_0315090 Ga0495635_0315090_210_902 230
72 3300046678 Ga0495599_0002399 Ga0495599_0002399_9894_10586 230
73 3300046680 Ga0495646_0308155 Ga0495646_0308155_90_782 230
74 3300046683 Ga0495658_0004579 Ga0495658_0004579_3162_3854 230
75 3300046689 Ga0495613_0002922 Ga0495613_0002922_636_1328 230
76 3300046690 Ga0495624_0013677 Ga0495624_0013677_1067_1759 230
77 3300047317 Ga0495604_0002023 Ga0495604_0002023_3176_3868 230
78 3300047322 Ga0495680_0001124 Ga0495680_0001124_18339_19031 230
79 3300049577 Ga0501041_0008810 Ga0501041_0008810_3907_4599 230
80 3300049582 Ga0501048_0145106 Ga0501048_0145106_487_1179 230
81 3300049592 Ga0501076_0070188 Ga0501076_0070188_597_1289 230
82 3300049741 Ga0501079_0162032 Ga0501079_0162032_33_725 230
83 3300050511 nmdc:mga08y16_426710_c1 nmdc:mga08y16_426710_c1_252_944 230
84 3300050511 nmdc:mga08y16_88231_c1 nmdc:mga08y16_88231_c1_1820_2512 230
85 3300050512 nmdc:mga0n895_10479_c1 nmdc:mga0n895_10479_c1_2280_2972 230
86 3300050515 nmdc:mga0a205_212894_c1 nmdc:mga0a205_212894_c1_463_1155 230
87 3300060353 Ga0501082_0548646 Ga0501082_0548646_243_935 230
88 iso_pu_bacteria 8002869464 8002872584 230
89 3300001989 JGI24739J22299_10000107 JGI24739J22299_100001076 231
90 3300002737 JGI25162J39368_1000007 JGI25162J39368_1000007238 231
91 3300005272 Ga0065703_1020638 Ga0065703_10206382 231
92 3300005345 Ga0070692_10025021 Ga0070692_100250213 231
93 3300005435 Ga0070714_100001772 Ga0070714_1000017724 231
94 3300005435 Ga0070714_100015965 Ga0070714_1000159652 231
95 3300005440 Ga0070705_100054401 Ga0070705_1000544013 231
96 3300005444 Ga0070694_100023136 Ga0070694_1000231362 231
97 3300005545 Ga0070695_100259892 Ga0070695_1002598922 231
98 3300005549 Ga0070704_100081562 Ga0070704_1000815622 231
99 3300005718 Ga0068866_10376516 Ga0068866_103765161 231
100 3300006051 Ga0075364_10101648 Ga0075364_101016481 231
101 3300006844 Ga0075428_100223646 Ga0075428_1002236462 231
102 3300006852 Ga0075433_10019821 Ga0075433_100198212 231
103 3300006914 Ga0075436_100017307 Ga0075436_1000173075 231
104 3300006946 Ga0079104_1002497 Ga0079104_10024972 231
105 3300009011 Ga0105251_10000230 Ga0105251_100002306 231
106 3300009011 Ga0105251_10000233 Ga0105251_1000023312 231
107 3300009011 Ga0105251_10010612 Ga0105251_100106125 231
108 3300009011 Ga0105251_10016472 Ga0105251_100164723 231
109 3300009036 Ga0105244_10001361 Ga0105244_100013613 231
110 3300009092 Ga0105250_10000020 Ga0105250_1000002055 231
111 3300009092 Ga0105250_10008877 Ga0105250_100088774 231
112 3300009101 Ga0105247_10000396 Ga0105247_100003962 231
113 3300009174 Ga0105241_10000013 Ga0105241_1000001360 231
114 3300011119 Ga0105246_10019180 Ga0105246_100191802 231
115 3300013100 Ga0157373_10000081 Ga0157373_1000008161 231
116 3300013100 Ga0157373_10004744 Ga0157373_100047448 231
117 3300013102 Ga0157371_10003054 Ga0157371_1000305410 231
118 3300013306 Ga0163162_10084587 Ga0163162_100845872 231
119 3300014497 Ga0182008_10008294 Ga0182008_100082944 231
120 3300015261 Ga0182006_1042856 Ga0182006_10428563 231
121 3300017792 Ga0163161_10000028 Ga0163161_1000002889 231
122 3300025711 Ga0207696_1000036 Ga0207696_1000036101 231
123 3300025711 Ga0207696_1000068 Ga0207696_1000068111 231
124 3300025711 Ga0207696_1000557 Ga0207696_10005578 231
125 3300025728 Ga0207655_1000106 Ga0207655_100010657 231
126 3300025728 Ga0207655_1030501 Ga0207655_10305011 231
127 3300025735 Ga0207713_1000044 Ga0207713_1000044128 231
128 3300025735 Ga0207713_1000062 Ga0207713_100006290 231
129 3300025735 Ga0207713_1006491 Ga0207713_10064917 231
130 3300025735 Ga0207713_1007196 Ga0207713_10071965 231
131 3300025900 Ga0207710_10000145 Ga0207710_1000014579 231
132 3300025911 Ga0207654_10000016 Ga0207654_1000001691 231
133 3300025928 Ga0207700_10261199 Ga0207700_102611993 231
134 3300025929 Ga0207664_10007528 Ga0207664_100075289 231
135 3300025929 Ga0207664_10907730 Ga0207664_109077301 231
136 3300026142 Ga0207698_10111234 Ga0207698_101112344 231
137 3300027111 Ga0209281_1000107 Ga0209281_100010791 231
138 3300028558 Ga0265326_10031321 Ga0265326_100313213 231
139 3300028573 Ga0265334_10000017 Ga0265334_1000001724 231
140 3300028800 Ga0265338_10026656 Ga0265338_100266566 231
141 3300031595 Ga0265313_10000022 Ga0265313_1000002250 231
142 3300031595 Ga0265313_10077584 Ga0265313_100775842 231
143 3300032002 Ga0307416_100225071 Ga0307416_1002250713 231
144 3300034816 Ga0373930_0070381 Ga0373930_0070381_90_785 231
145 3300035112 Ga0373932_0054421 Ga0373932_0054421_431_1126 231
146 3300035115 Ga0373941_0151685 Ga0373941_0151685_68_763 231
147 3300035691 Ga0373931_0215207 Ga0373931_0215207_331_1026 231
148 3300041411 Ga0439466_0019916 Ga0439466_0019916_33_728 231
149 3300041486 Ga0451807_2384151 Ga0451807_2384151_123_818 231
150 3300042876 Ga0451577_0531029 Ga0451577_0531029_148_843 231
151 3300046453 Ga0495627_000100 Ga0495627_000100_158_853 231
152 3300046517 Ga0495630_0093027 Ga0495630_0093027_1107_1802 231
153 3300046530 Ga0495654_0000616 Ga0495654_0000616_5912_6607 231
154 3300046679 Ga0495623_0008104 Ga0495623_0008104_723_1421 231
155 3300046684 Ga0495669_0007483 Ga0495669_0007483_633_1328 231
156 3300046794 Ga0495589_0000010 Ga0495589_0000010_134711_135406 231
157 3300047444 Ga0495675_0032298 Ga0495675_0032298_575_1273 231
158 3300047471 Ga0495684_0002525 Ga0495684_0002525_6832_7530 231
159 3300048088 Ga0495602_0017644 Ga0495602_0017644_624_1322 231
160 3300048903 Ga0496100_0145498 Ga0496100_0145498_192_887 231
161 3300048904 Ga0496101_0000053 Ga0496101_0000053_79150_79845 231
162 3300048912 Ga0496109_0766254 Ga0496109_0766254_166_861 231
163 3300048919 Ga0496116_0000077 Ga0496116_0000077_120127_120822 231
164 3300048920 Ga0496117_0002611 Ga0496117_0002611_11602_12297 231
165 3300048920 Ga0496117_0254179 Ga0496117_0254179_53_748 231
166 3300048921 Ga0496118_0008371 Ga0496118_0008371_4566_5261 231
167 3300048921 Ga0496118_0055479 Ga0496118_0055479_1670_2365 231
168 3300048922 Ga0496119_0001653 Ga0496119_0001653_11586_12281 231
169 3300048922 Ga0496119_0010401 Ga0496119_0010401_2567_3262 231
170 3300048923 Ga0496120_0000139 Ga0496120_0000139_69934_70629 231
171 3300048923 Ga0496120_0001587 Ga0496120_0001587_15325_16020 231
172 3300048925 Ga0496122_0007780 Ga0496122_0007780_6870_7565 231
173 3300048926 Ga0496123_0003349 Ga0496123_0003349_12475_13170 231
174 3300048927 Ga0496124_0000100 Ga0496124_0000100_106422_107117 231
175 3300048927 Ga0496124_0019885 Ga0496124_0019885_1567_2262 231
176 3300049824 Ga0501045_0098628 Ga0501045_0098628_1172_1867 231
177 3300050491 nmdc:mga00v17_55345_c1 nmdc:mga00v17_55345_c1_746_1441 231
178 3300050510 nmdc:mga06r32_454698_c1 nmdc:mga06r32_454698_c1_510_1205 231
179 3300050513 nmdc:mga0rr50_11608_c1 nmdc:mga0rr50_11608_c1_1762_2457 231
180 3300050514 nmdc:mga08x19_10704_c2 nmdc:mga08x19_10704_c2_2542_3237 231
181 3300050515 nmdc:mga0a205_7368_c2 nmdc:mga0a205_7368_c2_3479_4174 231
182 iso_pu_bacteria 2643221579 2643908690 231
183 iso_pu_bacteria 2643221581 2643916120 231
184 iso_pu_bacteria 2643221695 2644528932 231
185 iso_pu_bacteria 2895498888 2895501941 231
186 iso_pu_bacteria 2895511927 2895517107 231
187 iso_pu_bacteria 2895522137 2895524645 231
188 iso_pu_bacteria 2895525241 2895526241 231
189 iso_pu_bacteria 2923516293 2923517907 231
190 3300005338 Ga0068868_100377429 Ga0068868_1003774292 232
191 3300005343 Ga0070687_100290753 Ga0070687_1002907531 232
192 3300005353 Ga0070669_100458231 Ga0070669_1004582311 232
193 3300005355 Ga0070671_100253818 Ga0070671_1002538183 232
194 3300005364 Ga0070673_100181525 Ga0070673_1001815252 232
195 3300005467 Ga0070706_100114912 Ga0070706_1001149122 232
196 3300005468 Ga0070707_100123106 Ga0070707_1001231063 232
197 3300005471 Ga0070698_100123876 Ga0070698_1001238762 232
198 3300005518 Ga0070699_100188003 Ga0070699_1001880032 232
199 3300005536 Ga0070697_100126708 Ga0070697_1001267082 232
200 3300005548 Ga0070665_100299227 Ga0070665_1002992273 232
201 3300005549 Ga0070704_100666488 Ga0070704_1006664881 232
202 3300005841 Ga0068863_100669760 Ga0068863_1006697601 232
203 3300005985 Ga0081539_10000496 Ga0081539_1000049648 232
204 3300006186 Ga0075369_10013066 Ga0075369_100130662 232
205 3300006195 Ga0075366_10101187 Ga0075366_101011871 232
206 3300006844 Ga0075428_100008331 Ga0075428_1000083317 232
207 3300006847 Ga0075431_100153423 Ga0075431_1001534231 232
208 3300006852 Ga0075433_10034636 Ga0075433_100346364 232
209 3300006871 Ga0075434_100131120 Ga0075434_1001311202 232
210 3300006914 Ga0075436_100000593 Ga0075436_10000059322 232
211 3300006914 Ga0075436_100006924 Ga0075436_1000069246 232
212 3300006914 Ga0075436_100016824 Ga0075436_1000168245 232
213 3300006914 Ga0075436_100212591 Ga0075436_1002125912 232
214 3300007076 Ga0075435_100073601 Ga0075435_1000736011 232
215 3300007076 Ga0075435_100573956 Ga0075435_1005739562 232
216 3300007265 Ga0099794_10016077 Ga0099794_100160774 232
217 3300009094 Ga0111539_10009312 Ga0111539_100093129 232
218 3300009176 Ga0105242_10014042 Ga0105242_100140424 232
219 3300011119 Ga0105246_10225459 Ga0105246_102254591 232
220 3300013296 Ga0157374_10672242 Ga0157374_106722421 232
221 3300013297 Ga0157378_10085314 Ga0157378_100853144 232
222 3300014969 Ga0157376_10425113 Ga0157376_104251132 232
223 3300025912 Ga0207707_10084896 Ga0207707_100848963 232
224 3300025912 Ga0207707_10501529 Ga0207707_105015292 232
225 3300025922 Ga0207646_10453780 Ga0207646_104537802 232
226 3300025960 Ga0207651_10232355 Ga0207651_102323551 232
227 3300026023 Ga0207677_10201775 Ga0207677_102017751 232
228 3300026121 Ga0207683_10162721 Ga0207683_101627212 232
229 3300026142 Ga0207698_10382077 Ga0207698_103820771 232
230 3300027907 Ga0207428_10034099 Ga0207428_100340992 232
231 3300030521 Ga0307511_10000108 Ga0307511_1000010855 232
232 3300031852 Ga0307410_10472055 Ga0307410_104720551 232
233 3300032002 Ga0307416_100022451 Ga0307416_1000224514 232
234 3300032002 Ga0307416_100068295 Ga0307416_1000682952 232
235 3300033179 Ga0307507_10025756 Ga0307507_100257564 232
236 3300035086 Ga0373934_0051832 Ga0373934_0051832_910_1608 232
237 3300035398 Ga0316574_0240123 Ga0316574_0240123_226_924 232
238 3300035691 Ga0373931_0089954 Ga0373931_0089954_195_893 232
239 3300042876 Ga0451577_0229986 Ga0451577_0229986_529_1227 232
240 3300045051 Ga0451576_0011469 Ga0451576_0011469_574_1272 232
241 3300046471 Ga0495650_0082873 Ga0495650_0082873_407_1105 232
242 3300046515 Ga0495620_0166566 Ga0495620_0166566_67_765 232
243 3300047443 Ga0495687_118020 Ga0495687_118020_240_938 232
244 3300048912 Ga0496109_0284617 Ga0496109_0284617_124_822 232
245 3300048913 Ga0496110_0667090 Ga0496110_0667090_174_872 232
246 3300048924 Ga0496121_0027154 Ga0496121_0027154_683_1381 232
247 3300049569 Ga0501032_0321361 Ga0501032_0321361_257_955 232
248 3300049571 Ga0501034_0057798 Ga0501034_0057798_58_756 232
249 3300049571 Ga0501034_0252256 Ga0501034_0252256_894_1592 232
250 3300049572 Ga0501036_0185158 Ga0501036_0185158_665_1363 232
251 3300049573 Ga0501037_0029800 Ga0501037_0029800_2550_3248 232
252 3300049574 Ga0501038_0228590 Ga0501038_0228590_16_714 232
253 3300049575 Ga0501039_0006328 Ga0501039_0006328_3435_4133 232
254 3300049577 Ga0501041_0040479 Ga0501041_0040479_1648_2346 232
255 3300049579 Ga0501043_0000038 Ga0501043_0000038_12701_13399 232
256 3300049579 Ga0501043_0107972 Ga0501043_0107972_703_1401 232
257 3300049579 Ga0501043_0138387 Ga0501043_0138387_127_825 232
258 3300049580 Ga0501046_0000049 Ga0501046_0000049_115281_115979 232
259 3300049581 Ga0501047_0000039 Ga0501047_0000039_71894_72592 232
260 3300049581 Ga0501047_0701068 Ga0501047_0701068_111_809 232
261 3300049582 Ga0501048_0002594 Ga0501048_0002594_5892_6590 232
262 3300049584 Ga0501068_0042549 Ga0501068_0042549_75_773 232
263 3300049587 Ga0501071_0082446 Ga0501071_0082446_1049_1747 232
264 3300049588 Ga0501072_0029736 Ga0501072_0029736_1420_2118 232
265 3300049588 Ga0501072_0038048 Ga0501072_0038048_2832_3530 232
266 3300049591 Ga0501075_0006548 Ga0501075_0006548_4365_5063 232
267 3300049592 Ga0501076_0002770 Ga0501076_0002770_8874_9572 232
268 3300049593 Ga0501077_0030345 Ga0501077_0030345_1291_1989 232
269 3300049741 Ga0501079_0000379 Ga0501079_0000379_12220_12918 232
270 3300049742 Ga0501080_0027036 Ga0501080_0027036_399_1097 232
271 3300049743 Ga0501081_0000033 Ga0501081_0000033_18812_19510 232
272 3300049822 Ga0501035_0046012 Ga0501035_0046012_2706_3404 232
273 3300049823 Ga0501044_0120444 Ga0501044_0120444_867_1565 232
274 3300049824 Ga0501045_0008121 Ga0501045_0008121_2767_3465 232
275 3300049824 Ga0501045_0262476 Ga0501045_0262476_478_1176 232
276 3300050493 nmdc:mga0k408_175428_c1 nmdc:mga0k408_175428_c1_69_767 232
277 3300050510 nmdc:mga06r32_151794_c1 nmdc:mga06r32_151794_c1_944_1642 232
278 3300050514 nmdc:mga08x19_1118_c1 nmdc:mga08x19_1118_c1_5999_6697 232
279 3300050514 nmdc:mga08x19_8586_c1 nmdc:mga08x19_8586_c1_4759_5457 232
280 3300050515 nmdc:mga0a205_72306_c1 nmdc:mga0a205_72306_c1_60_758 232
281 3300053090 Ga0500646_0000390 Ga0500646_0000390_3167_3865 232
282 3300053098 Ga0500650_0074422 Ga0500650_0074422_728_1426 232
283 3300053151 Ga0500604_0017031 Ga0500604_0017031_599_1297 232
284 3300054114 Ga0501084_0117761 Ga0501084_0117761_474_1172 232
285 3300060353 Ga0501082_0001333 Ga0501082_0001333_3737_4435 232
286 3300061734 Ga0530510_0762317 Ga0530510_0762317_29_727 232
287 3300005340 Ga0070689_100186592 Ga0070689_1001865923 233
288 3300005439 Ga0070711_100458889 Ga0070711_1004588891 233
289 3300005444 Ga0070694_100150111 Ga0070694_1001501112 233
290 3300005455 Ga0070663_100046329 Ga0070663_1000463292 233
291 3300005457 Ga0070662_100008279 Ga0070662_1000082794 233
292 3300005530 Ga0070679_100972066 Ga0070679_1009720661 233
293 3300005545 Ga0070695_100011088 Ga0070695_1000110882 233
294 3300005618 Ga0068864_100018648 Ga0068864_1000186485 233
295 3300005719 Ga0068861_100139227 Ga0068861_1001392273 233
296 3300005843 Ga0068860_100212677 Ga0068860_1002126772 233
297 3300005844 Ga0068862_100014628 Ga0068862_1000146284 233
298 3300006038 Ga0075365_10009131 Ga0075365_100091313 233
299 3300006195 Ga0075366_10004427 Ga0075366_100044273 233
300 3300006195 Ga0075366_10066176 Ga0075366_100661763 233
301 3300006844 Ga0075428_100000107 Ga0075428_10000010732 233
302 3300006846 Ga0075430_100069573 Ga0075430_1000695733 233
303 3300006846 Ga0075430_100101971 Ga0075430_1001019712 233
304 3300006852 Ga0075433_10002934 Ga0075433_100029347 233
305 3300006871 Ga0075434_100001090 Ga0075434_10000109016 233
306 3300006880 Ga0075429_100000317 Ga0075429_10000031732 233
307 3300006880 Ga0075429_100002952 Ga0075429_1000029528 233
308 3300006914 Ga0075436_100001604 Ga0075436_10000160417 233
309 3300006914 Ga0075436_100040125 Ga0075436_1000401254 233
310 3300007076 Ga0075435_100000229 Ga0075435_10000022916 233
311 3300009094 Ga0111539_10005775 Ga0111539_1000577516 233
312 3300009094 Ga0111539_10018067 Ga0111539_100180678 233
313 3300009147 Ga0114129_10001717 Ga0114129_1000171716 233
314 3300009148 Ga0105243_10235286 Ga0105243_102352862 233
315 3300025905 Ga0207685_10059237 Ga0207685_100592372 233
316 3300025916 Ga0207663_10416295 Ga0207663_104162952 233
317 3300025917 Ga0207660_10374426 Ga0207660_103744262 233
318 3300025935 Ga0207709_10093129 Ga0207709_100931292 233
319 3300025961 Ga0207712_10360919 Ga0207712_103609192 233
320 3300026067 Ga0207678_10034038 Ga0207678_100340382 233
321 3300026078 Ga0207702_10076220 Ga0207702_100762203 233
322 3300026088 Ga0207641_10163450 Ga0207641_101634503 233
323 3300026095 Ga0207676_10030973 Ga0207676_100309732 233
324 3300026118 Ga0207675_100158730 Ga0207675_1001587302 233
325 3300027671 Ga0209588_1049292 Ga0209588_10492922 233
326 3300027907 Ga0207428_10000179 Ga0207428_1000017972 233
327 3300027907 Ga0207428_10020477 Ga0207428_100204773 233
328 3300028381 Ga0268264_10156428 Ga0268264_101564282 233
329 3300031730 Ga0307516_10311996 Ga0307516_103119961 233
330 3300031852 Ga0307410_10530965 Ga0307410_105309651 233
331 3300031995 Ga0307409_100263865 Ga0307409_1002638652 233
332 3300035083 Ga0373926_0008847 Ga0373926_0008847_2107_2808 233
333 3300035113 Ga0373936_0024942 Ga0373936_0024942_641_1342 233
334 3300035116 Ga0373945_0005768 Ga0373945_0005768_611_1312 233
335 3300035170 Ga0373943_0062728 Ga0373943_0062728_211_912 233
336 3300035171 Ga0373946_0036820 Ga0373946_0036820_1139_1840 233
337 3300035692 Ga0373935_0036322 Ga0373935_0036322_1609_2310 233
338 3300035695 Ga0373927_0009707 Ga0373927_0009707_3949_4650 233
339 3300035725 Ga0373947_0075888 Ga0373947_0075888_1217_1918 233
340 3300037068 Ga0373925_0015285 Ga0373925_0015285_898_1599 233
341 3300039447 Ga0436361_1102119 Ga0436361_1102119_705_1406 233
342 3300042133 Ga0450896_020740 Ga0450896_020740_108_809 233
343 3300042876 Ga0451577_0015419 Ga0451577_0015419_2049_2750 233
344 3300045051 Ga0451576_0003504 Ga0451576_0003504_11329_12030 233
345 3300046455 Ga0495603_0117204 Ga0495603_0117204_410_1111 233
346 3300046472 Ga0495580_0000780 Ga0495580_0000780_9051_9752 233
347 3300046473 Ga0495582_0018378 Ga0495582_0018378_2290_2991 233
348 3300046526 Ga0495666_0038565 Ga0495666_0038565_182_883 233
349 3300046535 Ga0495586_0004233 Ga0495586_0004233_1198_1899 233
350 3300046674 Ga0495588_0023299 Ga0495588_0023299_2222_2923 233
351 3300046681 Ga0495647_0001167 Ga0495647_0001167_1943_2644 233
352 3300046683 Ga0495658_0023702 Ga0495658_0023702_966_1667 233
353 3300047318 Ga0495636_0008379 Ga0495636_0008379_2560_3261 233
354 3300047321 Ga0495676_0040690 Ga0495676_0040690_2441_3142 233
355 3300048905 Ga0496102_0028701 Ga0496102_0028701_382_1083 233
356 3300049129 Ga0501309_018677 Ga0501309_018677_185_886 233
357 3300049161 Ga0501305_025098 Ga0501305_025098_102_803 233
358 3300049529 Ga0501313_016454 Ga0501313_016454_101_802 233
359 3300049592 Ga0501076_0177336 Ga0501076_0177336_347_1048 233
360 3300049824 Ga0501045_0232574 Ga0501045_0232574_639_1340 233
361 3300050492 nmdc:mga0yw44_22891_c1 nmdc:mga0yw44_22891_c1_446_1147 233
362 3300050493 nmdc:mga0k408_7176_c1 nmdc:mga0k408_7176_c1_2412_3113 233
363 3300050507 nmdc:mga05p37_1373_c1 nmdc:mga05p37_1373_c1_26811_27512 233
364 3300050508 nmdc:mga09592_369_c1 nmdc:mga09592_369_c1_5669_6370 233
365 3300050509 nmdc:mga0qj67_78908_c1 nmdc:mga0qj67_78908_c1_748_1449 233
366 3300050511 nmdc:mga08y16_2408_c2 nmdc:mga08y16_2408_c2_7225_7926 233
367 3300050511 nmdc:mga08y16_3865_c1 nmdc:mga08y16_3865_c1_5737_6438 233
368 3300050512 nmdc:mga0n895_272_c1 nmdc:mga0n895_272_c1_23109_23810 233
369 3300050513 nmdc:mga0rr50_65_c1 nmdc:mga0rr50_65_c1_26489_27190 233
370 3300050514 nmdc:mga08x19_1138_c1 nmdc:mga08x19_1138_c1_9790_10491 233
371 3300050514 nmdc:mga08x19_18797_c1 nmdc:mga08x19_18797_c1_1088_1789 233
372 3300050515 nmdc:mga0a205_38_c1 nmdc:mga0a205_38_c1_43997_44698 233
373 3300050516 nmdc:mga0sz30_102402_c1 nmdc:mga0sz30_102402_c1_36_737 233
374 3300053117 Ga0500593_000086 Ga0500593_000086_3991_4692 233
375 3300053131 Ga0500652_000940 Ga0500652_000940_5660_6361 233
376 3300053154 Ga0500619_000159 Ga0500619_000159_14709_15410 233
377 3300005530 Ga0070679_100239762 Ga0070679_1002397622 234
378 3300005535 Ga0070684_100048049 Ga0070684_1000480494 234
379 3300005536 Ga0070697_100002781 Ga0070697_1000027811 234
380 3300005544 Ga0070686_100008505 Ga0070686_1000085056 234
381 3300005547 Ga0070693_100004415 Ga0070693_1000044153 234
382 3300005547 Ga0070693_100120740 Ga0070693_1001207402 234
383 3300006051 Ga0075364_10000071 Ga0075364_1000007110 234
384 3300006237 Ga0097621_100001351 Ga0097621_10000135112 234
385 3300006871 Ga0075434_100480903 Ga0075434_1004809032 234
386 3300007076 Ga0075435_100757542 Ga0075435_1007575421 234
387 3300009984 Ga0105029_102780 Ga0105029_1027802 234
388 3300009993 Ga0105028_104845 Ga0105028_1048452 234
389 3300025304 Ga0209257_1000170 Ga0209257_100017038 234
390 3300026035 Ga0207703_10451565 Ga0207703_104515652 234
391 3300026116 Ga0207674_10794722 Ga0207674_107947222 234
392 3300027360 Ga0209969_1004338 Ga0209969_10043383 234
393 3300027364 Ga0209967_1001392 Ga0209967_10013925 234
394 3300027378 Ga0209981_1001824 Ga0209981_10018243 234
395 3300027462 Ga0210000_1002695 Ga0210000_10026952 234
396 3300027471 Ga0209995_1002834 Ga0209995_10028344 234
397 3300027543 Ga0209999_1002191 Ga0209999_10021914 234
398 3300031456 Ga0307513_10053910 Ga0307513_100539102 234
399 3300031456 Ga0307513_10187057 Ga0307513_101870572 234
400 3300032004 Ga0307414_10003843 Ga0307414_100038435 234
401 3300032004 Ga0307414_10285570 Ga0307414_102855702 234
402 3300035114 Ga0373939_0003944 Ga0373939_0003944_1437_2141 234
403 3300035115 Ga0373941_0008262 Ga0373941_0008262_1552_2259 234
404 3300035121 Ga0373960_0058190 Ga0373960_0058190_42_746 234
405 3300035207 Ga0373942_0029070 Ga0373942_0029070_138_845 234
406 3300035241 Ga0373961_0139058 Ga0373961_0139058_85_789 234
407 3300035242 Ga0373962_0035700 Ga0373962_0035700_314_1018 234
408 3300035691 Ga0373931_0010935 Ga0373931_0010935_2831_3535 234
409 3300035691 Ga0373931_0025228 Ga0373931_0025228_2025_2732 234
410 3300039145 Ga0237816_02012 Ga0237816_02012_641_1345 234
411 3300041404 Ga0439436_0036455 Ga0439436_0036455_10_714 234
412 3300041411 Ga0439466_0122546 Ga0439466_0122546_72_776 234
413 3300041413 Ga0439465_0001020 Ga0439465_0001020_3346_4050 234
414 3300041451 Ga0451791_0606939 Ga0451791_0606939_227_931 234
415 3300041452 Ga0451793_1630383 Ga0451793_1630383_180_884 234
416 3300041453 Ga0451797_1003378 Ga0451797_1003378_1350_2054 234
417 3300041460 Ga0451802_0724729 Ga0451802_0724729_108_812 234
418 3300041486 Ga0451807_2152295 Ga0451807_2152295_1661_2365 234
419 3300041997 Ga0439431_0004092 Ga0439431_0004092_1362_2066 234
420 3300042004 Ga0439445_0003943 Ga0439445_0003943_378_1082 234
421 3300042004 Ga0439445_0016603 Ga0439445_0016603_560_1264 234
422 3300042007 Ga0439449_0000018 Ga0439449_0000018_40476_41180 234
423 3300042007 Ga0439449_0008520 Ga0439449_0008520_146_850 234
424 3300044656 Ga0466969_0005519 Ga0466969_0005519_1336_2043 234
425 3300044683 Ga0466965_0006319 Ga0466965_0006319_374_1078 234
426 3300044684 Ga0466966_0025545 Ga0466966_0025545_612_1319 234
427 3300044684 Ga0466966_0276921 Ga0466966_0276921_31_735 234
428 3300044693 Ga0466961_0000186 Ga0466961_0000186_4689_5393 234
429 3300044719 Ga0466971_0057905 Ga0466971_0057905_856_1563 234
430 3300045049 Ga0466959_0000908 Ga0466959_0000908_6521_7225 234
431 3300045051 Ga0451576_0080843 Ga0451576_0080843_1500_2204 234
432 3300046522 Ga0495643_0238755 Ga0495643_0238755_61_765 234
433 3300046525 Ga0495663_0011477 Ga0495663_0011477_805_1509 234
434 3300046660 Ga0495625_0094104 Ga0495625_0094104_75_779 234
435 3300046692 Ga0495671_0007619 Ga0495671_0007619_2406_3110 234
436 3300048925 Ga0496122_0058846 Ga0496122_0058846_48_752 234
437 3300048926 Ga0496123_0064399 Ga0496123_0064399_49_753 234
438 3300049705 Ga0501225_0011654 Ga0501225_0011654_72_776 234
439 3300050491 nmdc:mga00v17_770_c1 nmdc:mga00v17_770_c1_10726_11430 234
440 3300050509 nmdc:mga0qj67_329177_c1 nmdc:mga0qj67_329177_c1_317_1024 234
441 3300050513 nmdc:mga0rr50_730685_c1 nmdc:mga0rr50_730685_c1_120_824 234
442 3300061719 Ga0466962_0084418 Ga0466962_0084418_734_1441 234
443 3300003781 Ga0055536_1001684 Ga0055536_100168411 235
444 3300005289 Ga0065704_10070919 Ga0065704_1007091917 235
445 3300005530 Ga0070679_100026952 Ga0070679_1000269525 235
446 3300005546 Ga0070696_100269404 Ga0070696_1002694042 235
447 3300005547 Ga0070693_100299893 Ga0070693_1002998931 235
448 3300013307 Ga0157372_10050434 Ga0157372_100504343 235
449 3300025292 Ga0209676_1000024 Ga0209676_1000024335 235
450 3300025912 Ga0207707_10013310 Ga0207707_100133107 235
451 3300025921 Ga0207652_10149805 Ga0207652_101498052 235
452 3300031548 Ga0307408_100486867 Ga0307408_1004868672 235
453 3300031824 Ga0307413_10065057 Ga0307413_100650572 235
454 3300031901 Ga0307406_10182256 Ga0307406_101822561 235
455 3300031995 Ga0307409_100269574 Ga0307409_1002695742 235
456 3300031995 Ga0307409_100287702 Ga0307409_1002877022 235
457 3300032002 Ga0307416_100395218 Ga0307416_1003952182 235
458 3300032004 Ga0307414_10505464 Ga0307414_105054641 235
459 3300032004 Ga0307414_10832818 Ga0307414_108328181 235
460 3300032004 Ga0307414_10847184 Ga0307414_108471841 235
461 3300032126 Ga0307415_100112153 Ga0307415_1001121533 235
462 3300037312 Ga0395899_0170380 Ga0395899_0170380_83_793 235
463 3300037466 Ga0395898_0346624 Ga0395898_0346624_52_762 235
464 3300041413 Ga0439465_0021577 Ga0439465_0021577_1259_1966 235
465 3300041494 Ga0451837_0571131 Ga0451837_0571131_1124_1831 235
466 3300041509 Ga0451843_0662141 Ga0451843_0662141_323_1030 235
467 3300042006 Ga0439432_011274 Ga0439432_011274_124_837 235
468 3300042007 Ga0439449_0009369 Ga0439449_0009369_829_1551 235
469 3300042007 Ga0439449_0018214 Ga0439449_0018214_1171_1878 235
470 3300042876 Ga0451577_0030922 Ga0451577_0030922_2682_3389 235
471 3300044712 Ga0453684_0001838 Ga0453684_0001838_30195_30911 235
472 3300044712 Ga0453684_0577436 Ga0453684_0577436_193_909 235
473 3300044712 Ga0453684_0882040 Ga0453684_0882040_54_761 235
474 3300045051 Ga0451576_0098067 Ga0451576_0098067_2127_2843 235
475 3300049513 Ga0501290_000646 Ga0501290_000646_3882_4589 235
476 3300049523 Ga0501300_010037 Ga0501300_010037_61_768 235
477 3300049531 Ga0501315_006877 Ga0501315_006877_550_1263 235
478 3300049571 Ga0501034_0000122 Ga0501034_0000122_86822_87529 235
479 3300049762 Ga0501265_005136 Ga0501265_005136_466_1173 235
480 3300049767 Ga0501270_032590 Ga0501270_032590_31_744 235
481 3300049771 Ga0501274_013342 Ga0501274_013342_24_737 235
482 3300049772 Ga0501275_002650 Ga0501275_002650_203_910 235
483 3300013307 Ga0157372_10079938 Ga0157372_100799384 236
484 3300026089 Ga0207648_10327159 Ga0207648_103271592 236
485 3300035398 Ga0316574_0468911 Ga0316574_0468911_53_769 236
486 3300050507 nmdc:mga05p37_246269_c1 nmdc:mga05p37_246269_c1_195_917 238
487 3300003323 rootH1_10078708 rootH1_100787081 245
488 3300041509 Ga0451843_0075458 Ga0451843_0075458_771_1508 245
489 3300013307 Ga0157372_10084043 Ga0157372_100840432 246
490 3300050493 nmdc:mga0k408_109930_c1 nmdc:mga0k408_109930_c1_338_1117 249
491 3300042013 Ga0439456_043083 Ga0439456_043083_110_910 256
492 3300042436 Ga0439435_0007780 Ga0439435_0007780_989_1789 256
493 3300042461 Ga0439460_0001673 Ga0439460_0001673_20_820 256
494 2162886007 SwRhRL2b_contig_1851671 SwRhRL2b_0991.00007050 264
495 3300048917 Ga0496114_0003855 Ga0496114_0003855_6905_7741 264
496 3300048929 Ga0496126_0002981 Ga0496126_0002981_11106_11942 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

189

274

0.99

PF02678

Pirin

Pirin

46

162

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9652 30 263
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9613 30 264
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9611 30 263
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9493 30 264
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.8727 71 149
ID Description Score Start End Superfamily
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9857 40 164 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9838 42 160 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9776 40 164 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9678 42 160 2.60.120.10
af_F1QLW3_37_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9511 68 149 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4P7CSX9-F1-model_v4 Pirin family protein 0.9965 30 260 GO:0046872
AF-A0A850QIQ9-F1-model_v4 Pirin family protein 0.9959 30 261 GO:0046872
AF-A0A1H6TRA1-F1-model_v4 Quercetin 2,3-dioxygenase 0.9944 30 264 GO:0046872
AF-A0A2H1PM95-F1-model_v4 deleted 0.9933 30 203
AF-A0A534X9Y4-F1-model_v4 Pirin family protein 0.9932 30 148

Feature Viewer

pLDDT pTM Quality
91.45 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map