F454949
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 496 | 342 | 468 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300048917|Ga0496114_0003855|Ga0496114_0003855_6905_7741 |
| Length | 278 |
| Sequence | MCSQAVGKTSLDSLLEQSIGSWLIYSITVQDHAARLTTPRSSAMITLRPAQARGHANHGWLDSWHSFSFANYFDDQHVHWGPLRVINEDRVAAGRGFGEHGHRDMEIISYVLEGALGHKDSMGNSSSIVPGDVQRMSAGTGVQHSEFNYNESGTTHFLQIWIIPDRQGVTPSYAEKAFPATEKQGRLRLVISPDGGDGSISIQQDARMYVGLFDGSEKAELPLAEGRLGYVHVARGEVTVNGKPLKAGDALLYDGEPLVSIERGIGSEVLVFDLPRMQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 3 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 4 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 5 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 6 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 7 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 8 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 9 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 10 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 11 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 12 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 13 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 14 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 15 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 16 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 17 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 18 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 19 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 20 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 21 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 22 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 23 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 24 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 25 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 26 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 27 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 28 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 97 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 144 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 169 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 170 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 171 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 175 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 183 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 184 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 194 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 195 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 196 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 197 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 198 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 204 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 205 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 206 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 207 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 208 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 209 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 210 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 211 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 212 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 213 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 214 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 215 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 216 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 217 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 218 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 219 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 220 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 221 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 271 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 272 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 273 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 274 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 275 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 276 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 277 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 278 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 283 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 284 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 308 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 309 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 310 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 317 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 328 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 329 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 330 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 331 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 332 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 333 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 336 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 337 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 338 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 339 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 340 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 341 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 342 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.55 |
| Metatranscriptomes | 0.81 |
| Isolates | 5.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.04 |
| Nodule | 0.4 |
| Rhizoplane | 2.62 |
| Rhizosphere | 84.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1851671 | 2162886007 | Bacteria | 4382 |
| 2 | JGI24739J22299_10000107 | 3300001989 | Bacteria | 25402 |
| 3 | JGI25162J39368_1000007 | 3300002737 | Bacteria | 403947 |
| 4 | rootH2_10005386 | 3300003320 | Bacteria | 74798 |
| 5 | rootH1_10078708 | 3300003323 | Bacteria | 1768 |
| 6 | Ga0055536_1001684 | 3300003781 | Bacteria | 13103 |
| 7 | Ga0065703_1020638 | 3300005272 | Bacteria | 1656 |
| 8 | Ga0065704_10070919 | 3300005289 | Bacteria | 14652 |
| 9 | Ga0068868_100211494 | 3300005338 | Bacteria | 1621 |
| 10 | Ga0068868_100377429 | 3300005338 | Bacteria | 1219 |
| 11 | Ga0070689_100186592 | 3300005340 | Bacteria | 1687 |
| 12 | Ga0070689_100205843 | 3300005340 | Bacteria | 1609 |
| 13 | Ga0070689_100737482 | 3300005340 | Bacteria | 863 |
| 14 | Ga0070687_100290753 | 3300005343 | Bacteria | 1033 |
| 15 | Ga0070692_10025021 | 3300005345 | Bacteria | 2940 |
| 16 | Ga0070669_100458231 | 3300005353 | Bacteria | 1052 |
| 17 | Ga0070675_100017058 | 3300005354 | Bacteria | 5772 |
| 18 | Ga0070671_100253818 | 3300005355 | Bacteria | 1494 |
| 19 | Ga0070673_100181525 | 3300005364 | Bacteria | 1802 |
| 20 | Ga0070673_100494504 | 3300005364 | Bacteria | 1106 |
| 21 | Ga0070688_100206852 | 3300005365 | Bacteria | 1376 |
| 22 | Ga0070714_100001772 | 3300005435 | Bacteria | 15735 |
| 23 | Ga0070714_100015965 | 3300005435 | Bacteria | 6055 |
| 24 | Ga0070701_10305403 | 3300005438 | Bacteria | 979 |
| 25 | Ga0070711_100458889 | 3300005439 | Bacteria | 1044 |
| 26 | Ga0070705_100054401 | 3300005440 | Bacteria | 2348 |
| 27 | Ga0070700_100014470 | 3300005441 | Bacteria | 4455 |
| 28 | Ga0070694_100023136 | 3300005444 | Bacteria | 3992 |
| 29 | Ga0070694_100150111 | 3300005444 | Bacteria | 1701 |
| 30 | Ga0070663_100046329 | 3300005455 | Bacteria | 3076 |
| 31 | Ga0070662_100008279 | 3300005457 | Bacteria | 6773 |
| 32 | Ga0068867_100248830 | 3300005459 | Bacteria | 1445 |
| 33 | Ga0070706_100114912 | 3300005467 | Bacteria | 2506 |
| 34 | Ga0070707_100123106 | 3300005468 | Bacteria | 2518 |
| 35 | Ga0070698_100123876 | 3300005471 | Bacteria | 2542 |
| 36 | Ga0070699_100188003 | 3300005518 | Bacteria | 1834 |
| 37 | Ga0070679_100026952 | 3300005530 | Bacteria | 5651 |
| 38 | Ga0070679_100239762 | 3300005530 | Bacteria | 1771 |
| 39 | Ga0070679_100972066 | 3300005530 | Bacteria | 793 |
| 40 | Ga0070684_100048049 | 3300005535 | Bacteria | 3701 |
| 41 | Ga0070697_100002781 | 3300005536 | Bacteria | 13474 |
| 42 | Ga0070697_100126708 | 3300005536 | Bacteria | 2139 |
| 43 | Ga0070686_100008505 | 3300005544 | Bacteria | 5748 |
| 44 | Ga0070695_100011088 | 3300005545 | Bacteria | 5388 |
| 45 | Ga0070695_100259892 | 3300005545 | Bacteria | 1268 |
| 46 | Ga0070696_100269404 | 3300005546 | Bacteria | 1294 |
| 47 | Ga0070693_100004415 | 3300005547 | Bacteria | 6649 |
| 48 | Ga0070693_100120740 | 3300005547 | Bacteria | 1625 |
| 49 | Ga0070693_100299893 | 3300005547 | Bacteria | 1083 |
| 50 | Ga0070665_100299227 | 3300005548 | Bacteria | 1611 |
| 51 | Ga0070704_100081562 | 3300005549 | Bacteria | 2383 |
| 52 | Ga0070704_100666488 | 3300005549 | Bacteria | 920 |
| 53 | Ga0070702_100038397 | 3300005615 | Bacteria | 2666 |
| 54 | Ga0068859_101092046 | 3300005617 | Bacteria | 877 |
| 55 | Ga0068864_100018648 | 3300005618 | Bacteria | 5799 |
| 56 | Ga0068866_10376516 | 3300005718 | Bacteria | 909 |
| 57 | Ga0068861_100139227 | 3300005719 | Bacteria | 1979 |
| 58 | Ga0068861_100192116 | 3300005719 | Bacteria | 1707 |
| 59 | Ga0068863_100669760 | 3300005841 | Bacteria | 1030 |
| 60 | Ga0068860_100212677 | 3300005843 | Bacteria | 1876 |
| 61 | Ga0068862_100014628 | 3300005844 | Bacteria | 6517 |
| 62 | Ga0068862_100266416 | 3300005844 | Bacteria | 1565 |
| 63 | Ga0081539_10000496 | 3300005985 | Bacteria | 82338 |
| 64 | Ga0075365_10009131 | 3300006038 | Bacteria | 5680 |
| 65 | Ga0075364_10000071 | 3300006051 | Bacteria | 39405 |
| 66 | Ga0075364_10101648 | 3300006051 | Bacteria | 1914 |
| 67 | Ga0075369_10013066 | 3300006186 | Bacteria | 3288 |
| 68 | Ga0075366_10004427 | 3300006195 | Bacteria | 7539 |
| 69 | Ga0075366_10066176 | 3300006195 | Bacteria | 2150 |
| 70 | Ga0075366_10101187 | 3300006195 | Bacteria | 1729 |
| 71 | Ga0097621_100001351 | 3300006237 | Bacteria | 16880 |
| 72 | Ga0075428_100000107 | 3300006844 | Bacteria | 70381 |
| 73 | Ga0075428_100008331 | 3300006844 | Bacteria | 11491 |
| 74 | Ga0075428_100223646 | 3300006844 | Bacteria | 2032 |
| 75 | Ga0075430_100069573 | 3300006846 | Bacteria | 2952 |
| 76 | Ga0075430_100101971 | 3300006846 | Bacteria | 2396 |
| 77 | Ga0075431_100153423 | 3300006847 | Bacteria | 2371 |
| 78 | Ga0075433_10002934 | 3300006852 | Bacteria | 13090 |
| 79 | Ga0075433_10019821 | 3300006852 | Bacteria | 5612 |
| 80 | Ga0075433_10034636 | 3300006852 | Bacteria | 4338 |
| 81 | Ga0075433_10500195 | 3300006852 | Bacteria | 1070 |
| 82 | Ga0075434_100001090 | 3300006871 | Bacteria | 22240 |
| 83 | Ga0075434_100011032 | 3300006871 | Bacteria | 8502 |
| 84 | Ga0075434_100131120 | 3300006871 | Bacteria | 2525 |
| 85 | Ga0075434_100480903 | 3300006871 | Bacteria | 1263 |
| 86 | Ga0075429_100000317 | 3300006880 | Bacteria | 34568 |
| 87 | Ga0075429_100002952 | 3300006880 | Bacteria | 14428 |
| 88 | Ga0075436_100000593 | 3300006914 | Bacteria | 23748 |
| 89 | Ga0075436_100001604 | 3300006914 | Bacteria | 15447 |
| 90 | Ga0075436_100006924 | 3300006914 | Bacteria | 7756 |
| 91 | Ga0075436_100016824 | 3300006914 | Bacteria | 5005 |
| 92 | Ga0075436_100017307 | 3300006914 | Bacteria | 4934 |
| 93 | Ga0075436_100040125 | 3300006914 | Bacteria | 3230 |
| 94 | Ga0075436_100212591 | 3300006914 | Bacteria | 1371 |
| 95 | Ga0097620_101092051 | 3300006931 | Bacteria | 877 |
| 96 | Ga0079104_1002497 | 3300006946 | Bacteria | 9789 |
| 97 | Ga0075435_100000229 | 3300007076 | Bacteria | 34254 |
| 98 | Ga0075435_100073601 | 3300007076 | Bacteria | 2793 |
| 99 | Ga0075435_100132387 | 3300007076 | Bacteria | 2087 |
| 100 | Ga0075435_100573956 | 3300007076 | Bacteria | 977 |
| 101 | Ga0075435_100757542 | 3300007076 | Bacteria | 845 |
| 102 | Ga0099794_10016077 | 3300007265 | Bacteria | 3312 |
| 103 | Ga0105251_10000230 | 3300009011 | Bacteria | 56255 |
| 104 | Ga0105251_10000233 | 3300009011 | Bacteria | 55865 |
| 105 | Ga0105251_10010612 | 3300009011 | Bacteria | 5326 |
| 106 | Ga0105251_10016472 | 3300009011 | Bacteria | 3993 |
| 107 | Ga0105244_10001361 | 3300009036 | Bacteria | 19852 |
| 108 | Ga0105250_10000020 | 3300009092 | Bacteria | 242010 |
| 109 | Ga0105250_10008877 | 3300009092 | Bacteria | 4252 |
| 110 | Ga0111539_10005775 | 3300009094 | Bacteria | 15996 |
| 111 | Ga0111539_10009312 | 3300009094 | Bacteria | 12402 |
| 112 | Ga0111539_10018067 | 3300009094 | Bacteria | 8735 |
| 113 | Ga0111539_10029811 | 3300009094 | Bacteria | 6639 |
| 114 | Ga0111539_10226420 | 3300009094 | Bacteria | 2178 |
| 115 | Ga0105247_10000396 | 3300009101 | Bacteria | 36915 |
| 116 | Ga0114129_10001717 | 3300009147 | Bacteria | 29906 |
| 117 | Ga0105243_10235286 | 3300009148 | Bacteria | 1627 |
| 118 | Ga0105241_10000013 | 3300009174 | Bacteria | 172249 |
| 119 | Ga0105242_10014042 | 3300009176 | Bacteria | 6198 |
| 120 | Ga0105029_102780 | 3300009984 | Bacteria | 1148 |
| 121 | Ga0105028_104845 | 3300009993 | Bacteria | 1403 |
| 122 | Ga0105246_10019180 | 3300011119 | Bacteria | 4366 |
| 123 | Ga0105246_10225459 | 3300011119 | Bacteria | 1472 |
| 124 | Ga0157373_10000081 | 3300013100 | Bacteria | 82343 |
| 125 | Ga0157373_10004744 | 3300013100 | Bacteria | 10228 |
| 126 | Ga0157371_10003054 | 3300013102 | Bacteria | 15537 |
| 127 | Ga0157374_10672242 | 3300013296 | Unclassified | 1048 |
| 128 | Ga0157378_10085314 | 3300013297 | Bacteria | 2860 |
| 129 | Ga0163162_10084587 | 3300013306 | Bacteria | 3248 |
| 130 | Ga0157372_10050434 | 3300013307 | Bacteria | 4629 |
| 131 | Ga0157372_10079938 | 3300013307 | Bacteria | 3698 |
| 132 | Ga0157372_10084043 | 3300013307 | Bacteria | 3607 |
| 133 | Ga0182008_10008294 | 3300014497 | Bacteria | 5677 |
| 134 | Ga0157376_10425113 | 3300014969 | Bacteria | 1290 |
| 135 | Ga0182006_1042856 | 3300015261 | Bacteria | 1771 |
| 136 | Ga0163161_10000028 | 3300017792 | Bacteria | 197151 |
| 137 | Ga0209676_1000024 | 3300025292 | Bacteria | 578839 |
| 138 | Ga0209257_1000170 | 3300025304 | Bacteria | 169384 |
| 139 | Ga0207696_1000036 | 3300025711 | Bacteria | 337736 |
| 140 | Ga0207696_1000068 | 3300025711 | Bacteria | 228017 |
| 141 | Ga0207696_1000557 | 3300025711 | Bacteria | 29652 |
| 142 | Ga0207655_1000106 | 3300025728 | Bacteria | 181416 |
| 143 | Ga0207655_1030501 | 3300025728 | Bacteria | 2506 |
| 144 | Ga0207713_1000044 | 3300025735 | Bacteria | 238074 |
| 145 | Ga0207713_1000062 | 3300025735 | Bacteria | 208832 |
| 146 | Ga0207713_1006491 | 3300025735 | Bacteria | 7113 |
| 147 | Ga0207713_1007196 | 3300025735 | Bacteria | 6630 |
| 148 | Ga0207710_10000145 | 3300025900 | Bacteria | 80941 |
| 149 | Ga0207685_10059237 | 3300025905 | Bacteria | 1509 |
| 150 | Ga0207645_10026933 | 3300025907 | Bacteria | 3715 |
| 151 | Ga0207654_10000016 | 3300025911 | Bacteria | 211550 |
| 152 | Ga0207707_10013310 | 3300025912 | Bacteria | 7171 |
| 153 | Ga0207707_10084896 | 3300025912 | Bacteria | 2766 |
| 154 | Ga0207707_10501529 | 3300025912 | Bacteria | 1035 |
| 155 | Ga0207663_10416295 | 3300025916 | Bacteria | 1031 |
| 156 | Ga0207660_10374426 | 3300025917 | Bacteria | 1144 |
| 157 | Ga0207652_10149805 | 3300025921 | Bacteria | 2088 |
| 158 | Ga0207646_10453780 | 3300025922 | Bacteria | 1157 |
| 159 | Ga0207659_10072424 | 3300025926 | Bacteria | 2519 |
| 160 | Ga0207700_10261199 | 3300025928 | Bacteria | 1483 |
| 161 | Ga0207664_10007528 | 3300025929 | Bacteria | 7555 |
| 162 | Ga0207664_10907730 | 3300025929 | Bacteria | 791 |
| 163 | Ga0207709_10093129 | 3300025935 | Bacteria | 1975 |
| 164 | Ga0207670_10303116 | 3300025936 | Bacteria | 1251 |
| 165 | Ga0207670_10444049 | 3300025936 | Bacteria | 1045 |
| 166 | Ga0207689_10044295 | 3300025942 | Bacteria | 3678 |
| 167 | Ga0207651_10232355 | 3300025960 | Bacteria | 1498 |
| 168 | Ga0207712_10360919 | 3300025961 | Bacteria | 1210 |
| 169 | Ga0207677_10201775 | 3300026023 | Bacteria | 1581 |
| 170 | Ga0207703_10451565 | 3300026035 | Bacteria | 1201 |
| 171 | Ga0207678_10034038 | 3300026067 | Bacteria | 4438 |
| 172 | Ga0207708_10427962 | 3300026075 | Bacteria | 1099 |
| 173 | Ga0207702_10076220 | 3300026078 | Bacteria | 2898 |
| 174 | Ga0207641_10163450 | 3300026088 | Bacteria | 2026 |
| 175 | Ga0207648_10327159 | 3300026089 | Bacteria | 1378 |
| 176 | Ga0207676_10030973 | 3300026095 | Bacteria | 4020 |
| 177 | Ga0207674_10794722 | 3300026116 | Bacteria | 913 |
| 178 | Ga0207675_100158730 | 3300026118 | Bacteria | 2156 |
| 179 | Ga0207675_100192107 | 3300026118 | Bacteria | 1959 |
| 180 | Ga0207683_10115027 | 3300026121 | Bacteria | 2411 |
| 181 | Ga0207683_10162721 | 3300026121 | Bacteria | 2018 |
| 182 | Ga0207698_10111234 | 3300026142 | Bacteria | 2296 |
| 183 | Ga0207698_10382077 | 3300026142 | Bacteria | 1340 |
| 184 | Ga0209281_1000107 | 3300027111 | Bacteria | 218397 |
| 185 | Ga0209969_1003492 | 3300027360 | Bacteria | 2175 |
| 186 | Ga0209969_1004338 | 3300027360 | Bacteria | 1984 |
| 187 | Ga0209967_1001392 | 3300027364 | Bacteria | 3099 |
| 188 | Ga0209981_1001824 | 3300027378 | Bacteria | 2702 |
| 189 | Ga0210000_1002695 | 3300027462 | Bacteria | 2529 |
| 190 | Ga0210000_1010958 | 3300027462 | Bacteria | 1343 |
| 191 | Ga0209995_1002834 | 3300027471 | Bacteria | 2747 |
| 192 | Ga0209999_1002191 | 3300027543 | Bacteria | 3419 |
| 193 | Ga0209999_1004623 | 3300027543 | Bacteria | 2472 |
| 194 | Ga0209588_1049292 | 3300027671 | Bacteria | 1363 |
| 195 | Ga0207428_10000179 | 3300027907 | Bacteria | 88854 |
| 196 | Ga0207428_10020477 | 3300027907 | Bacteria | 5618 |
| 197 | Ga0207428_10034099 | 3300027907 | Bacteria | 4174 |
| 198 | Ga0207428_10209995 | 3300027907 | Bacteria | 1463 |
| 199 | Ga0268264_10156428 | 3300028381 | Bacteria | 2049 |
| 200 | Ga0265326_10031321 | 3300028558 | Bacteria | 1515 |
| 201 | Ga0265334_10000017 | 3300028573 | Bacteria | 147461 |
| 202 | Ga0265338_10026656 | 3300028800 | Bacteria | 5820 |
| 203 | Ga0307511_10000108 | 3300030521 | Bacteria | 74238 |
| 204 | Ga0307513_10053910 | 3300031456 | Bacteria | 4317 |
| 205 | Ga0307513_10187057 | 3300031456 | Bacteria | 1927 |
| 206 | Ga0307408_100486867 | 3300031548 | Bacteria | 1077 |
| 207 | Ga0265313_10000022 | 3300031595 | Bacteria | 144838 |
| 208 | Ga0265313_10077584 | 3300031595 | Bacteria | 1516 |
| 209 | Ga0307516_10311996 | 3300031730 | Bacteria | 1246 |
| 210 | Ga0307413_10065057 | 3300031824 | Bacteria | 2269 |
| 211 | Ga0307410_10472055 | 3300031852 | Bacteria | 1027 |
| 212 | Ga0307410_10530965 | 3300031852 | Bacteria | 972 |
| 213 | Ga0307406_10182256 | 3300031901 | Bacteria | 1530 |
| 214 | Ga0307409_100263865 | 3300031995 | Bacteria | 1582 |
| 215 | Ga0307409_100269574 | 3300031995 | Bacteria | 1567 |
| 216 | Ga0307409_100287702 | 3300031995 | Bacteria | 1522 |
| 217 | Ga0307416_100022451 | 3300032002 | Bacteria | 4556 |
| 218 | Ga0307416_100068295 | 3300032002 | Bacteria | 2936 |
| 219 | Ga0307416_100225071 | 3300032002 | Bacteria | 1803 |
| 220 | Ga0307416_100395218 | 3300032002 | Bacteria | 1418 |
| 221 | Ga0307414_10003843 | 3300032004 | Bacteria | 8080 |
| 222 | Ga0307414_10285570 | 3300032004 | Bacteria | 1389 |
| 223 | Ga0307414_10505464 | 3300032004 | Bacteria | 1070 |
| 224 | Ga0307414_10832818 | 3300032004 | Bacteria | 843 |
| 225 | Ga0307414_10847184 | 3300032004 | Bacteria | 836 |
| 226 | Ga0307415_100112153 | 3300032126 | Bacteria | 2026 |
| 227 | Ga0307507_10025756 | 3300033179 | Bacteria | 6367 |
| 228 | Ga0373930_0070381 | 3300034816 | Bacteria | 795 |
| 229 | Ga0373926_0008847 | 3300035083 | Bacteria | 3354 |
| 230 | Ga0373934_0051832 | 3300035086 | Bacteria | 1627 |
| 231 | Ga0373932_0054421 | 3300035112 | Bacteria | 1197 |
| 232 | Ga0373936_0024942 | 3300035113 | Bacteria | 2336 |
| 233 | Ga0373939_0003944 | 3300035114 | Bacteria | 3491 |
| 234 | Ga0373941_0008262 | 3300035115 | Bacteria | 2579 |
| 235 | Ga0373941_0151685 | 3300035115 | Bacteria | 851 |
| 236 | Ga0373945_0005768 | 3300035116 | Bacteria | 3973 |
| 237 | Ga0373960_0058190 | 3300035121 | Bacteria | 1165 |
| 238 | Ga0373943_0062728 | 3300035170 | Bacteria | 1861 |
| 239 | Ga0373946_0036820 | 3300035171 | Bacteria | 1986 |
| 240 | Ga0373942_0029070 | 3300035207 | Bacteria | 1448 |
| 241 | Ga0373961_0139058 | 3300035241 | Bacteria | 819 |
| 242 | Ga0373962_0035700 | 3300035242 | Bacteria | 1381 |
| 243 | Ga0316574_0240123 | 3300035398 | Bacteria | 1158 |
| 244 | Ga0316574_0468911 | 3300035398 | Unclassified | 788 |
| 245 | Ga0373924_0078428 | 3300035410 | Bacteria | 1402 |
| 246 | Ga0373931_0010935 | 3300035691 | Bacteria | 4372 |
| 247 | Ga0373931_0025228 | 3300035691 | Bacteria | 3019 |
| 248 | Ga0373931_0089954 | 3300035691 | Bacteria | 1709 |
| 249 | Ga0373931_0215207 | 3300035691 | Bacteria | 1154 |
| 250 | Ga0373931_0219763 | 3300035691 | Bacteria | 1143 |
| 251 | Ga0373935_0036322 | 3300035692 | Bacteria | 3079 |
| 252 | Ga0373927_0009707 | 3300035695 | Bacteria | 6453 |
| 253 | Ga0373933_0710941 | 3300035724 | Bacteria | 661 |
| 254 | Ga0373947_0075888 | 3300035725 | Bacteria | 2070 |
| 255 | Ga0373925_0015285 | 3300037068 | Bacteria | 5550 |
| 256 | Ga0395899_0170380 | 3300037312 | Bacteria | 1533 |
| 257 | Ga0395898_0346624 | 3300037466 | Bacteria | 1416 |
| 258 | Ga0237816_02012 | 3300039145 | Bacteria | 1602 |
| 259 | Ga0436361_1102119 | 3300039447 | Bacteria | 1641 |
| 260 | Ga0439436_0036455 | 3300041404 | Bacteria | 1419 |
| 261 | Ga0439466_0019916 | 3300041411 | Bacteria | 2397 |
| 262 | Ga0439466_0122546 | 3300041411 | Bacteria | 802 |
| 263 | Ga0439465_0001020 | 3300041413 | Bacteria | 8908 |
| 264 | Ga0439465_0021577 | 3300041413 | Bacteria | 2020 |
| 265 | Ga0451791_0606939 | 3300041451 | Bacteria | 1515 |
| 266 | Ga0451793_1630383 | 3300041452 | Bacteria | 2322 |
| 267 | Ga0451797_1003378 | 3300041453 | Bacteria | 2171 |
| 268 | Ga0451802_0724729 | 3300041460 | Bacteria | 985 |
| 269 | Ga0451807_2152295 | 3300041486 | Bacteria | 2593 |
| 270 | Ga0451807_2384151 | 3300041486 | Bacteria | 1032 |
| 271 | Ga0451837_0571131 | 3300041494 | Bacteria | 2448 |
| 272 | Ga0451843_0075458 | 3300041509 | Bacteria | 1654 |
| 273 | Ga0451843_0662141 | 3300041509 | Bacteria | 1530 |
| 274 | Ga0439431_0004092 | 3300041997 | Bacteria | 3208 |
| 275 | Ga0439445_0003943 | 3300042004 | Bacteria | 3347 |
| 276 | Ga0439445_0016603 | 3300042004 | Bacteria | 1812 |
| 277 | Ga0439432_011274 | 3300042006 | Bacteria | 3082 |
| 278 | Ga0439449_0000018 | 3300042007 | Bacteria | 46636 |
| 279 | Ga0439449_0008520 | 3300042007 | Bacteria | 3896 |
| 280 | Ga0439449_0009369 | 3300042007 | Bacteria | 3713 |
| 281 | Ga0439449_0018214 | 3300042007 | Bacteria | 2635 |
| 282 | Ga0439456_043083 | 3300042013 | Bacteria | 981 |
| 283 | Ga0450923_019625 | 3300042125 | Bacteria | 1304 |
| 284 | Ga0450896_020740 | 3300042133 | Bacteria | 963 |
| 285 | Ga0439435_0007780 | 3300042436 | Bacteria | 2466 |
| 286 | Ga0439460_0001673 | 3300042461 | Bacteria | 5255 |
| 287 | Ga0451577_0015419 | 3300042876 | Bacteria | 7112 |
| 288 | Ga0451577_0030922 | 3300042876 | Bacteria | 4834 |
| 289 | Ga0451577_0229986 | 3300042876 | Bacteria | 1677 |
| 290 | Ga0451577_0531029 | 3300042876 | Bacteria | 1068 |
| 291 | Ga0466969_0005519 | 3300044656 | Bacteria | 6720 |
| 292 | Ga0466965_0006319 | 3300044683 | Bacteria | 5370 |
| 293 | Ga0466965_0128606 | 3300044683 | Bacteria | 1312 |
| 294 | Ga0466966_0025545 | 3300044684 | Bacteria | 3857 |
| 295 | Ga0466966_0276921 | 3300044684 | Bacteria | 1009 |
| 296 | Ga0466961_0000186 | 3300044693 | Bacteria | 41739 |
| 297 | Ga0453684_0001838 | 3300044712 | Bacteria | 55467 |
| 298 | Ga0453684_0577436 | 3300044712 | Bacteria | 1235 |
| 299 | Ga0453684_0882040 | 3300044712 | Bacteria | 959 |
| 300 | Ga0466971_0057905 | 3300044719 | Bacteria | 1749 |
| 301 | Ga0466959_0000908 | 3300045049 | Bacteria | 17509 |
| 302 | Ga0451576_0003504 | 3300045051 | Bacteria | 21445 |
| 303 | Ga0451576_0011469 | 3300045051 | Bacteria | 10062 |
| 304 | Ga0451576_0080843 | 3300045051 | Bacteria | 3381 |
| 305 | Ga0451576_0098067 | 3300045051 | Bacteria | 3048 |
| 306 | Ga0451576_0422758 | 3300045051 | Bacteria | 1398 |
| 307 | Ga0495627_000100 | 3300046453 | Bacteria | 106276 |
| 308 | Ga0495592_0001600 | 3300046454 | Bacteria | 15847 |
| 309 | Ga0495603_0117204 | 3300046455 | Bacteria | 1552 |
| 310 | Ga0495650_0082873 | 3300046471 | Bacteria | 1233 |
| 311 | Ga0495580_0000780 | 3300046472 | Bacteria | 27419 |
| 312 | Ga0495582_0018378 | 3300046473 | Bacteria | 3824 |
| 313 | Ga0495582_0135587 | 3300046473 | Bacteria | 1393 |
| 314 | Ga0495662_0005281 | 3300046476 | Bacteria | 6470 |
| 315 | Ga0495608_0000167 | 3300046511 | Bacteria | 46550 |
| 316 | Ga0495620_0166566 | 3300046515 | Bacteria | 855 |
| 317 | Ga0495628_0003674 | 3300046516 | Bacteria | 13697 |
| 318 | Ga0495630_0001186 | 3300046517 | Bacteria | 17967 |
| 319 | Ga0495630_0093027 | 3300046517 | Bacteria | 2279 |
| 320 | Ga0495643_0238755 | 3300046522 | Bacteria | 853 |
| 321 | Ga0495663_0011477 | 3300046525 | Bacteria | 2465 |
| 322 | Ga0495666_0038565 | 3300046526 | Bacteria | 2323 |
| 323 | Ga0495654_0000616 | 3300046530 | Bacteria | 28330 |
| 324 | Ga0495640_0000309 | 3300046533 | Bacteria | 33726 |
| 325 | Ga0495586_0000827 | 3300046535 | Bacteria | 17795 |
| 326 | Ga0495586_0004233 | 3300046535 | Bacteria | 7682 |
| 327 | Ga0495587_0050723 | 3300046536 | Bacteria | 2455 |
| 328 | Ga0495667_0027587 | 3300046559 | Bacteria | 3825 |
| 329 | Ga0495634_0005562 | 3300046642 | Bacteria | 9670 |
| 330 | Ga0495625_0094104 | 3300046660 | Bacteria | 2068 |
| 331 | Ga0495635_0315090 | 3300046663 | Bacteria | 1047 |
| 332 | Ga0495588_0023299 | 3300046674 | Bacteria | 3065 |
| 333 | Ga0495599_0002399 | 3300046678 | Bacteria | 10897 |
| 334 | Ga0495623_0008104 | 3300046679 | Bacteria | 6831 |
| 335 | Ga0495646_0308155 | 3300046680 | Bacteria | 836 |
| 336 | Ga0495647_0001167 | 3300046681 | Bacteria | 8076 |
| 337 | Ga0495658_0004579 | 3300046683 | Bacteria | 6804 |
| 338 | Ga0495658_0023702 | 3300046683 | Bacteria | 3261 |
| 339 | Ga0495669_0007483 | 3300046684 | Bacteria | 4580 |
| 340 | Ga0495613_0002922 | 3300046689 | Bacteria | 12811 |
| 341 | Ga0495624_0013677 | 3300046690 | Bacteria | 5526 |
| 342 | Ga0495671_0007619 | 3300046692 | Bacteria | 6152 |
| 343 | Ga0495589_0000010 | 3300046794 | Bacteria | 250407 |
| 344 | Ga0495604_0002023 | 3300047317 | Bacteria | 16355 |
| 345 | Ga0495604_0149970 | 3300047317 | Bacteria | 1658 |
| 346 | Ga0495636_0008379 | 3300047318 | Bacteria | 4081 |
| 347 | Ga0495676_0040690 | 3300047321 | Bacteria | 3833 |
| 348 | Ga0495680_0001124 | 3300047322 | Bacteria | 29512 |
| 349 | Ga0495687_118020 | 3300047443 | Bacteria | 962 |
| 350 | Ga0495675_0032298 | 3300047444 | Bacteria | 3340 |
| 351 | Ga0495684_0002525 | 3300047471 | Bacteria | 14591 |
| 352 | Ga0495602_0017644 | 3300048088 | Bacteria | 7151 |
| 353 | Ga0496100_0145498 | 3300048903 | Bacteria | 1685 |
| 354 | Ga0496101_0000053 | 3300048904 | Bacteria | 139859 |
| 355 | Ga0496102_0028701 | 3300048905 | Bacteria | 4972 |
| 356 | Ga0496109_0284617 | 3300048912 | Bacteria | 1558 |
| 357 | Ga0496109_0766254 | 3300048912 | Bacteria | 903 |
| 358 | Ga0496110_0667090 | 3300048913 | Bacteria | 940 |
| 359 | Ga0496114_0003855 | 3300048917 | Bacteria | 11564 |
| 360 | Ga0496116_0000077 | 3300048919 | Bacteria | 227959 |
| 361 | Ga0496117_0002611 | 3300048920 | Bacteria | 22395 |
| 362 | Ga0496117_0254179 | 3300048920 | Bacteria | 956 |
| 363 | Ga0496118_0008371 | 3300048921 | Bacteria | 10697 |
| 364 | Ga0496118_0055479 | 3300048921 | Bacteria | 2990 |
| 365 | Ga0496119_0001653 | 3300048922 | Bacteria | 26225 |
| 366 | Ga0496119_0010401 | 3300048922 | Bacteria | 7838 |
| 367 | Ga0496119_0395429 | 3300048922 | Bacteria | 660 |
| 368 | Ga0496120_0000139 | 3300048923 | Bacteria | 120489 |
| 369 | Ga0496120_0001587 | 3300048923 | Bacteria | 26441 |
| 370 | Ga0496121_0027154 | 3300048924 | Bacteria | 5365 |
| 371 | Ga0496122_0007780 | 3300048925 | Bacteria | 11787 |
| 372 | Ga0496122_0058846 | 3300048925 | Bacteria | 2841 |
| 373 | Ga0496123_0003349 | 3300048926 | Bacteria | 18135 |
| 374 | Ga0496123_0064399 | 3300048926 | Bacteria | 2336 |
| 375 | Ga0496124_0000100 | 3300048927 | Bacteria | 181404 |
| 376 | Ga0496124_0019885 | 3300048927 | Bacteria | 6228 |
| 377 | Ga0496126_0002981 | 3300048929 | Bacteria | 21979 |
| 378 | Ga0501309_018677 | 3300049129 | Unclassified | 959 |
| 379 | Ga0501305_025098 | 3300049161 | Unclassified | 902 |
| 380 | Ga0501290_000646 | 3300049513 | Bacteria | 5225 |
| 381 | Ga0501300_010037 | 3300049523 | Bacteria | 1381 |
| 382 | Ga0501313_016454 | 3300049529 | Unclassified | 888 |
| 383 | Ga0501315_006877 | 3300049531 | Bacteria | 1281 |
| 384 | Ga0501032_0321361 | 3300049569 | Bacteria | 999 |
| 385 | Ga0501034_0000122 | 3300049571 | Bacteria | 144085 |
| 386 | Ga0501034_0057798 | 3300049571 | Bacteria | 3899 |
| 387 | Ga0501034_0252256 | 3300049571 | Bacteria | 1709 |
| 388 | Ga0501036_0185158 | 3300049572 | Bacteria | 1752 |
| 389 | Ga0501037_0029800 | 3300049573 | Bacteria | 4032 |
| 390 | Ga0501038_0228590 | 3300049574 | Bacteria | 1481 |
| 391 | Ga0501039_0006328 | 3300049575 | Bacteria | 8989 |
| 392 | Ga0501041_0008810 | 3300049577 | Bacteria | 5939 |
| 393 | Ga0501041_0040479 | 3300049577 | Bacteria | 2828 |
| 394 | Ga0501043_0000038 | 3300049579 | Bacteria | 128656 |
| 395 | Ga0501043_0107972 | 3300049579 | Bacteria | 2186 |
| 396 | Ga0501043_0138387 | 3300049579 | Bacteria | 1907 |
| 397 | Ga0501046_0000049 | 3300049580 | Bacteria | 135088 |
| 398 | Ga0501047_0000039 | 3300049581 | Bacteria | 187849 |
| 399 | Ga0501047_0701068 | 3300049581 | Bacteria | 830 |
| 400 | Ga0501048_0002594 | 3300049582 | Bacteria | 13846 |
| 401 | Ga0501048_0145106 | 3300049582 | Bacteria | 1679 |
| 402 | Ga0501068_0042549 | 3300049584 | Bacteria | 2732 |
| 403 | Ga0501071_0082446 | 3300049587 | Bacteria | 2355 |
| 404 | Ga0501072_0029736 | 3300049588 | Bacteria | 4269 |
| 405 | Ga0501072_0038048 | 3300049588 | Bacteria | 3776 |
| 406 | Ga0501075_0006548 | 3300049591 | Bacteria | 8023 |
| 407 | Ga0501076_0002770 | 3300049592 | Bacteria | 12132 |
| 408 | Ga0501076_0070188 | 3300049592 | Bacteria | 2801 |
| 409 | Ga0501076_0177336 | 3300049592 | Bacteria | 1737 |
| 410 | Ga0501077_0030345 | 3300049593 | Bacteria | 3440 |
| 411 | Ga0501225_0011654 | 3300049705 | Bacteria | 2473 |
| 412 | Ga0501079_0000379 | 3300049741 | Bacteria | 28580 |
| 413 | Ga0501079_0162032 | 3300049741 | Bacteria | 1744 |
| 414 | Ga0501080_0027036 | 3300049742 | Bacteria | 5335 |
| 415 | Ga0501081_0000033 | 3300049743 | Bacteria | 51492 |
| 416 | Ga0501265_005136 | 3300049762 | Bacteria | 1504 |
| 417 | Ga0501270_032590 | 3300049767 | Bacteria | 868 |
| 418 | Ga0501274_013342 | 3300049771 | Bacteria | 788 |
| 419 | Ga0501275_002650 | 3300049772 | Bacteria | 1644 |
| 420 | Ga0501035_0046012 | 3300049822 | Bacteria | 3925 |
| 421 | Ga0501044_0120444 | 3300049823 | Bacteria | 2626 |
| 422 | Ga0501045_0008121 | 3300049824 | Bacteria | 7311 |
| 423 | Ga0501045_0098628 | 3300049824 | Bacteria | 2162 |
| 424 | Ga0501045_0232574 | 3300049824 | Bacteria | 1372 |
| 425 | Ga0501045_0262476 | 3300049824 | Bacteria | 1286 |
| 426 | nmdc:mga00v17_55345_c1 | 3300050491 | Bacteria | 2423 |
| 427 | nmdc:mga00v17_770_c1 | 3300050491 | Bacteria | 17418 |
| 428 | nmdc:mga0yw44_22891_c1 | 3300050492 | Bacteria | 3511 |
| 429 | nmdc:mga0k408_109930_c1 | 3300050493 | Bacteria | 1629 |
| 430 | nmdc:mga0k408_175428_c1 | 3300050493 | Bacteria | 1278 |
| 431 | nmdc:mga0k408_7176_c1 | 3300050493 | Bacteria | 5955 |
| 432 | nmdc:mga05p37_1373_c1 | 3300050507 | Bacteria | 28308 |
| 433 | nmdc:mga05p37_246269_c1 | 3300050507 | Bacteria | 2146 |
| 434 | nmdc:mga09592_369_c1 | 3300050508 | Bacteria | 32912 |
| 435 | nmdc:mga0qj67_329177_c1 | 3300050509 | Bacteria | 1236 |
| 436 | nmdc:mga0qj67_78908_c1 | 3300050509 | Bacteria | 2636 |
| 437 | nmdc:mga06r32_151794_c1 | 3300050510 | Bacteria | 2295 |
| 438 | nmdc:mga06r32_454698_c1 | 3300050510 | Bacteria | 1260 |
| 439 | nmdc:mga08y16_2408_c2 | 3300050511 | Bacteria | 8891 |
| 440 | nmdc:mga08y16_3865_c1 | 3300050511 | Bacteria | 15580 |
| 441 | nmdc:mga08y16_426710_c1 | 3300050511 | Bacteria | 1354 |
| 442 | nmdc:mga08y16_88231_c1 | 3300050511 | Bacteria | 3232 |
| 443 | nmdc:mga0n895_10479_c1 | 3300050512 | Bacteria | 8194 |
| 444 | nmdc:mga0n895_272_c1 | 3300050512 | Bacteria | 33829 |
| 445 | nmdc:mga0rr50_11608_c1 | 3300050513 | Bacteria | 5651 |
| 446 | nmdc:mga0rr50_65_c1 | 3300050513 | Bacteria | 62915 |
| 447 | nmdc:mga0rr50_730685_c1 | 3300050513 | Bacteria | 845 |
| 448 | nmdc:mga08x19_10704_c2 | 3300050514 | Bacteria | 3490 |
| 449 | nmdc:mga08x19_1118_c1 | 3300050514 | Bacteria | 16743 |
| 450 | nmdc:mga08x19_1138_c1 | 3300050514 | Bacteria | 16598 |
| 451 | nmdc:mga08x19_18797_c1 | 3300050514 | Bacteria | 4236 |
| 452 | nmdc:mga08x19_8586_c1 | 3300050514 | Bacteria | 6088 |
| 453 | nmdc:mga0a205_212894_c1 | 3300050515 | Bacteria | 1820 |
| 454 | nmdc:mga0a205_38_c1 | 3300050515 | Bacteria | 73135 |
| 455 | nmdc:mga0a205_72306_c1 | 3300050515 | Bacteria | 3332 |
| 456 | nmdc:mga0a205_7368_c2 | 3300050515 | Bacteria | 5481 |
| 457 | nmdc:mga0sz30_102402_c1 | 3300050516 | Bacteria | 1251 |
| 458 | Ga0500646_0000390 | 3300053090 | Bacteria | 13179 |
| 459 | Ga0500650_0074422 | 3300053098 | Bacteria | 1588 |
| 460 | Ga0500593_000086 | 3300053117 | Bacteria | 33745 |
| 461 | Ga0500652_000940 | 3300053131 | Bacteria | 9635 |
| 462 | Ga0500604_0017031 | 3300053151 | Bacteria | 2006 |
| 463 | Ga0500619_000159 | 3300053154 | Bacteria | 16357 |
| 464 | Ga0501084_0117761 | 3300054114 | Bacteria | 2233 |
| 465 | Ga0501082_0001333 | 3300060353 | Bacteria | 21634 |
| 466 | Ga0501082_0548646 | 3300060353 | Bacteria | 1011 |
| 467 | Ga0466962_0084418 | 3300061719 | Bacteria | 1519 |
| 468 | Ga0530510_0762317 | 3300061734 | Bacteria | 738 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035724 | Ga0373933_0710941 | Ga0373933_0710941_40_636 | 197 |
| 2 | 3300047317 | Ga0495604_0149970 | Ga0495604_0149970_38_634 | 197 |
| 3 | 3300048922 | Ga0496119_0395429 | Ga0496119_0395429_20_613 | 197 |
| 4 | iso_pu_bacteria | 2506520007 | 2506580851 | 227 |
| 5 | iso_pu_bacteria | 2506520008 | 2506585990 | 227 |
| 6 | iso_pu_bacteria | 2508501071 | 2508854658 | 227 |
| 7 | iso_pu_bacteria | 2654587920 | 2656276691 | 227 |
| 8 | iso_pu_bacteria | 2687453601 | 2689447407 | 227 |
| 9 | iso_pu_bacteria | 2806310673 | 2807180284 | 227 |
| 10 | iso_pu_bacteria | 2808606414 | 2809126712 | 227 |
| 11 | iso_pu_bacteria | 2852103415 | 2852106794 | 227 |
| 12 | iso_pu_bacteria | 2876601092 | 2876602550 | 227 |
| 13 | iso_pu_bacteria | 2888366609 | 2888371339 | 227 |
| 14 | iso_pu_bacteria | 2904504865 | 2904508255 | 227 |
| 15 | iso_pu_bacteria | 2932406140 | 2932409350 | 227 |
| 16 | iso_pu_bacteria | 2939577877 | 2939581145 | 227 |
| 17 | iso_pu_bacteria | 640753048 | 640940219 | 227 |
| 18 | iso_pu_bacteria | 8004592986 | 8004593995 | 227 |
| 19 | iso_pu_bacteria | 8015394850 | 8015395174 | 227 |
| 20 | iso_pu_bacteria | 8016733728 | 8016737605 | 227 |
| 21 | iso_pu_bacteria | 8019499862 | 8019504231 | 227 |
| 22 | 3300003320 | rootH2_10005386 | rootH2_100053866 | 228 |
| 23 | iso_pu_bacteria | 2889415604 | 2889418479 | 228 |
| 24 | 3300005338 | Ga0068868_100211494 | Ga0068868_1002114942 | 230 |
| 25 | 3300005340 | Ga0070689_100205843 | Ga0070689_1002058432 | 230 |
| 26 | 3300005340 | Ga0070689_100737482 | Ga0070689_1007374821 | 230 |
| 27 | 3300005354 | Ga0070675_100017058 | Ga0070675_1000170585 | 230 |
| 28 | 3300005364 | Ga0070673_100494504 | Ga0070673_1004945042 | 230 |
| 29 | 3300005365 | Ga0070688_100206852 | Ga0070688_1002068522 | 230 |
| 30 | 3300005438 | Ga0070701_10305403 | Ga0070701_103054032 | 230 |
| 31 | 3300005441 | Ga0070700_100014470 | Ga0070700_1000144704 | 230 |
| 32 | 3300005459 | Ga0068867_100248830 | Ga0068867_1002488302 | 230 |
| 33 | 3300005615 | Ga0070702_100038397 | Ga0070702_1000383972 | 230 |
| 34 | 3300005617 | Ga0068859_101092046 | Ga0068859_1010920461 | 230 |
| 35 | 3300005719 | Ga0068861_100192116 | Ga0068861_1001921162 | 230 |
| 36 | 3300005844 | Ga0068862_100266416 | Ga0068862_1002664162 | 230 |
| 37 | 3300006852 | Ga0075433_10500195 | Ga0075433_105001952 | 230 |
| 38 | 3300006871 | Ga0075434_100011032 | Ga0075434_1000110322 | 230 |
| 39 | 3300006931 | Ga0097620_101092051 | Ga0097620_1010920511 | 230 |
| 40 | 3300007076 | Ga0075435_100132387 | Ga0075435_1001323871 | 230 |
| 41 | 3300009094 | Ga0111539_10029811 | Ga0111539_100298112 | 230 |
| 42 | 3300009094 | Ga0111539_10226420 | Ga0111539_102264202 | 230 |
| 43 | 3300025907 | Ga0207645_10026933 | Ga0207645_100269332 | 230 |
| 44 | 3300025926 | Ga0207659_10072424 | Ga0207659_100724242 | 230 |
| 45 | 3300025936 | Ga0207670_10303116 | Ga0207670_103031162 | 230 |
| 46 | 3300025936 | Ga0207670_10444049 | Ga0207670_104440492 | 230 |
| 47 | 3300025942 | Ga0207689_10044295 | Ga0207689_100442954 | 230 |
| 48 | 3300026075 | Ga0207708_10427962 | Ga0207708_104279622 | 230 |
| 49 | 3300026118 | Ga0207675_100192107 | Ga0207675_1001921072 | 230 |
| 50 | 3300026121 | Ga0207683_10115027 | Ga0207683_101150274 | 230 |
| 51 | 3300027360 | Ga0209969_1003492 | Ga0209969_10034923 | 230 |
| 52 | 3300027462 | Ga0210000_1010958 | Ga0210000_10109582 | 230 |
| 53 | 3300027543 | Ga0209999_1004623 | Ga0209999_10046234 | 230 |
| 54 | 3300027907 | Ga0207428_10209995 | Ga0207428_102099952 | 230 |
| 55 | 3300035410 | Ga0373924_0078428 | Ga0373924_0078428_472_1164 | 230 |
| 56 | 3300035691 | Ga0373931_0219763 | Ga0373931_0219763_408_1100 | 230 |
| 57 | 3300042125 | Ga0450923_019625 | Ga0450923_019625_454_1146 | 230 |
| 58 | 3300044683 | Ga0466965_0128606 | Ga0466965_0128606_118_810 | 230 |
| 59 | 3300045051 | Ga0451576_0422758 | Ga0451576_0422758_543_1235 | 230 |
| 60 | 3300046454 | Ga0495592_0001600 | Ga0495592_0001600_788_1480 | 230 |
| 61 | 3300046473 | Ga0495582_0135587 | Ga0495582_0135587_35_727 | 230 |
| 62 | 3300046476 | Ga0495662_0005281 | Ga0495662_0005281_5734_6426 | 230 |
| 63 | 3300046511 | Ga0495608_0000167 | Ga0495608_0000167_29581_30273 | 230 |
| 64 | 3300046516 | Ga0495628_0003674 | Ga0495628_0003674_12680_13372 | 230 |
| 65 | 3300046517 | Ga0495630_0001186 | Ga0495630_0001186_14748_15440 | 230 |
| 66 | 3300046533 | Ga0495640_0000309 | Ga0495640_0000309_14623_15315 | 230 |
| 67 | 3300046535 | Ga0495586_0000827 | Ga0495586_0000827_2852_3544 | 230 |
| 68 | 3300046536 | Ga0495587_0050723 | Ga0495587_0050723_736_1428 | 230 |
| 69 | 3300046559 | Ga0495667_0027587 | Ga0495667_0027587_1852_2544 | 230 |
| 70 | 3300046642 | Ga0495634_0005562 | Ga0495634_0005562_2258_2950 | 230 |
| 71 | 3300046663 | Ga0495635_0315090 | Ga0495635_0315090_210_902 | 230 |
| 72 | 3300046678 | Ga0495599_0002399 | Ga0495599_0002399_9894_10586 | 230 |
| 73 | 3300046680 | Ga0495646_0308155 | Ga0495646_0308155_90_782 | 230 |
| 74 | 3300046683 | Ga0495658_0004579 | Ga0495658_0004579_3162_3854 | 230 |
| 75 | 3300046689 | Ga0495613_0002922 | Ga0495613_0002922_636_1328 | 230 |
| 76 | 3300046690 | Ga0495624_0013677 | Ga0495624_0013677_1067_1759 | 230 |
| 77 | 3300047317 | Ga0495604_0002023 | Ga0495604_0002023_3176_3868 | 230 |
| 78 | 3300047322 | Ga0495680_0001124 | Ga0495680_0001124_18339_19031 | 230 |
| 79 | 3300049577 | Ga0501041_0008810 | Ga0501041_0008810_3907_4599 | 230 |
| 80 | 3300049582 | Ga0501048_0145106 | Ga0501048_0145106_487_1179 | 230 |
| 81 | 3300049592 | Ga0501076_0070188 | Ga0501076_0070188_597_1289 | 230 |
| 82 | 3300049741 | Ga0501079_0162032 | Ga0501079_0162032_33_725 | 230 |
| 83 | 3300050511 | nmdc:mga08y16_426710_c1 | nmdc:mga08y16_426710_c1_252_944 | 230 |
| 84 | 3300050511 | nmdc:mga08y16_88231_c1 | nmdc:mga08y16_88231_c1_1820_2512 | 230 |
| 85 | 3300050512 | nmdc:mga0n895_10479_c1 | nmdc:mga0n895_10479_c1_2280_2972 | 230 |
| 86 | 3300050515 | nmdc:mga0a205_212894_c1 | nmdc:mga0a205_212894_c1_463_1155 | 230 |
| 87 | 3300060353 | Ga0501082_0548646 | Ga0501082_0548646_243_935 | 230 |
| 88 | iso_pu_bacteria | 8002869464 | 8002872584 | 230 |
| 89 | 3300001989 | JGI24739J22299_10000107 | JGI24739J22299_100001076 | 231 |
| 90 | 3300002737 | JGI25162J39368_1000007 | JGI25162J39368_1000007238 | 231 |
| 91 | 3300005272 | Ga0065703_1020638 | Ga0065703_10206382 | 231 |
| 92 | 3300005345 | Ga0070692_10025021 | Ga0070692_100250213 | 231 |
| 93 | 3300005435 | Ga0070714_100001772 | Ga0070714_1000017724 | 231 |
| 94 | 3300005435 | Ga0070714_100015965 | Ga0070714_1000159652 | 231 |
| 95 | 3300005440 | Ga0070705_100054401 | Ga0070705_1000544013 | 231 |
| 96 | 3300005444 | Ga0070694_100023136 | Ga0070694_1000231362 | 231 |
| 97 | 3300005545 | Ga0070695_100259892 | Ga0070695_1002598922 | 231 |
| 98 | 3300005549 | Ga0070704_100081562 | Ga0070704_1000815622 | 231 |
| 99 | 3300005718 | Ga0068866_10376516 | Ga0068866_103765161 | 231 |
| 100 | 3300006051 | Ga0075364_10101648 | Ga0075364_101016481 | 231 |
| 101 | 3300006844 | Ga0075428_100223646 | Ga0075428_1002236462 | 231 |
| 102 | 3300006852 | Ga0075433_10019821 | Ga0075433_100198212 | 231 |
| 103 | 3300006914 | Ga0075436_100017307 | Ga0075436_1000173075 | 231 |
| 104 | 3300006946 | Ga0079104_1002497 | Ga0079104_10024972 | 231 |
| 105 | 3300009011 | Ga0105251_10000230 | Ga0105251_100002306 | 231 |
| 106 | 3300009011 | Ga0105251_10000233 | Ga0105251_1000023312 | 231 |
| 107 | 3300009011 | Ga0105251_10010612 | Ga0105251_100106125 | 231 |
| 108 | 3300009011 | Ga0105251_10016472 | Ga0105251_100164723 | 231 |
| 109 | 3300009036 | Ga0105244_10001361 | Ga0105244_100013613 | 231 |
| 110 | 3300009092 | Ga0105250_10000020 | Ga0105250_1000002055 | 231 |
| 111 | 3300009092 | Ga0105250_10008877 | Ga0105250_100088774 | 231 |
| 112 | 3300009101 | Ga0105247_10000396 | Ga0105247_100003962 | 231 |
| 113 | 3300009174 | Ga0105241_10000013 | Ga0105241_1000001360 | 231 |
| 114 | 3300011119 | Ga0105246_10019180 | Ga0105246_100191802 | 231 |
| 115 | 3300013100 | Ga0157373_10000081 | Ga0157373_1000008161 | 231 |
| 116 | 3300013100 | Ga0157373_10004744 | Ga0157373_100047448 | 231 |
| 117 | 3300013102 | Ga0157371_10003054 | Ga0157371_1000305410 | 231 |
| 118 | 3300013306 | Ga0163162_10084587 | Ga0163162_100845872 | 231 |
| 119 | 3300014497 | Ga0182008_10008294 | Ga0182008_100082944 | 231 |
| 120 | 3300015261 | Ga0182006_1042856 | Ga0182006_10428563 | 231 |
| 121 | 3300017792 | Ga0163161_10000028 | Ga0163161_1000002889 | 231 |
| 122 | 3300025711 | Ga0207696_1000036 | Ga0207696_1000036101 | 231 |
| 123 | 3300025711 | Ga0207696_1000068 | Ga0207696_1000068111 | 231 |
| 124 | 3300025711 | Ga0207696_1000557 | Ga0207696_10005578 | 231 |
| 125 | 3300025728 | Ga0207655_1000106 | Ga0207655_100010657 | 231 |
| 126 | 3300025728 | Ga0207655_1030501 | Ga0207655_10305011 | 231 |
| 127 | 3300025735 | Ga0207713_1000044 | Ga0207713_1000044128 | 231 |
| 128 | 3300025735 | Ga0207713_1000062 | Ga0207713_100006290 | 231 |
| 129 | 3300025735 | Ga0207713_1006491 | Ga0207713_10064917 | 231 |
| 130 | 3300025735 | Ga0207713_1007196 | Ga0207713_10071965 | 231 |
| 131 | 3300025900 | Ga0207710_10000145 | Ga0207710_1000014579 | 231 |
| 132 | 3300025911 | Ga0207654_10000016 | Ga0207654_1000001691 | 231 |
| 133 | 3300025928 | Ga0207700_10261199 | Ga0207700_102611993 | 231 |
| 134 | 3300025929 | Ga0207664_10007528 | Ga0207664_100075289 | 231 |
| 135 | 3300025929 | Ga0207664_10907730 | Ga0207664_109077301 | 231 |
| 136 | 3300026142 | Ga0207698_10111234 | Ga0207698_101112344 | 231 |
| 137 | 3300027111 | Ga0209281_1000107 | Ga0209281_100010791 | 231 |
| 138 | 3300028558 | Ga0265326_10031321 | Ga0265326_100313213 | 231 |
| 139 | 3300028573 | Ga0265334_10000017 | Ga0265334_1000001724 | 231 |
| 140 | 3300028800 | Ga0265338_10026656 | Ga0265338_100266566 | 231 |
| 141 | 3300031595 | Ga0265313_10000022 | Ga0265313_1000002250 | 231 |
| 142 | 3300031595 | Ga0265313_10077584 | Ga0265313_100775842 | 231 |
| 143 | 3300032002 | Ga0307416_100225071 | Ga0307416_1002250713 | 231 |
| 144 | 3300034816 | Ga0373930_0070381 | Ga0373930_0070381_90_785 | 231 |
| 145 | 3300035112 | Ga0373932_0054421 | Ga0373932_0054421_431_1126 | 231 |
| 146 | 3300035115 | Ga0373941_0151685 | Ga0373941_0151685_68_763 | 231 |
| 147 | 3300035691 | Ga0373931_0215207 | Ga0373931_0215207_331_1026 | 231 |
| 148 | 3300041411 | Ga0439466_0019916 | Ga0439466_0019916_33_728 | 231 |
| 149 | 3300041486 | Ga0451807_2384151 | Ga0451807_2384151_123_818 | 231 |
| 150 | 3300042876 | Ga0451577_0531029 | Ga0451577_0531029_148_843 | 231 |
| 151 | 3300046453 | Ga0495627_000100 | Ga0495627_000100_158_853 | 231 |
| 152 | 3300046517 | Ga0495630_0093027 | Ga0495630_0093027_1107_1802 | 231 |
| 153 | 3300046530 | Ga0495654_0000616 | Ga0495654_0000616_5912_6607 | 231 |
| 154 | 3300046679 | Ga0495623_0008104 | Ga0495623_0008104_723_1421 | 231 |
| 155 | 3300046684 | Ga0495669_0007483 | Ga0495669_0007483_633_1328 | 231 |
| 156 | 3300046794 | Ga0495589_0000010 | Ga0495589_0000010_134711_135406 | 231 |
| 157 | 3300047444 | Ga0495675_0032298 | Ga0495675_0032298_575_1273 | 231 |
| 158 | 3300047471 | Ga0495684_0002525 | Ga0495684_0002525_6832_7530 | 231 |
| 159 | 3300048088 | Ga0495602_0017644 | Ga0495602_0017644_624_1322 | 231 |
| 160 | 3300048903 | Ga0496100_0145498 | Ga0496100_0145498_192_887 | 231 |
| 161 | 3300048904 | Ga0496101_0000053 | Ga0496101_0000053_79150_79845 | 231 |
| 162 | 3300048912 | Ga0496109_0766254 | Ga0496109_0766254_166_861 | 231 |
| 163 | 3300048919 | Ga0496116_0000077 | Ga0496116_0000077_120127_120822 | 231 |
| 164 | 3300048920 | Ga0496117_0002611 | Ga0496117_0002611_11602_12297 | 231 |
| 165 | 3300048920 | Ga0496117_0254179 | Ga0496117_0254179_53_748 | 231 |
| 166 | 3300048921 | Ga0496118_0008371 | Ga0496118_0008371_4566_5261 | 231 |
| 167 | 3300048921 | Ga0496118_0055479 | Ga0496118_0055479_1670_2365 | 231 |
| 168 | 3300048922 | Ga0496119_0001653 | Ga0496119_0001653_11586_12281 | 231 |
| 169 | 3300048922 | Ga0496119_0010401 | Ga0496119_0010401_2567_3262 | 231 |
| 170 | 3300048923 | Ga0496120_0000139 | Ga0496120_0000139_69934_70629 | 231 |
| 171 | 3300048923 | Ga0496120_0001587 | Ga0496120_0001587_15325_16020 | 231 |
| 172 | 3300048925 | Ga0496122_0007780 | Ga0496122_0007780_6870_7565 | 231 |
| 173 | 3300048926 | Ga0496123_0003349 | Ga0496123_0003349_12475_13170 | 231 |
| 174 | 3300048927 | Ga0496124_0000100 | Ga0496124_0000100_106422_107117 | 231 |
| 175 | 3300048927 | Ga0496124_0019885 | Ga0496124_0019885_1567_2262 | 231 |
| 176 | 3300049824 | Ga0501045_0098628 | Ga0501045_0098628_1172_1867 | 231 |
| 177 | 3300050491 | nmdc:mga00v17_55345_c1 | nmdc:mga00v17_55345_c1_746_1441 | 231 |
| 178 | 3300050510 | nmdc:mga06r32_454698_c1 | nmdc:mga06r32_454698_c1_510_1205 | 231 |
| 179 | 3300050513 | nmdc:mga0rr50_11608_c1 | nmdc:mga0rr50_11608_c1_1762_2457 | 231 |
| 180 | 3300050514 | nmdc:mga08x19_10704_c2 | nmdc:mga08x19_10704_c2_2542_3237 | 231 |
| 181 | 3300050515 | nmdc:mga0a205_7368_c2 | nmdc:mga0a205_7368_c2_3479_4174 | 231 |
| 182 | iso_pu_bacteria | 2643221579 | 2643908690 | 231 |
| 183 | iso_pu_bacteria | 2643221581 | 2643916120 | 231 |
| 184 | iso_pu_bacteria | 2643221695 | 2644528932 | 231 |
| 185 | iso_pu_bacteria | 2895498888 | 2895501941 | 231 |
| 186 | iso_pu_bacteria | 2895511927 | 2895517107 | 231 |
| 187 | iso_pu_bacteria | 2895522137 | 2895524645 | 231 |
| 188 | iso_pu_bacteria | 2895525241 | 2895526241 | 231 |
| 189 | iso_pu_bacteria | 2923516293 | 2923517907 | 231 |
| 190 | 3300005338 | Ga0068868_100377429 | Ga0068868_1003774292 | 232 |
| 191 | 3300005343 | Ga0070687_100290753 | Ga0070687_1002907531 | 232 |
| 192 | 3300005353 | Ga0070669_100458231 | Ga0070669_1004582311 | 232 |
| 193 | 3300005355 | Ga0070671_100253818 | Ga0070671_1002538183 | 232 |
| 194 | 3300005364 | Ga0070673_100181525 | Ga0070673_1001815252 | 232 |
| 195 | 3300005467 | Ga0070706_100114912 | Ga0070706_1001149122 | 232 |
| 196 | 3300005468 | Ga0070707_100123106 | Ga0070707_1001231063 | 232 |
| 197 | 3300005471 | Ga0070698_100123876 | Ga0070698_1001238762 | 232 |
| 198 | 3300005518 | Ga0070699_100188003 | Ga0070699_1001880032 | 232 |
| 199 | 3300005536 | Ga0070697_100126708 | Ga0070697_1001267082 | 232 |
| 200 | 3300005548 | Ga0070665_100299227 | Ga0070665_1002992273 | 232 |
| 201 | 3300005549 | Ga0070704_100666488 | Ga0070704_1006664881 | 232 |
| 202 | 3300005841 | Ga0068863_100669760 | Ga0068863_1006697601 | 232 |
| 203 | 3300005985 | Ga0081539_10000496 | Ga0081539_1000049648 | 232 |
| 204 | 3300006186 | Ga0075369_10013066 | Ga0075369_100130662 | 232 |
| 205 | 3300006195 | Ga0075366_10101187 | Ga0075366_101011871 | 232 |
| 206 | 3300006844 | Ga0075428_100008331 | Ga0075428_1000083317 | 232 |
| 207 | 3300006847 | Ga0075431_100153423 | Ga0075431_1001534231 | 232 |
| 208 | 3300006852 | Ga0075433_10034636 | Ga0075433_100346364 | 232 |
| 209 | 3300006871 | Ga0075434_100131120 | Ga0075434_1001311202 | 232 |
| 210 | 3300006914 | Ga0075436_100000593 | Ga0075436_10000059322 | 232 |
| 211 | 3300006914 | Ga0075436_100006924 | Ga0075436_1000069246 | 232 |
| 212 | 3300006914 | Ga0075436_100016824 | Ga0075436_1000168245 | 232 |
| 213 | 3300006914 | Ga0075436_100212591 | Ga0075436_1002125912 | 232 |
| 214 | 3300007076 | Ga0075435_100073601 | Ga0075435_1000736011 | 232 |
| 215 | 3300007076 | Ga0075435_100573956 | Ga0075435_1005739562 | 232 |
| 216 | 3300007265 | Ga0099794_10016077 | Ga0099794_100160774 | 232 |
| 217 | 3300009094 | Ga0111539_10009312 | Ga0111539_100093129 | 232 |
| 218 | 3300009176 | Ga0105242_10014042 | Ga0105242_100140424 | 232 |
| 219 | 3300011119 | Ga0105246_10225459 | Ga0105246_102254591 | 232 |
| 220 | 3300013296 | Ga0157374_10672242 | Ga0157374_106722421 | 232 |
| 221 | 3300013297 | Ga0157378_10085314 | Ga0157378_100853144 | 232 |
| 222 | 3300014969 | Ga0157376_10425113 | Ga0157376_104251132 | 232 |
| 223 | 3300025912 | Ga0207707_10084896 | Ga0207707_100848963 | 232 |
| 224 | 3300025912 | Ga0207707_10501529 | Ga0207707_105015292 | 232 |
| 225 | 3300025922 | Ga0207646_10453780 | Ga0207646_104537802 | 232 |
| 226 | 3300025960 | Ga0207651_10232355 | Ga0207651_102323551 | 232 |
| 227 | 3300026023 | Ga0207677_10201775 | Ga0207677_102017751 | 232 |
| 228 | 3300026121 | Ga0207683_10162721 | Ga0207683_101627212 | 232 |
| 229 | 3300026142 | Ga0207698_10382077 | Ga0207698_103820771 | 232 |
| 230 | 3300027907 | Ga0207428_10034099 | Ga0207428_100340992 | 232 |
| 231 | 3300030521 | Ga0307511_10000108 | Ga0307511_1000010855 | 232 |
| 232 | 3300031852 | Ga0307410_10472055 | Ga0307410_104720551 | 232 |
| 233 | 3300032002 | Ga0307416_100022451 | Ga0307416_1000224514 | 232 |
| 234 | 3300032002 | Ga0307416_100068295 | Ga0307416_1000682952 | 232 |
| 235 | 3300033179 | Ga0307507_10025756 | Ga0307507_100257564 | 232 |
| 236 | 3300035086 | Ga0373934_0051832 | Ga0373934_0051832_910_1608 | 232 |
| 237 | 3300035398 | Ga0316574_0240123 | Ga0316574_0240123_226_924 | 232 |
| 238 | 3300035691 | Ga0373931_0089954 | Ga0373931_0089954_195_893 | 232 |
| 239 | 3300042876 | Ga0451577_0229986 | Ga0451577_0229986_529_1227 | 232 |
| 240 | 3300045051 | Ga0451576_0011469 | Ga0451576_0011469_574_1272 | 232 |
| 241 | 3300046471 | Ga0495650_0082873 | Ga0495650_0082873_407_1105 | 232 |
| 242 | 3300046515 | Ga0495620_0166566 | Ga0495620_0166566_67_765 | 232 |
| 243 | 3300047443 | Ga0495687_118020 | Ga0495687_118020_240_938 | 232 |
| 244 | 3300048912 | Ga0496109_0284617 | Ga0496109_0284617_124_822 | 232 |
| 245 | 3300048913 | Ga0496110_0667090 | Ga0496110_0667090_174_872 | 232 |
| 246 | 3300048924 | Ga0496121_0027154 | Ga0496121_0027154_683_1381 | 232 |
| 247 | 3300049569 | Ga0501032_0321361 | Ga0501032_0321361_257_955 | 232 |
| 248 | 3300049571 | Ga0501034_0057798 | Ga0501034_0057798_58_756 | 232 |
| 249 | 3300049571 | Ga0501034_0252256 | Ga0501034_0252256_894_1592 | 232 |
| 250 | 3300049572 | Ga0501036_0185158 | Ga0501036_0185158_665_1363 | 232 |
| 251 | 3300049573 | Ga0501037_0029800 | Ga0501037_0029800_2550_3248 | 232 |
| 252 | 3300049574 | Ga0501038_0228590 | Ga0501038_0228590_16_714 | 232 |
| 253 | 3300049575 | Ga0501039_0006328 | Ga0501039_0006328_3435_4133 | 232 |
| 254 | 3300049577 | Ga0501041_0040479 | Ga0501041_0040479_1648_2346 | 232 |
| 255 | 3300049579 | Ga0501043_0000038 | Ga0501043_0000038_12701_13399 | 232 |
| 256 | 3300049579 | Ga0501043_0107972 | Ga0501043_0107972_703_1401 | 232 |
| 257 | 3300049579 | Ga0501043_0138387 | Ga0501043_0138387_127_825 | 232 |
| 258 | 3300049580 | Ga0501046_0000049 | Ga0501046_0000049_115281_115979 | 232 |
| 259 | 3300049581 | Ga0501047_0000039 | Ga0501047_0000039_71894_72592 | 232 |
| 260 | 3300049581 | Ga0501047_0701068 | Ga0501047_0701068_111_809 | 232 |
| 261 | 3300049582 | Ga0501048_0002594 | Ga0501048_0002594_5892_6590 | 232 |
| 262 | 3300049584 | Ga0501068_0042549 | Ga0501068_0042549_75_773 | 232 |
| 263 | 3300049587 | Ga0501071_0082446 | Ga0501071_0082446_1049_1747 | 232 |
| 264 | 3300049588 | Ga0501072_0029736 | Ga0501072_0029736_1420_2118 | 232 |
| 265 | 3300049588 | Ga0501072_0038048 | Ga0501072_0038048_2832_3530 | 232 |
| 266 | 3300049591 | Ga0501075_0006548 | Ga0501075_0006548_4365_5063 | 232 |
| 267 | 3300049592 | Ga0501076_0002770 | Ga0501076_0002770_8874_9572 | 232 |
| 268 | 3300049593 | Ga0501077_0030345 | Ga0501077_0030345_1291_1989 | 232 |
| 269 | 3300049741 | Ga0501079_0000379 | Ga0501079_0000379_12220_12918 | 232 |
| 270 | 3300049742 | Ga0501080_0027036 | Ga0501080_0027036_399_1097 | 232 |
| 271 | 3300049743 | Ga0501081_0000033 | Ga0501081_0000033_18812_19510 | 232 |
| 272 | 3300049822 | Ga0501035_0046012 | Ga0501035_0046012_2706_3404 | 232 |
| 273 | 3300049823 | Ga0501044_0120444 | Ga0501044_0120444_867_1565 | 232 |
| 274 | 3300049824 | Ga0501045_0008121 | Ga0501045_0008121_2767_3465 | 232 |
| 275 | 3300049824 | Ga0501045_0262476 | Ga0501045_0262476_478_1176 | 232 |
| 276 | 3300050493 | nmdc:mga0k408_175428_c1 | nmdc:mga0k408_175428_c1_69_767 | 232 |
| 277 | 3300050510 | nmdc:mga06r32_151794_c1 | nmdc:mga06r32_151794_c1_944_1642 | 232 |
| 278 | 3300050514 | nmdc:mga08x19_1118_c1 | nmdc:mga08x19_1118_c1_5999_6697 | 232 |
| 279 | 3300050514 | nmdc:mga08x19_8586_c1 | nmdc:mga08x19_8586_c1_4759_5457 | 232 |
| 280 | 3300050515 | nmdc:mga0a205_72306_c1 | nmdc:mga0a205_72306_c1_60_758 | 232 |
| 281 | 3300053090 | Ga0500646_0000390 | Ga0500646_0000390_3167_3865 | 232 |
| 282 | 3300053098 | Ga0500650_0074422 | Ga0500650_0074422_728_1426 | 232 |
| 283 | 3300053151 | Ga0500604_0017031 | Ga0500604_0017031_599_1297 | 232 |
| 284 | 3300054114 | Ga0501084_0117761 | Ga0501084_0117761_474_1172 | 232 |
| 285 | 3300060353 | Ga0501082_0001333 | Ga0501082_0001333_3737_4435 | 232 |
| 286 | 3300061734 | Ga0530510_0762317 | Ga0530510_0762317_29_727 | 232 |
| 287 | 3300005340 | Ga0070689_100186592 | Ga0070689_1001865923 | 233 |
| 288 | 3300005439 | Ga0070711_100458889 | Ga0070711_1004588891 | 233 |
| 289 | 3300005444 | Ga0070694_100150111 | Ga0070694_1001501112 | 233 |
| 290 | 3300005455 | Ga0070663_100046329 | Ga0070663_1000463292 | 233 |
| 291 | 3300005457 | Ga0070662_100008279 | Ga0070662_1000082794 | 233 |
| 292 | 3300005530 | Ga0070679_100972066 | Ga0070679_1009720661 | 233 |
| 293 | 3300005545 | Ga0070695_100011088 | Ga0070695_1000110882 | 233 |
| 294 | 3300005618 | Ga0068864_100018648 | Ga0068864_1000186485 | 233 |
| 295 | 3300005719 | Ga0068861_100139227 | Ga0068861_1001392273 | 233 |
| 296 | 3300005843 | Ga0068860_100212677 | Ga0068860_1002126772 | 233 |
| 297 | 3300005844 | Ga0068862_100014628 | Ga0068862_1000146284 | 233 |
| 298 | 3300006038 | Ga0075365_10009131 | Ga0075365_100091313 | 233 |
| 299 | 3300006195 | Ga0075366_10004427 | Ga0075366_100044273 | 233 |
| 300 | 3300006195 | Ga0075366_10066176 | Ga0075366_100661763 | 233 |
| 301 | 3300006844 | Ga0075428_100000107 | Ga0075428_10000010732 | 233 |
| 302 | 3300006846 | Ga0075430_100069573 | Ga0075430_1000695733 | 233 |
| 303 | 3300006846 | Ga0075430_100101971 | Ga0075430_1001019712 | 233 |
| 304 | 3300006852 | Ga0075433_10002934 | Ga0075433_100029347 | 233 |
| 305 | 3300006871 | Ga0075434_100001090 | Ga0075434_10000109016 | 233 |
| 306 | 3300006880 | Ga0075429_100000317 | Ga0075429_10000031732 | 233 |
| 307 | 3300006880 | Ga0075429_100002952 | Ga0075429_1000029528 | 233 |
| 308 | 3300006914 | Ga0075436_100001604 | Ga0075436_10000160417 | 233 |
| 309 | 3300006914 | Ga0075436_100040125 | Ga0075436_1000401254 | 233 |
| 310 | 3300007076 | Ga0075435_100000229 | Ga0075435_10000022916 | 233 |
| 311 | 3300009094 | Ga0111539_10005775 | Ga0111539_1000577516 | 233 |
| 312 | 3300009094 | Ga0111539_10018067 | Ga0111539_100180678 | 233 |
| 313 | 3300009147 | Ga0114129_10001717 | Ga0114129_1000171716 | 233 |
| 314 | 3300009148 | Ga0105243_10235286 | Ga0105243_102352862 | 233 |
| 315 | 3300025905 | Ga0207685_10059237 | Ga0207685_100592372 | 233 |
| 316 | 3300025916 | Ga0207663_10416295 | Ga0207663_104162952 | 233 |
| 317 | 3300025917 | Ga0207660_10374426 | Ga0207660_103744262 | 233 |
| 318 | 3300025935 | Ga0207709_10093129 | Ga0207709_100931292 | 233 |
| 319 | 3300025961 | Ga0207712_10360919 | Ga0207712_103609192 | 233 |
| 320 | 3300026067 | Ga0207678_10034038 | Ga0207678_100340382 | 233 |
| 321 | 3300026078 | Ga0207702_10076220 | Ga0207702_100762203 | 233 |
| 322 | 3300026088 | Ga0207641_10163450 | Ga0207641_101634503 | 233 |
| 323 | 3300026095 | Ga0207676_10030973 | Ga0207676_100309732 | 233 |
| 324 | 3300026118 | Ga0207675_100158730 | Ga0207675_1001587302 | 233 |
| 325 | 3300027671 | Ga0209588_1049292 | Ga0209588_10492922 | 233 |
| 326 | 3300027907 | Ga0207428_10000179 | Ga0207428_1000017972 | 233 |
| 327 | 3300027907 | Ga0207428_10020477 | Ga0207428_100204773 | 233 |
| 328 | 3300028381 | Ga0268264_10156428 | Ga0268264_101564282 | 233 |
| 329 | 3300031730 | Ga0307516_10311996 | Ga0307516_103119961 | 233 |
| 330 | 3300031852 | Ga0307410_10530965 | Ga0307410_105309651 | 233 |
| 331 | 3300031995 | Ga0307409_100263865 | Ga0307409_1002638652 | 233 |
| 332 | 3300035083 | Ga0373926_0008847 | Ga0373926_0008847_2107_2808 | 233 |
| 333 | 3300035113 | Ga0373936_0024942 | Ga0373936_0024942_641_1342 | 233 |
| 334 | 3300035116 | Ga0373945_0005768 | Ga0373945_0005768_611_1312 | 233 |
| 335 | 3300035170 | Ga0373943_0062728 | Ga0373943_0062728_211_912 | 233 |
| 336 | 3300035171 | Ga0373946_0036820 | Ga0373946_0036820_1139_1840 | 233 |
| 337 | 3300035692 | Ga0373935_0036322 | Ga0373935_0036322_1609_2310 | 233 |
| 338 | 3300035695 | Ga0373927_0009707 | Ga0373927_0009707_3949_4650 | 233 |
| 339 | 3300035725 | Ga0373947_0075888 | Ga0373947_0075888_1217_1918 | 233 |
| 340 | 3300037068 | Ga0373925_0015285 | Ga0373925_0015285_898_1599 | 233 |
| 341 | 3300039447 | Ga0436361_1102119 | Ga0436361_1102119_705_1406 | 233 |
| 342 | 3300042133 | Ga0450896_020740 | Ga0450896_020740_108_809 | 233 |
| 343 | 3300042876 | Ga0451577_0015419 | Ga0451577_0015419_2049_2750 | 233 |
| 344 | 3300045051 | Ga0451576_0003504 | Ga0451576_0003504_11329_12030 | 233 |
| 345 | 3300046455 | Ga0495603_0117204 | Ga0495603_0117204_410_1111 | 233 |
| 346 | 3300046472 | Ga0495580_0000780 | Ga0495580_0000780_9051_9752 | 233 |
| 347 | 3300046473 | Ga0495582_0018378 | Ga0495582_0018378_2290_2991 | 233 |
| 348 | 3300046526 | Ga0495666_0038565 | Ga0495666_0038565_182_883 | 233 |
| 349 | 3300046535 | Ga0495586_0004233 | Ga0495586_0004233_1198_1899 | 233 |
| 350 | 3300046674 | Ga0495588_0023299 | Ga0495588_0023299_2222_2923 | 233 |
| 351 | 3300046681 | Ga0495647_0001167 | Ga0495647_0001167_1943_2644 | 233 |
| 352 | 3300046683 | Ga0495658_0023702 | Ga0495658_0023702_966_1667 | 233 |
| 353 | 3300047318 | Ga0495636_0008379 | Ga0495636_0008379_2560_3261 | 233 |
| 354 | 3300047321 | Ga0495676_0040690 | Ga0495676_0040690_2441_3142 | 233 |
| 355 | 3300048905 | Ga0496102_0028701 | Ga0496102_0028701_382_1083 | 233 |
| 356 | 3300049129 | Ga0501309_018677 | Ga0501309_018677_185_886 | 233 |
| 357 | 3300049161 | Ga0501305_025098 | Ga0501305_025098_102_803 | 233 |
| 358 | 3300049529 | Ga0501313_016454 | Ga0501313_016454_101_802 | 233 |
| 359 | 3300049592 | Ga0501076_0177336 | Ga0501076_0177336_347_1048 | 233 |
| 360 | 3300049824 | Ga0501045_0232574 | Ga0501045_0232574_639_1340 | 233 |
| 361 | 3300050492 | nmdc:mga0yw44_22891_c1 | nmdc:mga0yw44_22891_c1_446_1147 | 233 |
| 362 | 3300050493 | nmdc:mga0k408_7176_c1 | nmdc:mga0k408_7176_c1_2412_3113 | 233 |
| 363 | 3300050507 | nmdc:mga05p37_1373_c1 | nmdc:mga05p37_1373_c1_26811_27512 | 233 |
| 364 | 3300050508 | nmdc:mga09592_369_c1 | nmdc:mga09592_369_c1_5669_6370 | 233 |
| 365 | 3300050509 | nmdc:mga0qj67_78908_c1 | nmdc:mga0qj67_78908_c1_748_1449 | 233 |
| 366 | 3300050511 | nmdc:mga08y16_2408_c2 | nmdc:mga08y16_2408_c2_7225_7926 | 233 |
| 367 | 3300050511 | nmdc:mga08y16_3865_c1 | nmdc:mga08y16_3865_c1_5737_6438 | 233 |
| 368 | 3300050512 | nmdc:mga0n895_272_c1 | nmdc:mga0n895_272_c1_23109_23810 | 233 |
| 369 | 3300050513 | nmdc:mga0rr50_65_c1 | nmdc:mga0rr50_65_c1_26489_27190 | 233 |
| 370 | 3300050514 | nmdc:mga08x19_1138_c1 | nmdc:mga08x19_1138_c1_9790_10491 | 233 |
| 371 | 3300050514 | nmdc:mga08x19_18797_c1 | nmdc:mga08x19_18797_c1_1088_1789 | 233 |
| 372 | 3300050515 | nmdc:mga0a205_38_c1 | nmdc:mga0a205_38_c1_43997_44698 | 233 |
| 373 | 3300050516 | nmdc:mga0sz30_102402_c1 | nmdc:mga0sz30_102402_c1_36_737 | 233 |
| 374 | 3300053117 | Ga0500593_000086 | Ga0500593_000086_3991_4692 | 233 |
| 375 | 3300053131 | Ga0500652_000940 | Ga0500652_000940_5660_6361 | 233 |
| 376 | 3300053154 | Ga0500619_000159 | Ga0500619_000159_14709_15410 | 233 |
| 377 | 3300005530 | Ga0070679_100239762 | Ga0070679_1002397622 | 234 |
| 378 | 3300005535 | Ga0070684_100048049 | Ga0070684_1000480494 | 234 |
| 379 | 3300005536 | Ga0070697_100002781 | Ga0070697_1000027811 | 234 |
| 380 | 3300005544 | Ga0070686_100008505 | Ga0070686_1000085056 | 234 |
| 381 | 3300005547 | Ga0070693_100004415 | Ga0070693_1000044153 | 234 |
| 382 | 3300005547 | Ga0070693_100120740 | Ga0070693_1001207402 | 234 |
| 383 | 3300006051 | Ga0075364_10000071 | Ga0075364_1000007110 | 234 |
| 384 | 3300006237 | Ga0097621_100001351 | Ga0097621_10000135112 | 234 |
| 385 | 3300006871 | Ga0075434_100480903 | Ga0075434_1004809032 | 234 |
| 386 | 3300007076 | Ga0075435_100757542 | Ga0075435_1007575421 | 234 |
| 387 | 3300009984 | Ga0105029_102780 | Ga0105029_1027802 | 234 |
| 388 | 3300009993 | Ga0105028_104845 | Ga0105028_1048452 | 234 |
| 389 | 3300025304 | Ga0209257_1000170 | Ga0209257_100017038 | 234 |
| 390 | 3300026035 | Ga0207703_10451565 | Ga0207703_104515652 | 234 |
| 391 | 3300026116 | Ga0207674_10794722 | Ga0207674_107947222 | 234 |
| 392 | 3300027360 | Ga0209969_1004338 | Ga0209969_10043383 | 234 |
| 393 | 3300027364 | Ga0209967_1001392 | Ga0209967_10013925 | 234 |
| 394 | 3300027378 | Ga0209981_1001824 | Ga0209981_10018243 | 234 |
| 395 | 3300027462 | Ga0210000_1002695 | Ga0210000_10026952 | 234 |
| 396 | 3300027471 | Ga0209995_1002834 | Ga0209995_10028344 | 234 |
| 397 | 3300027543 | Ga0209999_1002191 | Ga0209999_10021914 | 234 |
| 398 | 3300031456 | Ga0307513_10053910 | Ga0307513_100539102 | 234 |
| 399 | 3300031456 | Ga0307513_10187057 | Ga0307513_101870572 | 234 |
| 400 | 3300032004 | Ga0307414_10003843 | Ga0307414_100038435 | 234 |
| 401 | 3300032004 | Ga0307414_10285570 | Ga0307414_102855702 | 234 |
| 402 | 3300035114 | Ga0373939_0003944 | Ga0373939_0003944_1437_2141 | 234 |
| 403 | 3300035115 | Ga0373941_0008262 | Ga0373941_0008262_1552_2259 | 234 |
| 404 | 3300035121 | Ga0373960_0058190 | Ga0373960_0058190_42_746 | 234 |
| 405 | 3300035207 | Ga0373942_0029070 | Ga0373942_0029070_138_845 | 234 |
| 406 | 3300035241 | Ga0373961_0139058 | Ga0373961_0139058_85_789 | 234 |
| 407 | 3300035242 | Ga0373962_0035700 | Ga0373962_0035700_314_1018 | 234 |
| 408 | 3300035691 | Ga0373931_0010935 | Ga0373931_0010935_2831_3535 | 234 |
| 409 | 3300035691 | Ga0373931_0025228 | Ga0373931_0025228_2025_2732 | 234 |
| 410 | 3300039145 | Ga0237816_02012 | Ga0237816_02012_641_1345 | 234 |
| 411 | 3300041404 | Ga0439436_0036455 | Ga0439436_0036455_10_714 | 234 |
| 412 | 3300041411 | Ga0439466_0122546 | Ga0439466_0122546_72_776 | 234 |
| 413 | 3300041413 | Ga0439465_0001020 | Ga0439465_0001020_3346_4050 | 234 |
| 414 | 3300041451 | Ga0451791_0606939 | Ga0451791_0606939_227_931 | 234 |
| 415 | 3300041452 | Ga0451793_1630383 | Ga0451793_1630383_180_884 | 234 |
| 416 | 3300041453 | Ga0451797_1003378 | Ga0451797_1003378_1350_2054 | 234 |
| 417 | 3300041460 | Ga0451802_0724729 | Ga0451802_0724729_108_812 | 234 |
| 418 | 3300041486 | Ga0451807_2152295 | Ga0451807_2152295_1661_2365 | 234 |
| 419 | 3300041997 | Ga0439431_0004092 | Ga0439431_0004092_1362_2066 | 234 |
| 420 | 3300042004 | Ga0439445_0003943 | Ga0439445_0003943_378_1082 | 234 |
| 421 | 3300042004 | Ga0439445_0016603 | Ga0439445_0016603_560_1264 | 234 |
| 422 | 3300042007 | Ga0439449_0000018 | Ga0439449_0000018_40476_41180 | 234 |
| 423 | 3300042007 | Ga0439449_0008520 | Ga0439449_0008520_146_850 | 234 |
| 424 | 3300044656 | Ga0466969_0005519 | Ga0466969_0005519_1336_2043 | 234 |
| 425 | 3300044683 | Ga0466965_0006319 | Ga0466965_0006319_374_1078 | 234 |
| 426 | 3300044684 | Ga0466966_0025545 | Ga0466966_0025545_612_1319 | 234 |
| 427 | 3300044684 | Ga0466966_0276921 | Ga0466966_0276921_31_735 | 234 |
| 428 | 3300044693 | Ga0466961_0000186 | Ga0466961_0000186_4689_5393 | 234 |
| 429 | 3300044719 | Ga0466971_0057905 | Ga0466971_0057905_856_1563 | 234 |
| 430 | 3300045049 | Ga0466959_0000908 | Ga0466959_0000908_6521_7225 | 234 |
| 431 | 3300045051 | Ga0451576_0080843 | Ga0451576_0080843_1500_2204 | 234 |
| 432 | 3300046522 | Ga0495643_0238755 | Ga0495643_0238755_61_765 | 234 |
| 433 | 3300046525 | Ga0495663_0011477 | Ga0495663_0011477_805_1509 | 234 |
| 434 | 3300046660 | Ga0495625_0094104 | Ga0495625_0094104_75_779 | 234 |
| 435 | 3300046692 | Ga0495671_0007619 | Ga0495671_0007619_2406_3110 | 234 |
| 436 | 3300048925 | Ga0496122_0058846 | Ga0496122_0058846_48_752 | 234 |
| 437 | 3300048926 | Ga0496123_0064399 | Ga0496123_0064399_49_753 | 234 |
| 438 | 3300049705 | Ga0501225_0011654 | Ga0501225_0011654_72_776 | 234 |
| 439 | 3300050491 | nmdc:mga00v17_770_c1 | nmdc:mga00v17_770_c1_10726_11430 | 234 |
| 440 | 3300050509 | nmdc:mga0qj67_329177_c1 | nmdc:mga0qj67_329177_c1_317_1024 | 234 |
| 441 | 3300050513 | nmdc:mga0rr50_730685_c1 | nmdc:mga0rr50_730685_c1_120_824 | 234 |
| 442 | 3300061719 | Ga0466962_0084418 | Ga0466962_0084418_734_1441 | 234 |
| 443 | 3300003781 | Ga0055536_1001684 | Ga0055536_100168411 | 235 |
| 444 | 3300005289 | Ga0065704_10070919 | Ga0065704_1007091917 | 235 |
| 445 | 3300005530 | Ga0070679_100026952 | Ga0070679_1000269525 | 235 |
| 446 | 3300005546 | Ga0070696_100269404 | Ga0070696_1002694042 | 235 |
| 447 | 3300005547 | Ga0070693_100299893 | Ga0070693_1002998931 | 235 |
| 448 | 3300013307 | Ga0157372_10050434 | Ga0157372_100504343 | 235 |
| 449 | 3300025292 | Ga0209676_1000024 | Ga0209676_1000024335 | 235 |
| 450 | 3300025912 | Ga0207707_10013310 | Ga0207707_100133107 | 235 |
| 451 | 3300025921 | Ga0207652_10149805 | Ga0207652_101498052 | 235 |
| 452 | 3300031548 | Ga0307408_100486867 | Ga0307408_1004868672 | 235 |
| 453 | 3300031824 | Ga0307413_10065057 | Ga0307413_100650572 | 235 |
| 454 | 3300031901 | Ga0307406_10182256 | Ga0307406_101822561 | 235 |
| 455 | 3300031995 | Ga0307409_100269574 | Ga0307409_1002695742 | 235 |
| 456 | 3300031995 | Ga0307409_100287702 | Ga0307409_1002877022 | 235 |
| 457 | 3300032002 | Ga0307416_100395218 | Ga0307416_1003952182 | 235 |
| 458 | 3300032004 | Ga0307414_10505464 | Ga0307414_105054641 | 235 |
| 459 | 3300032004 | Ga0307414_10832818 | Ga0307414_108328181 | 235 |
| 460 | 3300032004 | Ga0307414_10847184 | Ga0307414_108471841 | 235 |
| 461 | 3300032126 | Ga0307415_100112153 | Ga0307415_1001121533 | 235 |
| 462 | 3300037312 | Ga0395899_0170380 | Ga0395899_0170380_83_793 | 235 |
| 463 | 3300037466 | Ga0395898_0346624 | Ga0395898_0346624_52_762 | 235 |
| 464 | 3300041413 | Ga0439465_0021577 | Ga0439465_0021577_1259_1966 | 235 |
| 465 | 3300041494 | Ga0451837_0571131 | Ga0451837_0571131_1124_1831 | 235 |
| 466 | 3300041509 | Ga0451843_0662141 | Ga0451843_0662141_323_1030 | 235 |
| 467 | 3300042006 | Ga0439432_011274 | Ga0439432_011274_124_837 | 235 |
| 468 | 3300042007 | Ga0439449_0009369 | Ga0439449_0009369_829_1551 | 235 |
| 469 | 3300042007 | Ga0439449_0018214 | Ga0439449_0018214_1171_1878 | 235 |
| 470 | 3300042876 | Ga0451577_0030922 | Ga0451577_0030922_2682_3389 | 235 |
| 471 | 3300044712 | Ga0453684_0001838 | Ga0453684_0001838_30195_30911 | 235 |
| 472 | 3300044712 | Ga0453684_0577436 | Ga0453684_0577436_193_909 | 235 |
| 473 | 3300044712 | Ga0453684_0882040 | Ga0453684_0882040_54_761 | 235 |
| 474 | 3300045051 | Ga0451576_0098067 | Ga0451576_0098067_2127_2843 | 235 |
| 475 | 3300049513 | Ga0501290_000646 | Ga0501290_000646_3882_4589 | 235 |
| 476 | 3300049523 | Ga0501300_010037 | Ga0501300_010037_61_768 | 235 |
| 477 | 3300049531 | Ga0501315_006877 | Ga0501315_006877_550_1263 | 235 |
| 478 | 3300049571 | Ga0501034_0000122 | Ga0501034_0000122_86822_87529 | 235 |
| 479 | 3300049762 | Ga0501265_005136 | Ga0501265_005136_466_1173 | 235 |
| 480 | 3300049767 | Ga0501270_032590 | Ga0501270_032590_31_744 | 235 |
| 481 | 3300049771 | Ga0501274_013342 | Ga0501274_013342_24_737 | 235 |
| 482 | 3300049772 | Ga0501275_002650 | Ga0501275_002650_203_910 | 235 |
| 483 | 3300013307 | Ga0157372_10079938 | Ga0157372_100799384 | 236 |
| 484 | 3300026089 | Ga0207648_10327159 | Ga0207648_103271592 | 236 |
| 485 | 3300035398 | Ga0316574_0468911 | Ga0316574_0468911_53_769 | 236 |
| 486 | 3300050507 | nmdc:mga05p37_246269_c1 | nmdc:mga05p37_246269_c1_195_917 | 238 |
| 487 | 3300003323 | rootH1_10078708 | rootH1_100787081 | 245 |
| 488 | 3300041509 | Ga0451843_0075458 | Ga0451843_0075458_771_1508 | 245 |
| 489 | 3300013307 | Ga0157372_10084043 | Ga0157372_100840432 | 246 |
| 490 | 3300050493 | nmdc:mga0k408_109930_c1 | nmdc:mga0k408_109930_c1_338_1117 | 249 |
| 491 | 3300042013 | Ga0439456_043083 | Ga0439456_043083_110_910 | 256 |
| 492 | 3300042436 | Ga0439435_0007780 | Ga0439435_0007780_989_1789 | 256 |
| 493 | 3300042461 | Ga0439460_0001673 | Ga0439460_0001673_20_820 | 256 |
| 494 | 2162886007 | SwRhRL2b_contig_1851671 | SwRhRL2b_0991.00007050 | 264 |
| 495 | 3300048917 | Ga0496114_0003855 | Ga0496114_0003855_6905_7741 | 264 |
| 496 | 3300048929 | Ga0496126_0002981 | Ga0496126_0002981_11106_11942 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6uts-assembly1.cif.gz_A | crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli | 0.9652 | 30 | 263 |
| 1tq5-assembly1.cif.gz_A | crystal structure of yhhw from escherichia coli | 0.9613 | 30 | 264 |
| 6uts-assembly1.cif.gz_A | crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli | 0.9611 | 30 | 263 |
| 1tq5-assembly1.cif.gz_A | crystal structure of yhhw from escherichia coli | 0.9493 | 30 | 264 |
| 2dct-assembly1.cif.gz_A | crystal structure of the tt1209 from thermus thermophilus hb8 | 0.8727 | 71 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tq5A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9857 | 40 | 164 | 2.60.120.10 |
| af_P9WI85_16_135_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9838 | 42 | 160 | 2.60.120.10 |
| 1tq5A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9776 | 40 | 164 | 2.60.120.10 |
| af_P9WI85_16_135_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9678 | 42 | 160 | 2.60.120.10 |
| af_F1QLW3_37_119_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9511 | 68 | 149 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P7CSX9-F1-model_v4 | Pirin family protein | 0.9965 | 30 | 260 |
GO:0046872
|
| AF-A0A850QIQ9-F1-model_v4 | Pirin family protein | 0.9959 | 30 | 261 |
GO:0046872
|
| AF-A0A1H6TRA1-F1-model_v4 | Quercetin 2,3-dioxygenase | 0.9944 | 30 | 264 |
GO:0046872
|
| AF-A0A2H1PM95-F1-model_v4 | deleted | 0.9933 | 30 | 203 |
|
| AF-A0A534X9Y4-F1-model_v4 | Pirin family protein | 0.9932 | 30 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar