F454930
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 496 | 328 | 468 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300044684|Ga0466966_0141525|Ga0466966_0141525_29_874 |
| Length | 281 |
| Sequence | MSEMRLVVVGAAGRMGRMLIRAVAEAEGCRLVGAIERPGSEAIGHDAGLLAGTGLLEVDVTDDPLPVFAQADGVLDFTAPAATVGFAALAAQARIVHVVGTTGLQEADFAKLEAAARHARIVQSGNMSLGVNLLAGLVRRAAATLGADFDIEILEMHHRMKVDAPSGTALLLGEAAAEGRGVRLAEHSVRSRDGHTGPRRSGDIGFATLRGGTVVGEHAVIFAGSGERLELTHKAEDRGIFARGAVRAALWGFDKKPGYYTMADVLGFDQPSFPDIRLETP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 2 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 3 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 4 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 5 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 6 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 7 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 8 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 9 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 10 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 11 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 12 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 13 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 14 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 15 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 16 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 17 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 18 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 19 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 20 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 21 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 22 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 23 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 26 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 27 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 28 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 29 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 99 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 111 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 209 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 210 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 211 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 263 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 264 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 265 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 290 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 301 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 302 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 315 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 316 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 317 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 320 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 324 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 325 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 326 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 327 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 328 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.75 |
| Metatranscriptomes | 0.6 |
| Isolates | 5.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.85 |
| Nodule | 3.02 |
| Rhizoplane | 6.45 |
| Rhizosphere | 80.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10024533 | 3300001979 | Bacteria | 2045 |
| 2 | JGI25158J39367_1000444 | 3300002739 | Bacteria | 8576 |
| 3 | JGI25152J39213_1001036 | 3300002773 | Bacteria | 13243 |
| 4 | JGI25151J46595_10022994 | 3300003187 | Bacteria | 2577 |
| 5 | Ga0006562J51391_1019409 | 3300003578 | Bacteria | 2281 |
| 6 | Ga0006562J51391_1019411 | 3300003578 | Bacteria | 1000 |
| 7 | Ga0055526_1001254 | 3300003771 | Bacteria | 18211 |
| 8 | Ga0055524_1000011 | 3300003775 | Bacteria | 261442 |
| 9 | Ga0065165_1000150 | 3300005262 | Bacteria | 121992 |
| 10 | Ga0065707_10111613 | 3300005295 | Bacteria | 2389 |
| 11 | Ga0070676_10105722 | 3300005328 | Bacteria | 1745 |
| 12 | Ga0068869_100088513 | 3300005334 | Bacteria | 2324 |
| 13 | Ga0070666_10003359 | 3300005335 | Bacteria | 9707 |
| 14 | Ga0070680_100003095 | 3300005336 | Bacteria | 12348 |
| 15 | Ga0070680_100015789 | 3300005336 | Bacteria | 5928 |
| 16 | Ga0070682_100000325 | 3300005337 | Bacteria | 32746 |
| 17 | Ga0068868_100049355 | 3300005338 | Bacteria | 3302 |
| 18 | Ga0070660_100093228 | 3300005339 | Bacteria | 2378 |
| 19 | Ga0070692_10135658 | 3300005345 | Bacteria | 1388 |
| 20 | Ga0070668_100329346 | 3300005347 | Bacteria | 1287 |
| 21 | Ga0070675_100127234 | 3300005354 | Bacteria | 2168 |
| 22 | Ga0070671_100059347 | 3300005355 | Bacteria | 3184 |
| 23 | Ga0070674_100151493 | 3300005356 | Bacteria | 1750 |
| 24 | Ga0070673_100015351 | 3300005364 | Bacteria | 5376 |
| 25 | Ga0070659_100139144 | 3300005366 | Bacteria | 1976 |
| 26 | Ga0070667_100288111 | 3300005367 | Bacteria | 1476 |
| 27 | Ga0070709_10004283 | 3300005434 | Bacteria | 7694 |
| 28 | Ga0070709_10248009 | 3300005434 | Bacteria | 1281 |
| 29 | Ga0070714_100192600 | 3300005435 | Bacteria | 1861 |
| 30 | Ga0070713_100000710 | 3300005436 | Bacteria | 21366 |
| 31 | Ga0070713_100113050 | 3300005436 | Bacteria | 2370 |
| 32 | Ga0070713_100143630 | 3300005436 | Bacteria | 2116 |
| 33 | Ga0070710_10076497 | 3300005437 | Bacteria | 1943 |
| 34 | Ga0070711_100025551 | 3300005439 | Bacteria | 3866 |
| 35 | Ga0070711_100316956 | 3300005439 | Bacteria | 1245 |
| 36 | Ga0070705_100233518 | 3300005440 | Bacteria | 1281 |
| 37 | Ga0070700_100150786 | 3300005441 | Bacteria | 1590 |
| 38 | Ga0070663_100046596 | 3300005455 | Bacteria | 3068 |
| 39 | Ga0070678_100084145 | 3300005456 | Bacteria | 2420 |
| 40 | Ga0070678_100450921 | 3300005456 | Bacteria | 1127 |
| 41 | Ga0070678_100609018 | 3300005456 | Bacteria | 976 |
| 42 | Ga0070662_100106633 | 3300005457 | Bacteria | 2129 |
| 43 | Ga0070681_10099814 | 3300005458 | Bacteria | 2849 |
| 44 | Ga0068867_100216440 | 3300005459 | Bacteria | 1541 |
| 45 | Ga0070685_10005299 | 3300005466 | Bacteria | 6538 |
| 46 | Ga0070679_100012384 | 3300005530 | Bacteria | 8149 |
| 47 | Ga0070679_100093362 | 3300005530 | Bacteria | 2997 |
| 48 | Ga0070684_100185160 | 3300005535 | Bacteria | 1893 |
| 49 | Ga0068853_100000927 | 3300005539 | Bacteria | 20513 |
| 50 | Ga0068853_100165084 | 3300005539 | Bacteria | 2001 |
| 51 | Ga0070672_100251684 | 3300005543 | Bacteria | 1488 |
| 52 | Ga0070696_100020547 | 3300005546 | Bacteria | 4474 |
| 53 | Ga0070696_100071543 | 3300005546 | Bacteria | 2441 |
| 54 | Ga0070693_100079016 | 3300005547 | Bacteria | 1956 |
| 55 | Ga0070693_100113285 | 3300005547 | Bacteria | 1672 |
| 56 | Ga0070665_100025159 | 3300005548 | Bacteria | 5998 |
| 57 | Ga0070665_100140738 | 3300005548 | Bacteria | 2416 |
| 58 | Ga0068854_100273317 | 3300005578 | Bacteria | 1358 |
| 59 | Ga0068856_100044923 | 3300005614 | Bacteria | 4348 |
| 60 | Ga0068856_100311289 | 3300005614 | Bacteria | 1592 |
| 61 | Ga0070702_100002584 | 3300005615 | Bacteria | 7873 |
| 62 | Ga0068863_100241830 | 3300005841 | Bacteria | 1742 |
| 63 | Ga0068858_100116237 | 3300005842 | Bacteria | 2500 |
| 64 | Ga0068862_100138064 | 3300005844 | Bacteria | 2162 |
| 65 | Ga0081455_10004792 | 3300005937 | Bacteria | 15036 |
| 66 | Ga0081455_10097189 | 3300005937 | Bacteria | 2373 |
| 67 | Ga0075365_10374879 | 3300006038 | Bacteria | 1004 |
| 68 | Ga0075363_100074335 | 3300006048 | Bacteria | 1850 |
| 69 | Ga0070715_10030309 | 3300006163 | Bacteria | 2186 |
| 70 | Ga0070715_10122339 | 3300006163 | Bacteria | 1242 |
| 71 | Ga0070715_10228916 | 3300006163 | Unclassified | 960 |
| 72 | Ga0070716_100001066 | 3300006173 | Bacteria | 12003 |
| 73 | Ga0070712_100004156 | 3300006175 | Bacteria | 8897 |
| 74 | Ga0070712_100062512 | 3300006175 | Bacteria | 2633 |
| 75 | Ga0070712_100085094 | 3300006175 | Bacteria | 2301 |
| 76 | Ga0070712_100138151 | 3300006175 | Bacteria | 1856 |
| 77 | Ga0097621_100007335 | 3300006237 | Bacteria | 7882 |
| 78 | Ga0097621_100105056 | 3300006237 | Bacteria | 2380 |
| 79 | Ga0068871_100005222 | 3300006358 | Bacteria | 9085 |
| 80 | Ga0075428_100338120 | 3300006844 | Bacteria | 1617 |
| 81 | Ga0075428_100364934 | 3300006844 | Bacteria | 1549 |
| 82 | Ga0075428_100826631 | 3300006844 | Bacteria | 984 |
| 83 | Ga0075430_100101579 | 3300006846 | Bacteria | 2401 |
| 84 | Ga0075431_100018281 | 3300006847 | Bacteria | 7132 |
| 85 | Ga0075431_100029270 | 3300006847 | Bacteria | 5667 |
| 86 | Ga0075431_100568894 | 3300006847 | Bacteria | 1119 |
| 87 | Ga0075434_100187736 | 3300006871 | Bacteria | 2087 |
| 88 | Ga0075429_100002407 | 3300006880 | Bacteria | 15758 |
| 89 | Ga0075436_100086862 | 3300006914 | Bacteria | 2172 |
| 90 | Ga0075435_100081988 | 3300007076 | Bacteria | 2650 |
| 91 | Ga0075435_100193680 | 3300007076 | Bacteria | 1721 |
| 92 | Ga0105251_10012277 | 3300009011 | Bacteria | 4855 |
| 93 | Ga0111539_10000115 | 3300009094 | Bacteria | 88645 |
| 94 | Ga0111539_10349241 | 3300009094 | Bacteria | 1721 |
| 95 | Ga0114129_10001209 | 3300009147 | Bacteria | 34278 |
| 96 | Ga0114129_10081364 | 3300009147 | Bacteria | 4502 |
| 97 | Ga0105243_10029150 | 3300009148 | Bacteria | 4243 |
| 98 | Ga0105243_10213190 | 3300009148 | Bacteria | 1702 |
| 99 | Ga0105241_10020240 | 3300009174 | Bacteria | 4915 |
| 100 | Ga0105241_10105690 | 3300009174 | Bacteria | 2246 |
| 101 | Ga0105241_10378747 | 3300009174 | Bacteria | 1236 |
| 102 | Ga0105242_10457075 | 3300009176 | Bacteria | 1205 |
| 103 | Ga0105248_10054127 | 3300009177 | Bacteria | 4500 |
| 104 | Ga0105238_10233006 | 3300009551 | Bacteria | 1818 |
| 105 | Ga0105249_10214044 | 3300009553 | Bacteria | 1893 |
| 106 | Ga0157345_1001900 | 3300012498 | Bacteria | 1462 |
| 107 | Ga0157338_1000769 | 3300012515 | Bacteria | 2057 |
| 108 | Ga0157370_10354246 | 3300013104 | Bacteria | 1353 |
| 109 | Ga0157369_10223892 | 3300013105 | Bacteria | 1968 |
| 110 | Ga0171462_1015 | 3300013250 | Bacteria | 169578 |
| 111 | Ga0157378_10239571 | 3300013297 | Bacteria | 1732 |
| 112 | Ga0157372_10002662 | 3300013307 | Bacteria | 19349 |
| 113 | Ga0157372_10013771 | 3300013307 | Bacteria | 8641 |
| 114 | Ga0157372_10424791 | 3300013307 | Bacteria | 1549 |
| 115 | Ga0157380_10317133 | 3300014326 | Bacteria | 1444 |
| 116 | Ga0157377_10026832 | 3300014745 | Bacteria | 3087 |
| 117 | Ga0163161_10047082 | 3300017792 | Bacteria | 3114 |
| 118 | Ga0206353_11538153 | 3300020082 | Bacteria | 2040 |
| 119 | Ga0213876_10014594 | 3300021384 | Bacteria | 4162 |
| 120 | Ga0213876_10121845 | 3300021384 | Bacteria | 1385 |
| 121 | Ga0228598_1000380 | 3300024227 | Bacteria | 8894 |
| 122 | Ga0209130_1000187 | 3300025284 | Bacteria | 87082 |
| 123 | Ga0209675_1002076 | 3300025291 | Bacteria | 10648 |
| 124 | Ga0209025_1003913 | 3300025294 | Bacteria | 13420 |
| 125 | Ga0209564_1000369 | 3300025295 | Bacteria | 83878 |
| 126 | Ga0209256_1000317 | 3300025299 | Bacteria | 83179 |
| 127 | Ga0207426_1010718 | 3300025302 | Bacteria | 3541 |
| 128 | Ga0207692_10055610 | 3300025898 | Bacteria | 2027 |
| 129 | Ga0207688_10086325 | 3300025901 | Bacteria | 1798 |
| 130 | Ga0207647_10100472 | 3300025904 | Bacteria | 1717 |
| 131 | Ga0207647_10232963 | 3300025904 | Bacteria | 1059 |
| 132 | Ga0207685_10007409 | 3300025905 | Bacteria | 3057 |
| 133 | Ga0207699_10000275 | 3300025906 | Bacteria | 28286 |
| 134 | Ga0207699_10124875 | 3300025906 | Bacteria | 1670 |
| 135 | Ga0207645_10024629 | 3300025907 | Bacteria | 3899 |
| 136 | Ga0207707_10122640 | 3300025912 | Bacteria | 2272 |
| 137 | Ga0207695_10227136 | 3300025913 | Bacteria | 1772 |
| 138 | Ga0207693_10002367 | 3300025915 | Bacteria | 16372 |
| 139 | Ga0207663_10028187 | 3300025916 | Bacteria | 3284 |
| 140 | Ga0207663_10155456 | 3300025916 | Bacteria | 1608 |
| 141 | Ga0207660_10203959 | 3300025917 | Bacteria | 1545 |
| 142 | Ga0207657_10027857 | 3300025919 | Bacteria | 5167 |
| 143 | Ga0207657_10057016 | 3300025919 | Bacteria | 3369 |
| 144 | Ga0207652_10350383 | 3300025921 | Bacteria | 1332 |
| 145 | Ga0207652_10385697 | 3300025921 | Bacteria | 1264 |
| 146 | Ga0207650_10087550 | 3300025925 | Bacteria | 2373 |
| 147 | Ga0207659_10025129 | 3300025926 | Bacteria | 3998 |
| 148 | Ga0207687_10250192 | 3300025927 | Bacteria | 1409 |
| 149 | Ga0207700_10012436 | 3300025928 | Bacteria | 5490 |
| 150 | Ga0207700_10080152 | 3300025928 | Bacteria | 2545 |
| 151 | Ga0207664_10019573 | 3300025929 | Bacteria | 5005 |
| 152 | Ga0207644_10016802 | 3300025931 | Bacteria | 4928 |
| 153 | Ga0207644_10020596 | 3300025931 | Bacteria | 4486 |
| 154 | Ga0207706_10064539 | 3300025933 | Bacteria | 3224 |
| 155 | Ga0207706_10157511 | 3300025933 | Bacteria | 1997 |
| 156 | Ga0207706_10275950 | 3300025933 | Bacteria | 1466 |
| 157 | Ga0207669_10069245 | 3300025937 | Bacteria | 2207 |
| 158 | Ga0207704_10019872 | 3300025938 | Bacteria | 3539 |
| 159 | Ga0207665_10001144 | 3300025939 | Bacteria | 17854 |
| 160 | Ga0207665_10087343 | 3300025939 | Bacteria | 2155 |
| 161 | Ga0207691_10239155 | 3300025940 | Bacteria | 1570 |
| 162 | Ga0207711_10366166 | 3300025941 | Bacteria | 1336 |
| 163 | Ga0207689_10006586 | 3300025942 | Bacteria | 10239 |
| 164 | Ga0207667_10143638 | 3300025949 | Bacteria | 2457 |
| 165 | Ga0207651_10007088 | 3300025960 | Bacteria | 5949 |
| 166 | Ga0207651_10186175 | 3300025960 | Bacteria | 1652 |
| 167 | Ga0207712_10322917 | 3300025961 | Bacteria | 1274 |
| 168 | Ga0207668_10089270 | 3300025972 | Bacteria | 2260 |
| 169 | Ga0207658_10294600 | 3300025986 | Bacteria | 1396 |
| 170 | Ga0207703_10046398 | 3300026035 | Bacteria | 3499 |
| 171 | Ga0207639_10291700 | 3300026041 | Bacteria | 1439 |
| 172 | Ga0207678_10005212 | 3300026067 | Bacteria | 11649 |
| 173 | Ga0207678_10461173 | 3300026067 | Bacteria | 1105 |
| 174 | Ga0207708_10029680 | 3300026075 | Bacteria | 4145 |
| 175 | Ga0207708_10232773 | 3300026075 | Bacteria | 1479 |
| 176 | Ga0207641_10815704 | 3300026088 | Bacteria | 923 |
| 177 | Ga0207648_10078410 | 3300026089 | Bacteria | 2881 |
| 178 | Ga0207676_10130943 | 3300026095 | Bacteria | 2132 |
| 179 | Ga0207674_10314816 | 3300026116 | Bacteria | 1514 |
| 180 | Ga0207683_10059773 | 3300026121 | Bacteria | 3348 |
| 181 | Ga0207428_10123899 | 3300027907 | Bacteria | 1980 |
| 182 | Ga0268266_10044744 | 3300028379 | Bacteria | 3784 |
| 183 | Ga0268264_10645366 | 3300028381 | Bacteria | 1047 |
| 184 | Ga0265338_10068475 | 3300028800 | Bacteria | 3057 |
| 185 | Ga0265328_10011043 | 3300031239 | Bacteria | 3619 |
| 186 | Ga0265325_10000011 | 3300031241 | Bacteria | 150631 |
| 187 | Ga0265325_10000238 | 3300031241 | Bacteria | 39199 |
| 188 | Ga0265325_10051461 | 3300031241 | Bacteria | 2117 |
| 189 | Ga0265340_10142496 | 3300031247 | Bacteria | 1096 |
| 190 | Ga0265339_10000462 | 3300031249 | Bacteria | 31680 |
| 191 | Ga0265339_10002208 | 3300031249 | Bacteria | 14116 |
| 192 | Ga0265339_10030126 | 3300031249 | Bacteria | 3074 |
| 193 | Ga0265331_10000007 | 3300031250 | Bacteria | 331074 |
| 194 | Ga0265327_10013307 | 3300031251 | Bacteria | 5472 |
| 195 | Ga0265316_10062483 | 3300031344 | Bacteria | 2890 |
| 196 | Ga0265316_10064256 | 3300031344 | Bacteria | 2843 |
| 197 | Ga0265316_10077334 | 3300031344 | Bacteria | 2556 |
| 198 | Ga0307513_10059875 | 3300031456 | Bacteria | 4040 |
| 199 | Ga0307408_100043956 | 3300031548 | Bacteria | 3181 |
| 200 | Ga0307408_100233416 | 3300031548 | Bacteria | 1508 |
| 201 | Ga0265313_10000088 | 3300031595 | Bacteria | 90711 |
| 202 | Ga0265313_10002423 | 3300031595 | Bacteria | 16122 |
| 203 | Ga0265313_10006548 | 3300031595 | Bacteria | 8214 |
| 204 | Ga0265314_10006928 | 3300031711 | Bacteria | 9926 |
| 205 | Ga0307410_10110103 | 3300031852 | Bacteria | 1991 |
| 206 | Ga0307406_10114316 | 3300031901 | Bacteria | 1864 |
| 207 | Ga0307412_10161954 | 3300031911 | Bacteria | 1663 |
| 208 | Ga0307409_100140221 | 3300031995 | Bacteria | 2082 |
| 209 | Ga0307416_100187466 | 3300032002 | Bacteria | 1946 |
| 210 | Ga0307414_10097905 | 3300032004 | Bacteria | 2199 |
| 211 | Ga0307411_10033825 | 3300032005 | Bacteria | 3174 |
| 212 | Ga0307415_100368506 | 3300032126 | Bacteria | 1215 |
| 213 | Ga0373959_0029260 | 3300034820 | Bacteria | 1104 |
| 214 | Ga0373938_0015409 | 3300034957 | Bacteria | 1480 |
| 215 | Ga0373940_0038989 | 3300035088 | Bacteria | 1299 |
| 216 | Ga0373940_0059063 | 3300035088 | Bacteria | 1093 |
| 217 | Ga0373944_0005793 | 3300035089 | Bacteria | 3267 |
| 218 | Ga0373949_0009178 | 3300035090 | Bacteria | 2168 |
| 219 | Ga0373951_0027208 | 3300035091 | Bacteria | 1334 |
| 220 | Ga0373939_0001208 | 3300035114 | Bacteria | 6318 |
| 221 | Ga0373939_0126866 | 3300035114 | Bacteria | 906 |
| 222 | Ga0373945_0028317 | 3300035116 | Bacteria | 1963 |
| 223 | Ga0373953_0021984 | 3300035117 | Bacteria | 2400 |
| 224 | Ga0373956_0047690 | 3300035119 | Bacteria | 1917 |
| 225 | Ga0373943_0001159 | 3300035170 | Bacteria | 11771 |
| 226 | Ga0373943_0005890 | 3300035170 | Bacteria | 5504 |
| 227 | Ga0373946_0002367 | 3300035171 | Bacteria | 6670 |
| 228 | Ga0373942_0010249 | 3300035207 | Bacteria | 2203 |
| 229 | Ga0373961_0009599 | 3300035241 | Bacteria | 2370 |
| 230 | Ga0373924_0046675 | 3300035410 | Bacteria | 1785 |
| 231 | Ga0373924_0123877 | 3300035410 | Bacteria | 1122 |
| 232 | Ga0373931_0023099 | 3300035691 | Bacteria | 3137 |
| 233 | Ga0373935_0002094 | 3300035692 | Bacteria | 11328 |
| 234 | Ga0373935_0046914 | 3300035692 | Bacteria | 2730 |
| 235 | Ga0373927_0077244 | 3300035695 | Bacteria | 2157 |
| 236 | Ga0373927_0120903 | 3300035695 | Bacteria | 1709 |
| 237 | Ga0373927_0128812 | 3300035695 | Bacteria | 1653 |
| 238 | Ga0373933_0036394 | 3300035724 | Bacteria | 2881 |
| 239 | Ga0373933_0303044 | 3300035724 | Bacteria | 1034 |
| 240 | Ga0373947_0005019 | 3300035725 | Bacteria | 7748 |
| 241 | Ga0373947_0013927 | 3300035725 | Bacteria | 4611 |
| 242 | Ga0373947_0208421 | 3300035725 | Bacteria | 1281 |
| 243 | Ga0373937_0013925 | 3300036401 | Bacteria | 7092 |
| 244 | Ga0373937_0019748 | 3300036401 | Bacteria | 6035 |
| 245 | Ga0373925_0001534 | 3300037068 | Bacteria | 19696 |
| 246 | Ga0373925_0015415 | 3300037068 | Bacteria | 5526 |
| 247 | Ga0373925_0084567 | 3300037068 | Bacteria | 2418 |
| 248 | Ga0395900_0193565 | 3300037418 | Bacteria | 2061 |
| 249 | Ga0395898_0042049 | 3300037466 | Bacteria | 4511 |
| 250 | Ga0395901_0223842 | 3300038443 | Bacteria | 1966 |
| 251 | Ga0436365_1681640 | 3300039437 | Bacteria | 9732 |
| 252 | Ga0436360_1261257 | 3300039438 | Bacteria | 1584 |
| 253 | Ga0436363_0378956 | 3300039450 | Bacteria | 815 |
| 254 | Ga0439466_0038786 | 3300041411 | Bacteria | 1599 |
| 255 | Ga0439448_0032022 | 3300042005 | Bacteria | 1672 |
| 256 | Ga0450902_018198 | 3300042137 | Bacteria | 1151 |
| 257 | Ga0466966_0141525 | 3300044684 | Bacteria | 1470 |
| 258 | Ga0495629_0002525 | 3300046459 | Bacteria | 14034 |
| 259 | Ga0495629_0130513 | 3300046459 | Bacteria | 1750 |
| 260 | Ga0495629_0250075 | 3300046459 | Bacteria | 1220 |
| 261 | Ga0495641_0037952 | 3300046461 | Bacteria | 2253 |
| 262 | Ga0495653_0123313 | 3300046463 | Bacteria | 1843 |
| 263 | Ga0495653_0392945 | 3300046463 | Bacteria | 883 |
| 264 | Ga0495653_0398421 | 3300046463 | Bacteria | 875 |
| 265 | Ga0495582_0006250 | 3300046473 | Bacteria | 6638 |
| 266 | Ga0495605_0074017 | 3300046474 | Bacteria | 1604 |
| 267 | Ga0495662_0005479 | 3300046476 | Bacteria | 6352 |
| 268 | Ga0495664_0002153 | 3300046477 | Bacteria | 10544 |
| 269 | Ga0495664_0042051 | 3300046477 | Bacteria | 2706 |
| 270 | Ga0495594_0093033 | 3300046499 | Bacteria | 1691 |
| 271 | Ga0495594_0146494 | 3300046499 | Bacteria | 1340 |
| 272 | Ga0495608_0143770 | 3300046511 | Bacteria | 1522 |
| 273 | Ga0495610_0028209 | 3300046512 | Bacteria | 2972 |
| 274 | Ga0495618_0001760 | 3300046514 | Bacteria | 14373 |
| 275 | Ga0495618_0109378 | 3300046514 | Bacteria | 1770 |
| 276 | Ga0495628_0236571 | 3300046516 | Bacteria | 1367 |
| 277 | Ga0495630_0011980 | 3300046517 | Bacteria | 6287 |
| 278 | Ga0495630_0081458 | 3300046517 | Bacteria | 2442 |
| 279 | Ga0495630_0136145 | 3300046517 | Bacteria | 1866 |
| 280 | Ga0495630_0140866 | 3300046517 | Bacteria | 1834 |
| 281 | Ga0495630_0347091 | 3300046517 | Bacteria | 1136 |
| 282 | Ga0495666_0130453 | 3300046526 | Bacteria | 1175 |
| 283 | Ga0495642_0232889 | 3300046528 | Bacteria | 804 |
| 284 | Ga0495652_0012826 | 3300046529 | Bacteria | 7549 |
| 285 | Ga0495652_0128826 | 3300046529 | Bacteria | 2006 |
| 286 | Ga0495665_0035029 | 3300046531 | Bacteria | 2683 |
| 287 | Ga0495665_0065538 | 3300046531 | Bacteria | 1917 |
| 288 | Ga0495640_0040029 | 3300046533 | Bacteria | 3284 |
| 289 | Ga0495640_0090705 | 3300046533 | Bacteria | 2017 |
| 290 | Ga0495586_0097959 | 3300046535 | Bacteria | 1625 |
| 291 | Ga0495645_0001651 | 3300046543 | Bacteria | 15142 |
| 292 | Ga0495645_0154019 | 3300046543 | Bacteria | 1594 |
| 293 | Ga0495622_0001360 | 3300046557 | Bacteria | 12503 |
| 294 | Ga0495622_0044140 | 3300046557 | Bacteria | 2072 |
| 295 | Ga0495611_0084959 | 3300046648 | Bacteria | 1459 |
| 296 | Ga0495635_0056324 | 3300046663 | Bacteria | 2706 |
| 297 | Ga0495623_0066383 | 3300046679 | Bacteria | 2254 |
| 298 | Ga0495647_0036742 | 3300046681 | Bacteria | 1845 |
| 299 | Ga0495658_0021249 | 3300046683 | Bacteria | 3420 |
| 300 | Ga0495613_0020140 | 3300046689 | Bacteria | 4970 |
| 301 | Ga0495649_0053494 | 3300046694 | Bacteria | 2185 |
| 302 | Ga0495600_0019140 | 3300046809 | Bacteria | 4368 |
| 303 | Ga0495581_0019057 | 3300047315 | Bacteria | 3982 |
| 304 | Ga0495674_0013772 | 3300047319 | Bacteria | 7592 |
| 305 | Ga0495674_0111154 | 3300047319 | Bacteria | 2323 |
| 306 | Ga0495676_0165859 | 3300047321 | Bacteria | 1558 |
| 307 | Ga0495680_0004614 | 3300047322 | Bacteria | 13127 |
| 308 | Ga0495684_0049283 | 3300047471 | Bacteria | 3218 |
| 309 | Ga0495686_0083098 | 3300047472 | Bacteria | 1954 |
| 310 | Ga0495686_0353751 | 3300047472 | Bacteria | 798 |
| 311 | Ga0495593_0010816 | 3300047673 | Bacteria | 5261 |
| 312 | Ga0495602_0141955 | 3300048088 | Bacteria | 1900 |
| 313 | Ga0496100_0018258 | 3300048903 | Bacteria | 4157 |
| 314 | Ga0496101_0005822 | 3300048904 | Bacteria | 7884 |
| 315 | Ga0496102_0047171 | 3300048905 | Bacteria | 3913 |
| 316 | Ga0496102_0064300 | 3300048905 | Bacteria | 3360 |
| 317 | Ga0496104_0000352 | 3300048907 | Bacteria | 41135 |
| 318 | Ga0496104_0001360 | 3300048907 | Bacteria | 21160 |
| 319 | Ga0496104_0031281 | 3300048907 | Bacteria | 4948 |
| 320 | Ga0496104_0631278 | 3300048907 | Bacteria | 980 |
| 321 | Ga0496105_0000295 | 3300048908 | Bacteria | 32782 |
| 322 | Ga0496105_0000498 | 3300048908 | Bacteria | 25929 |
| 323 | Ga0496105_0009338 | 3300048908 | Bacteria | 7665 |
| 324 | Ga0496106_0020197 | 3300048909 | Bacteria | 4942 |
| 325 | Ga0496107_0050133 | 3300048910 | Bacteria | 3008 |
| 326 | Ga0496108_0035079 | 3300048911 | Bacteria | 4168 |
| 327 | Ga0496108_0188192 | 3300048911 | Bacteria | 1789 |
| 328 | Ga0496108_0322058 | 3300048911 | Bacteria | 1348 |
| 329 | Ga0496109_0096362 | 3300048912 | Bacteria | 2741 |
| 330 | Ga0496110_0041912 | 3300048913 | Bacteria | 3995 |
| 331 | Ga0496111_0015406 | 3300048914 | Bacteria | 5246 |
| 332 | Ga0496111_0194488 | 3300048914 | Bacteria | 1508 |
| 333 | Ga0496112_0012247 | 3300048915 | Bacteria | 7875 |
| 334 | Ga0496112_0038371 | 3300048915 | Bacteria | 4676 |
| 335 | Ga0496112_0054114 | 3300048915 | Bacteria | 3942 |
| 336 | Ga0496112_0160504 | 3300048915 | Bacteria | 2214 |
| 337 | Ga0496113_0008690 | 3300048916 | Bacteria | 6628 |
| 338 | Ga0496113_0333584 | 3300048916 | Bacteria | 1216 |
| 339 | Ga0496115_0044085 | 3300048918 | Bacteria | 3557 |
| 340 | Ga0496115_0054133 | 3300048918 | Bacteria | 3221 |
| 341 | Ga0496115_0072357 | 3300048918 | Bacteria | 2797 |
| 342 | Ga0496115_0160783 | 3300048918 | Bacteria | 1856 |
| 343 | Ga0496115_0355056 | 3300048918 | Bacteria | 1195 |
| 344 | Ga0496115_0700043 | 3300048918 | Bacteria | 796 |
| 345 | Ga0496117_0031338 | 3300048920 | Bacteria | 4062 |
| 346 | Ga0496119_0000483 | 3300048922 | Bacteria | 54518 |
| 347 | Ga0496123_0107023 | 3300048926 | Bacteria | 1609 |
| 348 | Ga0496126_0372538 | 3300048929 | Bacteria | 1164 |
| 349 | Ga0501032_0061484 | 3300049569 | Bacteria | 2517 |
| 350 | Ga0501033_0112706 | 3300049570 | Bacteria | 1978 |
| 351 | Ga0501033_0148748 | 3300049570 | Bacteria | 1690 |
| 352 | Ga0501033_0168135 | 3300049570 | Bacteria | 1575 |
| 353 | Ga0501033_0257482 | 3300049570 | Bacteria | 1236 |
| 354 | Ga0501034_0082307 | 3300049571 | Bacteria | 3220 |
| 355 | Ga0501034_0144169 | 3300049571 | Bacteria | 2360 |
| 356 | Ga0501034_0226277 | 3300049571 | Bacteria | 1821 |
| 357 | Ga0501034_0374040 | 3300049571 | Bacteria | 1350 |
| 358 | Ga0501034_0403473 | 3300049571 | Bacteria | 1289 |
| 359 | Ga0501036_0118099 | 3300049572 | Bacteria | 2239 |
| 360 | Ga0501036_0232553 | 3300049572 | Bacteria | 1546 |
| 361 | Ga0501037_0008896 | 3300049573 | Bacteria | 7354 |
| 362 | Ga0501037_0050257 | 3300049573 | Bacteria | 3052 |
| 363 | Ga0501037_0153514 | 3300049573 | Bacteria | 1644 |
| 364 | Ga0501037_0393060 | 3300049573 | Bacteria | 952 |
| 365 | Ga0501038_0141259 | 3300049574 | Bacteria | 1970 |
| 366 | Ga0501038_0179106 | 3300049574 | Bacteria | 1711 |
| 367 | Ga0501039_0150536 | 3300049575 | Bacteria | 1828 |
| 368 | Ga0501039_0248957 | 3300049575 | Bacteria | 1397 |
| 369 | Ga0501041_0083493 | 3300049577 | Bacteria | 1969 |
| 370 | Ga0501042_0106091 | 3300049578 | Bacteria | 2022 |
| 371 | Ga0501043_0053079 | 3300049579 | Bacteria | 3183 |
| 372 | Ga0501046_0001578 | 3300049580 | Bacteria | 21792 |
| 373 | Ga0501047_0012474 | 3300049581 | Bacteria | 8048 |
| 374 | Ga0501047_0083304 | 3300049581 | Bacteria | 3074 |
| 375 | Ga0501047_0230989 | 3300049581 | Bacteria | 1703 |
| 376 | Ga0501048_0048329 | 3300049582 | Bacteria | 3035 |
| 377 | Ga0501067_0007392 | 3300049583 | Bacteria | 6103 |
| 378 | Ga0501069_0003295 | 3300049585 | Bacteria | 8283 |
| 379 | Ga0501070_0022871 | 3300049586 | Bacteria | 5232 |
| 380 | Ga0501070_0054407 | 3300049586 | Bacteria | 3319 |
| 381 | Ga0501070_0067324 | 3300049586 | Bacteria | 2966 |
| 382 | Ga0501070_0127120 | 3300049586 | Bacteria | 2106 |
| 383 | Ga0501070_0197870 | 3300049586 | Bacteria | 1650 |
| 384 | Ga0501070_0311006 | 3300049586 | Bacteria | 1282 |
| 385 | Ga0501071_0073381 | 3300049587 | Bacteria | 2496 |
| 386 | Ga0501071_0527876 | 3300049587 | Bacteria | 906 |
| 387 | Ga0501073_0027442 | 3300049589 | Bacteria | 4071 |
| 388 | Ga0501073_0065939 | 3300049589 | Bacteria | 2524 |
| 389 | Ga0501073_0120561 | 3300049589 | Bacteria | 1818 |
| 390 | Ga0501073_0122697 | 3300049589 | Bacteria | 1801 |
| 391 | Ga0501073_0364808 | 3300049589 | Bacteria | 997 |
| 392 | Ga0501073_0528701 | 3300049589 | Bacteria | 815 |
| 393 | Ga0501074_0077463 | 3300049590 | Bacteria | 2386 |
| 394 | Ga0501074_0102785 | 3300049590 | Bacteria | 2046 |
| 395 | Ga0501075_0122040 | 3300049591 | Bacteria | 1983 |
| 396 | Ga0501076_0022154 | 3300049592 | Bacteria | 4882 |
| 397 | Ga0501076_0062628 | 3300049592 | Bacteria | 2963 |
| 398 | Ga0501076_0078634 | 3300049592 | Bacteria | 2647 |
| 399 | Ga0501076_0137018 | 3300049592 | Bacteria | 1988 |
| 400 | Ga0501077_0003865 | 3300049593 | Bacteria | 9027 |
| 401 | Ga0501077_0128278 | 3300049593 | Bacteria | 1608 |
| 402 | Ga0501077_0234282 | 3300049593 | Bacteria | 1167 |
| 403 | Ga0501252_010513 | 3300049682 | Bacteria | 1095 |
| 404 | Ga0501079_0047049 | 3300049741 | Bacteria | 3328 |
| 405 | Ga0501080_0017640 | 3300049742 | Bacteria | 6603 |
| 406 | Ga0501080_0019521 | 3300049742 | Bacteria | 6279 |
| 407 | Ga0501080_0077906 | 3300049742 | Bacteria | 3083 |
| 408 | Ga0501080_0309998 | 3300049742 | Bacteria | 1430 |
| 409 | Ga0501080_0355344 | 3300049742 | Bacteria | 1322 |
| 410 | Ga0501081_0063088 | 3300049743 | Bacteria | 2571 |
| 411 | Ga0501081_0376277 | 3300049743 | Bacteria | 1049 |
| 412 | Ga0501083_0000940 | 3300049744 | Bacteria | 19244 |
| 413 | Ga0501083_0201037 | 3300049744 | Bacteria | 1299 |
| 414 | Ga0501083_0202398 | 3300049744 | Bacteria | 1295 |
| 415 | Ga0501035_0001208 | 3300049822 | Bacteria | 26922 |
| 416 | Ga0501035_0131144 | 3300049822 | Bacteria | 2185 |
| 417 | Ga0501035_0143049 | 3300049822 | Bacteria | 2078 |
| 418 | Ga0501035_0267698 | 3300049822 | Bacteria | 1447 |
| 419 | Ga0501035_0445842 | 3300049822 | Bacteria | 1071 |
| 420 | Ga0501035_0654640 | 3300049822 | Bacteria | 851 |
| 421 | Ga0501044_0000122 | 3300049823 | Bacteria | 93246 |
| 422 | Ga0501044_0228461 | 3300049823 | Bacteria | 1809 |
| 423 | Ga0501044_0245667 | 3300049823 | Bacteria | 1733 |
| 424 | Ga0501045_0029529 | 3300049824 | Bacteria | 3964 |
| 425 | nmdc:mga03n38_119552_c1 | 3300050490 | Bacteria | 1293 |
| 426 | nmdc:mga00v17_271441_c1 | 3300050491 | Bacteria | 1101 |
| 427 | nmdc:mga00v17_398454_c1 | 3300050491 | Bacteria | 894 |
| 428 | nmdc:mga0yw44_202838_c1 | 3300050492 | Bacteria | 1310 |
| 429 | nmdc:mga06z11_153047_c1 | 3300050494 | Bacteria | 1313 |
| 430 | nmdc:mga06z11_246075_c1 | 3300050494 | Bacteria | 1052 |
| 431 | nmdc:mga04h51_18509_c1 | 3300050495 | Bacteria | 2053 |
| 432 | nmdc:mga07m45_266770_c1 | 3300050496 | Bacteria | 996 |
| 433 | nmdc:mga05p37_144428_c1 | 3300050507 | Bacteria | 2914 |
| 434 | nmdc:mga05p37_7481_c1 | 3300050507 | Bacteria | 12877 |
| 435 | nmdc:mga09592_1529_c1 | 3300050508 | Bacteria | 18637 |
| 436 | nmdc:mga0qj67_263920_c1 | 3300050509 | Bacteria | 1397 |
| 437 | nmdc:mga0qj67_4938_c1 | 3300050509 | Bacteria | 9695 |
| 438 | nmdc:mga06r32_3841_c1 | 3300050510 | Bacteria | 13443 |
| 439 | nmdc:mga06r32_400795_c1 | 3300050510 | Bacteria | 1354 |
| 440 | nmdc:mga06r32_47_c1 | 3300050510 | Bacteria | 74242 |
| 441 | nmdc:mga08y16_32930_c1 | 3300050511 | Bacteria | 5446 |
| 442 | nmdc:mga08y16_72_c1 | 3300050511 | Bacteria | 84439 |
| 443 | nmdc:mga0n895_196422_c1 | 3300050512 | Bacteria | 2049 |
| 444 | nmdc:mga0n895_339891_c1 | 3300050512 | Bacteria | 1520 |
| 445 | nmdc:mga0rr50_278905_c1 | 3300050513 | Bacteria | 1394 |
| 446 | Ga0495601_0018199 | 3300053077 | Bacteria | 4273 |
| 447 | Ga0495601_0020265 | 3300053077 | Bacteria | 4061 |
| 448 | Ga0495612_0002446 | 3300053078 | Bacteria | 7645 |
| 449 | Ga0495595_0091465 | 3300053084 | Bacteria | 1460 |
| 450 | Ga0495619_0000387 | 3300053085 | Bacteria | 30124 |
| 451 | Ga0495619_0072173 | 3300053085 | Bacteria | 2311 |
| 452 | Ga0500650_0089458 | 3300053098 | Bacteria | 1441 |
| 453 | Ga0500555_020301 | 3300053103 | Bacteria | 1914 |
| 454 | Ga0500593_008845 | 3300053117 | Bacteria | 4154 |
| 455 | Ga0500616_0045484 | 3300053153 | Bacteria | 2338 |
| 456 | Ga0500636_0013976 | 3300053177 | Bacteria | 4719 |
| 457 | Ga0500637_0002549 | 3300053178 | Bacteria | 8133 |
| 458 | Ga0500645_015225 | 3300053730 | Bacteria | 2439 |
| 459 | Ga0501084_0004700 | 3300054114 | Bacteria | 11153 |
| 460 | Ga0501084_0022961 | 3300054114 | Bacteria | 5207 |
| 461 | Ga0501084_0064745 | 3300054114 | Bacteria | 3059 |
| 462 | Ga0501084_0078122 | 3300054114 | Bacteria | 2774 |
| 463 | Ga0501082_0029624 | 3300060353 | Bacteria | 4716 |
| 464 | Ga0501082_0081705 | 3300060353 | Bacteria | 2788 |
| 465 | Ga0501082_0085570 | 3300060353 | Bacteria | 2719 |
| 466 | Ga0501082_0148038 | 3300060353 | Bacteria | 2039 |
| 467 | Ga0501082_0247110 | 3300060353 | Bacteria | 1553 |
| 468 | Ga0530510_0042620 | 3300061734 | Bacteria | 3279 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0193565 | Ga0395900_0193565_369_1229 | 217 |
| 2 | 3300037466 | Ga0395898_0042049 | Ga0395898_0042049_642_1502 | 217 |
| 3 | 3300039450 | Ga0436363_0378956 | Ga0436363_0378956_19_792 | 226 |
| 4 | 3300047472 | Ga0495686_0353751 | Ga0495686_0353751_32_724 | 230 |
| 5 | 3300031251 | Ga0265327_10013307 | Ga0265327_100133077 | 232 |
| 6 | 3300031344 | Ga0265316_10064256 | Ga0265316_100642564 | 232 |
| 7 | 3300039438 | Ga0436360_1261257 | Ga0436360_1261257_130_999 | 233 |
| 8 | 3300048918 | Ga0496115_0700043 | Ga0496115_0700043_25_729 | 234 |
| 9 | 3300005614 | Ga0068856_100311289 | Ga0068856_1003112892 | 236 |
| 10 | 3300049593 | Ga0501077_0234282 | Ga0501077_0234282_440_1153 | 237 |
| 11 | 3300006163 | Ga0070715_10228916 | Ga0070715_102289162 | 239 |
| 12 | 3300035114 | Ga0373939_0001208 | Ga0373939_0001208_1084_1974 | 240 |
| 13 | 3300050512 | nmdc:mga0n895_196422_c1 | nmdc:mga0n895_196422_c1_72_842 | 241 |
| 14 | 3300035114 | Ga0373939_0126866 | Ga0373939_0126866_19_792 | 242 |
| 15 | 3300046463 | Ga0495653_0398421 | Ga0495653_0398421_23_796 | 242 |
| 16 | 3300050495 | nmdc:mga04h51_18509_c1 | nmdc:mga04h51_18509_c1_10_741 | 243 |
| 17 | 3300046517 | Ga0495630_0011980 | Ga0495630_0011980_3638_4447 | 244 |
| 18 | 3300013307 | Ga0157372_10013771 | Ga0157372_100137717 | 245 |
| 19 | 3300035692 | Ga0373935_0046914 | Ga0373935_0046914_782_1525 | 245 |
| 20 | 3300035695 | Ga0373927_0120903 | Ga0373927_0120903_859_1602 | 245 |
| 21 | 3300037068 | Ga0373925_0084567 | Ga0373925_0084567_783_1526 | 245 |
| 22 | 3300046459 | Ga0495629_0250075 | Ga0495629_0250075_275_1018 | 245 |
| 23 | 3300006844 | Ga0075428_100364934 | Ga0075428_1003649341 | 247 |
| 24 | 3300049682 | Ga0501252_010513 | Ga0501252_010513_244_1059 | 247 |
| 25 | 3300050511 | nmdc:mga08y16_32930_c1 | nmdc:mga08y16_32930_c1_3229_4038 | 247 |
| 26 | 3300005535 | Ga0070684_100185160 | Ga0070684_1001851603 | 248 |
| 27 | 3300005262 | Ga0065165_1000150 | Ga0065165_100015045 | 249 |
| 28 | 3300025284 | Ga0209130_1000187 | Ga0209130_100018761 | 249 |
| 29 | 3300025302 | Ga0207426_1010718 | Ga0207426_10107184 | 249 |
| 30 | 3300047472 | Ga0495686_0083098 | Ga0495686_0083098_1175_1924 | 249 |
| 31 | 3300048911 | Ga0496108_0322058 | Ga0496108_0322058_501_1307 | 249 |
| 32 | 3300028800 | Ga0265338_10068475 | Ga0265338_100684753 | 250 |
| 33 | 3300031249 | Ga0265339_10000462 | Ga0265339_1000046228 | 250 |
| 34 | 3300031595 | Ga0265313_10000088 | Ga0265313_1000008825 | 250 |
| 35 | 3300031711 | Ga0265314_10006928 | Ga0265314_100069286 | 250 |
| 36 | 3300048918 | Ga0496115_0160783 | Ga0496115_0160783_141_962 | 250 |
| 37 | 3300031249 | Ga0265339_10030126 | Ga0265339_100301265 | 251 |
| 38 | 3300031344 | Ga0265316_10077334 | Ga0265316_100773342 | 251 |
| 39 | 3300046499 | Ga0495594_0146494 | Ga0495594_0146494_113_922 | 251 |
| 40 | 3300046557 | Ga0495622_0044140 | Ga0495622_0044140_48_857 | 251 |
| 41 | 3300049589 | Ga0501073_0364808 | Ga0501073_0364808_14_769 | 251 |
| 42 | 3300003187 | JGI25151J46595_10022994 | JGI25151J46595_100229944 | 252 |
| 43 | 3300005441 | Ga0070700_100150786 | Ga0070700_1001507862 | 252 |
| 44 | 3300025294 | Ga0209025_1003913 | Ga0209025_10039135 | 252 |
| 45 | 3300053117 | Ga0500593_008845 | Ga0500593_008845_1855_2670 | 252 |
| 46 | 3300003771 | Ga0055526_1001254 | Ga0055526_10012542 | 253 |
| 47 | 3300003775 | Ga0055524_1000011 | Ga0055524_1000011167 | 253 |
| 48 | 3300005345 | Ga0070692_10135658 | Ga0070692_101356582 | 253 |
| 49 | 3300005434 | Ga0070709_10248009 | Ga0070709_102480091 | 253 |
| 50 | 3300009174 | Ga0105241_10378747 | Ga0105241_103787472 | 253 |
| 51 | 3300013105 | Ga0157369_10223892 | Ga0157369_102238923 | 253 |
| 52 | 3300013307 | Ga0157372_10424791 | Ga0157372_104247912 | 253 |
| 53 | 3300020082 | Ga0206353_11538153 | Ga0206353_115381533 | 253 |
| 54 | 3300025291 | Ga0209675_1002076 | Ga0209675_100207613 | 253 |
| 55 | 3300025295 | Ga0209564_1000369 | Ga0209564_100036977 | 253 |
| 56 | 3300025299 | Ga0209256_1000317 | Ga0209256_100031713 | 253 |
| 57 | 3300025913 | Ga0207695_10227136 | Ga0207695_102271362 | 253 |
| 58 | 3300031241 | Ga0265325_10000011 | Ga0265325_10000011141 | 253 |
| 59 | 3300031595 | Ga0265313_10006548 | Ga0265313_100065482 | 253 |
| 60 | iso_pu_bacteria | 2582581867 | 2585399072 | 253 |
| 61 | iso_pu_bacteria | 2585427590 | 2585818807 | 253 |
| 62 | 3300038443 | Ga0395901_0223842 | Ga0395901_0223842_1000_1860 | 254 |
| 63 | 3300042137 | Ga0450902_018198 | Ga0450902_018198_355_1119 | 254 |
| 64 | 3300049573 | Ga0501037_0393060 | Ga0501037_0393060_172_936 | 254 |
| 65 | 3300005295 | Ga0065707_10111613 | Ga0065707_101116131 | 255 |
| 66 | 3300007076 | Ga0075435_100081988 | Ga0075435_1000819882 | 255 |
| 67 | 3300009553 | Ga0105249_10214044 | Ga0105249_102140442 | 255 |
| 68 | 3300025961 | Ga0207712_10322917 | Ga0207712_103229172 | 255 |
| 69 | 3300034820 | Ga0373959_0029260 | Ga0373959_0029260_318_1085 | 255 |
| 70 | 3300035724 | Ga0373933_0036394 | Ga0373933_0036394_505_1293 | 255 |
| 71 | 3300036401 | Ga0373937_0013925 | Ga0373937_0013925_715_1503 | 255 |
| 72 | 3300046528 | Ga0495642_0232889 | Ga0495642_0232889_25_792 | 255 |
| 73 | 3300048088 | Ga0495602_0141955 | Ga0495602_0141955_253_1041 | 255 |
| 74 | 3300005328 | Ga0070676_10105722 | Ga0070676_101057223 | 256 |
| 75 | 3300005335 | Ga0070666_10003359 | Ga0070666_100033599 | 256 |
| 76 | 3300005354 | Ga0070675_100127234 | Ga0070675_1001272343 | 256 |
| 77 | 3300005456 | Ga0070678_100084145 | Ga0070678_1000841454 | 256 |
| 78 | 3300005459 | Ga0068867_100216440 | Ga0068867_1002164403 | 256 |
| 79 | 3300005548 | Ga0070665_100140738 | Ga0070665_1001407383 | 256 |
| 80 | 3300006844 | Ga0075428_100826631 | Ga0075428_1008266311 | 256 |
| 81 | 3300006871 | Ga0075434_100187736 | Ga0075434_1001877363 | 256 |
| 82 | 3300007076 | Ga0075435_100193680 | Ga0075435_1001936802 | 256 |
| 83 | 3300009177 | Ga0105248_10054127 | Ga0105248_100541272 | 256 |
| 84 | 3300012498 | Ga0157345_1001900 | Ga0157345_10019002 | 256 |
| 85 | 3300013297 | Ga0157378_10239571 | Ga0157378_102395712 | 256 |
| 86 | 3300014745 | Ga0157377_10026832 | Ga0157377_100268325 | 256 |
| 87 | 3300025907 | Ga0207645_10024629 | Ga0207645_100246295 | 256 |
| 88 | 3300025938 | Ga0207704_10019872 | Ga0207704_100198724 | 256 |
| 89 | 3300026075 | Ga0207708_10029680 | Ga0207708_100296803 | 256 |
| 90 | 3300026089 | Ga0207648_10078410 | Ga0207648_100784104 | 256 |
| 91 | 3300026116 | Ga0207674_10314816 | Ga0207674_103148162 | 256 |
| 92 | 3300026121 | Ga0207683_10059773 | Ga0207683_100597733 | 256 |
| 93 | 3300028379 | Ga0268266_10044744 | Ga0268266_100447443 | 256 |
| 94 | 3300035088 | Ga0373940_0059063 | Ga0373940_0059063_153_968 | 256 |
| 95 | 3300035090 | Ga0373949_0009178 | Ga0373949_0009178_793_1608 | 256 |
| 96 | 3300035091 | Ga0373951_0027208 | Ga0373951_0027208_14_829 | 256 |
| 97 | 3300035170 | Ga0373943_0005890 | Ga0373943_0005890_3117_3932 | 256 |
| 98 | 3300035207 | Ga0373942_0010249 | Ga0373942_0010249_94_909 | 256 |
| 99 | 3300035241 | Ga0373961_0009599 | Ga0373961_0009599_1033_1848 | 256 |
| 100 | 3300035691 | Ga0373931_0023099 | Ga0373931_0023099_1681_2496 | 256 |
| 101 | 3300035692 | Ga0373935_0002094 | Ga0373935_0002094_5219_6034 | 256 |
| 102 | 3300035725 | Ga0373947_0013927 | Ga0373947_0013927_142_957 | 256 |
| 103 | 3300037068 | Ga0373925_0015415 | Ga0373925_0015415_1579_2394 | 256 |
| 104 | 3300046459 | Ga0495629_0002525 | Ga0495629_0002525_5439_6254 | 256 |
| 105 | 3300046461 | Ga0495641_0037952 | Ga0495641_0037952_73_888 | 256 |
| 106 | 3300046473 | Ga0495582_0006250 | Ga0495582_0006250_5784_6599 | 256 |
| 107 | 3300046517 | Ga0495630_0347091 | Ga0495630_0347091_236_1051 | 256 |
| 108 | 3300046683 | Ga0495658_0021249 | Ga0495658_0021249_1149_1964 | 256 |
| 109 | 3300046689 | Ga0495613_0020140 | Ga0495613_0020140_1689_2504 | 256 |
| 110 | 3300047321 | Ga0495676_0165859 | Ga0495676_0165859_393_1208 | 256 |
| 111 | 3300047322 | Ga0495680_0004614 | Ga0495680_0004614_8820_9635 | 256 |
| 112 | 3300047673 | Ga0495593_0010816 | Ga0495593_0010816_1054_1869 | 256 |
| 113 | 3300048905 | Ga0496102_0064300 | Ga0496102_0064300_699_1514 | 256 |
| 114 | 3300050513 | nmdc:mga0rr50_278905_c1 | nmdc:mga0rr50_278905_c1_339_1154 | 256 |
| 115 | 3300053085 | Ga0495619_0000387 | Ga0495619_0000387_22050_22865 | 256 |
| 116 | 3300025904 | Ga0207647_10232963 | Ga0207647_102329632 | 257 |
| 117 | 3300026075 | Ga0207708_10232773 | Ga0207708_102327732 | 257 |
| 118 | 3300046463 | Ga0495653_0392945 | Ga0495653_0392945_88_861 | 257 |
| 119 | 3300046526 | Ga0495666_0130453 | Ga0495666_0130453_23_796 | 257 |
| 120 | 3300046531 | Ga0495665_0065538 | Ga0495665_0065538_17_790 | 257 |
| 121 | 3300049589 | Ga0501073_0528701 | Ga0501073_0528701_23_796 | 257 |
| 122 | 3300049822 | Ga0501035_0267698 | Ga0501035_0267698_525_1385 | 257 |
| 123 | 3300005937 | Ga0081455_10097189 | Ga0081455_100971893 | 258 |
| 124 | 3300006237 | Ga0097621_100007335 | Ga0097621_1000073357 | 258 |
| 125 | 3300006914 | Ga0075436_100086862 | Ga0075436_1000868622 | 258 |
| 126 | 3300031344 | Ga0265316_10062483 | Ga0265316_100624832 | 258 |
| 127 | 3300006048 | Ga0075363_100074335 | Ga0075363_1000743352 | 260 |
| 128 | 3300050490 | nmdc:mga03n38_119552_c1 | nmdc:mga03n38_119552_c1_286_1068 | 260 |
| 129 | 3300050494 | nmdc:mga06z11_153047_c1 | nmdc:mga06z11_153047_c1_415_1197 | 260 |
| 130 | 3300050494 | nmdc:mga06z11_246075_c1 | nmdc:mga06z11_246075_c1_59_841 | 260 |
| 131 | 3300053098 | Ga0500650_0089458 | Ga0500650_0089458_111_893 | 260 |
| 132 | 3300053103 | Ga0500555_020301 | Ga0500555_020301_194_976 | 260 |
| 133 | 3300049574 | Ga0501038_0141259 | Ga0501038_0141259_587_1372 | 261 |
| 134 | iso_pu_bacteria | 2545555834 | 2545673101 | 261 |
| 135 | iso_pu_bacteria | 641522639 | 641642295 | 261 |
| 136 | iso_pu_bacteria | 643348564 | 643598224 | 261 |
| 137 | 3300049589 | Ga0501073_0027442 | Ga0501073_0027442_1511_2317 | 262 |
| 138 | 3300025972 | Ga0207668_10089270 | Ga0207668_100892704 | 263 |
| 139 | 3300049581 | Ga0501047_0083304 | Ga0501047_0083304_937_1749 | 264 |
| 140 | 3300021384 | Ga0213876_10121845 | Ga0213876_101218452 | 265 |
| 141 | 3300031456 | Ga0307513_10059875 | Ga0307513_100598753 | 265 |
| 142 | 3300005937 | Ga0081455_10004792 | Ga0081455_100047928 | 266 |
| 143 | iso_pu_bacteria | 2513237087 | 2513590375 | 266 |
| 144 | iso_pu_bacteria | 2884298095 | 2884301324 | 266 |
| 145 | 3300005440 | Ga0070705_100233518 | Ga0070705_1002335182 | 267 |
| 146 | 3300005546 | Ga0070696_100020547 | Ga0070696_1000205475 | 267 |
| 147 | 3300009148 | Ga0105243_10213190 | Ga0105243_102131903 | 267 |
| 148 | 3300041411 | Ga0439466_0038786 | Ga0439466_0038786_706_1509 | 267 |
| 149 | 3300049822 | Ga0501035_0654640 | Ga0501035_0654640_15_818 | 267 |
| 150 | iso_pu_bacteria | 2508501114 | 2509077496 | 267 |
| 151 | iso_pu_bacteria | 2643221734 | 2644736040 | 267 |
| 152 | iso_pu_bacteria | 2643221736 | 2644742597 | 267 |
| 153 | iso_pu_bacteria | 2773857925 | 2774868739 | 267 |
| 154 | iso_pu_bacteria | 2775506901 | 2776258345 | 267 |
| 155 | iso_pu_bacteria | 2818991467 | 2819722079 | 267 |
| 156 | iso_pu_bacteria | 2835312727 | 2835318518 | 267 |
| 157 | iso_pu_bacteria | 2841760612 | 2841764002 | 267 |
| 158 | iso_pu_bacteria | 2841911363 | 2841915533 | 267 |
| 159 | iso_pu_bacteria | 2841917233 | 2841920735 | 267 |
| 160 | iso_pu_bacteria | 2844104063 | 2844108543 | 267 |
| 161 | iso_pu_bacteria | 2851182111 | 2851185243 | 267 |
| 162 | iso_pu_bacteria | 2851246043 | 2851250437 | 267 |
| 163 | iso_pu_bacteria | 2882456835 | 2882457573 | 267 |
| 164 | iso_pu_bacteria | 2891088606 | 2891088799 | 267 |
| 165 | iso_pu_bacteria | 2894232714 | 2894235964 | 267 |
| 166 | iso_pu_bacteria | 2909042592 | 2909046797 | 267 |
| 167 | iso_pu_bacteria | 2917699015 | 2917701910 | 267 |
| 168 | iso_pu_bacteria | 8001845381 | 8001848087 | 267 |
| 169 | iso_pu_bacteria | 8002060224 | 8002061883 | 267 |
| 170 | iso_pu_bacteria | 8057529695 | 8057534074 | 267 |
| 171 | 3300035116 | Ga0373945_0028317 | Ga0373945_0028317_950_1756 | 268 |
| 172 | 3300035725 | Ga0373947_0208421 | Ga0373947_0208421_316_1122 | 268 |
| 173 | 3300046514 | Ga0495618_0109378 | Ga0495618_0109378_395_1201 | 268 |
| 174 | 3300046517 | Ga0495630_0136145 | Ga0495630_0136145_596_1402 | 268 |
| 175 | 3300046533 | Ga0495640_0090705 | Ga0495640_0090705_596_1402 | 268 |
| 176 | 3300048904 | Ga0496101_0005822 | Ga0496101_0005822_6795_7601 | 268 |
| 177 | 3300048907 | Ga0496104_0000352 | Ga0496104_0000352_33959_34765 | 268 |
| 178 | 3300048907 | Ga0496104_0001360 | Ga0496104_0001360_8145_8951 | 268 |
| 179 | 3300048907 | Ga0496104_0631278 | Ga0496104_0631278_42_848 | 268 |
| 180 | 3300048908 | Ga0496105_0000295 | Ga0496105_0000295_27763_28569 | 268 |
| 181 | 3300048908 | Ga0496105_0000498 | Ga0496105_0000498_20737_21543 | 268 |
| 182 | 3300048908 | Ga0496105_0009338 | Ga0496105_0009338_6634_7440 | 268 |
| 183 | 3300048911 | Ga0496108_0188192 | Ga0496108_0188192_91_897 | 268 |
| 184 | 3300048912 | Ga0496109_0096362 | Ga0496109_0096362_1844_2650 | 268 |
| 185 | 3300048914 | Ga0496111_0194488 | Ga0496111_0194488_437_1243 | 268 |
| 186 | 3300048915 | Ga0496112_0012247 | Ga0496112_0012247_1533_2339 | 268 |
| 187 | 3300048915 | Ga0496112_0038371 | Ga0496112_0038371_209_1015 | 268 |
| 188 | 3300048916 | Ga0496113_0008690 | Ga0496113_0008690_3644_4450 | 268 |
| 189 | 3300048916 | Ga0496113_0333584 | Ga0496113_0333584_75_881 | 268 |
| 190 | 3300048918 | Ga0496115_0054133 | Ga0496115_0054133_638_1444 | 268 |
| 191 | 3300048918 | Ga0496115_0072357 | Ga0496115_0072357_955_1761 | 268 |
| 192 | 3300048922 | Ga0496119_0000483 | Ga0496119_0000483_17555_18361 | 268 |
| 193 | 3300049570 | Ga0501033_0112706 | Ga0501033_0112706_906_1712 | 268 |
| 194 | 3300049571 | Ga0501034_0144169 | Ga0501034_0144169_1152_1958 | 268 |
| 195 | 3300049572 | Ga0501036_0232553 | Ga0501036_0232553_638_1444 | 268 |
| 196 | 3300049583 | Ga0501067_0007392 | Ga0501067_0007392_355_1161 | 268 |
| 197 | 3300049586 | Ga0501070_0127120 | Ga0501070_0127120_1226_2032 | 268 |
| 198 | 3300049589 | Ga0501073_0065939 | Ga0501073_0065939_714_1520 | 268 |
| 199 | 3300049592 | Ga0501076_0062628 | Ga0501076_0062628_2055_2861 | 268 |
| 200 | 3300049822 | Ga0501035_0131144 | Ga0501035_0131144_1244_2050 | 268 |
| 201 | 3300049823 | Ga0501044_0228461 | Ga0501044_0228461_766_1572 | 268 |
| 202 | 3300050512 | nmdc:mga0n895_339891_c1 | nmdc:mga0n895_339891_c1_607_1425 | 268 |
| 203 | 3300053077 | Ga0495601_0020265 | Ga0495601_0020265_543_1349 | 268 |
| 204 | 3300054114 | Ga0501084_0078122 | Ga0501084_0078122_1705_2511 | 268 |
| 205 | 3300060353 | Ga0501082_0029624 | Ga0501082_0029624_2471_3277 | 268 |
| 206 | 3300005456 | Ga0070678_100609018 | Ga0070678_1006090181 | 269 |
| 207 | 3300005841 | Ga0068863_100241830 | Ga0068863_1002418303 | 269 |
| 208 | 3300009176 | Ga0105242_10457075 | Ga0105242_104570751 | 269 |
| 209 | 3300026088 | Ga0207641_10815704 | Ga0207641_108157041 | 269 |
| 210 | 3300031239 | Ga0265328_10011043 | Ga0265328_100110433 | 269 |
| 211 | 3300031241 | Ga0265325_10051461 | Ga0265325_100514612 | 269 |
| 212 | 3300031247 | Ga0265340_10142496 | Ga0265340_101424961 | 269 |
| 213 | 3300031249 | Ga0265339_10002208 | Ga0265339_1000220813 | 269 |
| 214 | 3300031250 | Ga0265331_10000007 | Ga0265331_1000000754 | 269 |
| 215 | 3300031595 | Ga0265313_10002423 | Ga0265313_100024239 | 269 |
| 216 | 3300035088 | Ga0373940_0038989 | Ga0373940_0038989_272_1081 | 269 |
| 217 | 3300046474 | Ga0495605_0074017 | Ga0495605_0074017_555_1364 | 269 |
| 218 | 3300046557 | Ga0495622_0001360 | Ga0495622_0001360_1003_1812 | 269 |
| 219 | 3300046648 | Ga0495611_0084959 | Ga0495611_0084959_30_839 | 269 |
| 220 | 3300046694 | Ga0495649_0053494 | Ga0495649_0053494_83_892 | 269 |
| 221 | 3300049573 | Ga0501037_0050257 | Ga0501037_0050257_1884_2693 | 269 |
| 222 | 3300049581 | Ga0501047_0012474 | Ga0501047_0012474_6902_7723 | 269 |
| 223 | 3300049586 | Ga0501070_0054407 | Ga0501070_0054407_765_1574 | 269 |
| 224 | 3300049586 | Ga0501070_0067324 | Ga0501070_0067324_34_855 | 269 |
| 225 | 3300049589 | Ga0501073_0120561 | Ga0501073_0120561_649_1470 | 269 |
| 226 | 3300049590 | Ga0501074_0102785 | Ga0501074_0102785_497_1318 | 269 |
| 227 | 3300049593 | Ga0501077_0128278 | Ga0501077_0128278_705_1523 | 269 |
| 228 | 3300049742 | Ga0501080_0077906 | Ga0501080_0077906_1207_2016 | 269 |
| 229 | 3300049742 | Ga0501080_0309998 | Ga0501080_0309998_528_1349 | 269 |
| 230 | 3300049822 | Ga0501035_0445842 | Ga0501035_0445842_20_841 | 269 |
| 231 | 3300053178 | Ga0500637_0002549 | Ga0500637_0002549_6050_6859 | 269 |
| 232 | 3300060353 | Ga0501082_0247110 | Ga0501082_0247110_139_951 | 269 |
| 233 | 3300005367 | Ga0070667_100288111 | Ga0070667_1002881111 | 270 |
| 234 | 3300005548 | Ga0070665_100025159 | Ga0070665_1000251593 | 270 |
| 235 | 3300006844 | Ga0075428_100338120 | Ga0075428_1003381201 | 270 |
| 236 | 3300006847 | Ga0075431_100018281 | Ga0075431_1000182814 | 270 |
| 237 | 3300006847 | Ga0075431_100568894 | Ga0075431_1005688941 | 270 |
| 238 | 3300009147 | Ga0114129_10081364 | Ga0114129_100813644 | 270 |
| 239 | 3300025986 | Ga0207658_10294600 | Ga0207658_102946002 | 270 |
| 240 | 3300028381 | Ga0268264_10645366 | Ga0268264_106453661 | 270 |
| 241 | 3300035695 | Ga0373927_0128812 | Ga0373927_0128812_277_1089 | 270 |
| 242 | 3300049590 | Ga0501074_0077463 | Ga0501074_0077463_865_1677 | 270 |
| 243 | 3300049592 | Ga0501076_0078634 | Ga0501076_0078634_1112_1924 | 270 |
| 244 | 3300049592 | Ga0501076_0137018 | Ga0501076_0137018_1119_1931 | 270 |
| 245 | 3300049742 | Ga0501080_0019521 | Ga0501080_0019521_2456_3268 | 270 |
| 246 | 3300049743 | Ga0501081_0376277 | Ga0501081_0376277_206_1018 | 270 |
| 247 | 3300049744 | Ga0501083_0000940 | Ga0501083_0000940_11874_12686 | 270 |
| 248 | 3300049744 | Ga0501083_0201037 | Ga0501083_0201037_208_1020 | 270 |
| 249 | 3300050507 | nmdc:mga05p37_144428_c1 | nmdc:mga05p37_144428_c1_1641_2465 | 270 |
| 250 | 3300050509 | nmdc:mga0qj67_4938_c1 | nmdc:mga0qj67_4938_c1_3390_4217 | 270 |
| 251 | 3300050510 | nmdc:mga06r32_3841_c1 | nmdc:mga06r32_3841_c1_5516_6343 | 270 |
| 252 | 3300050510 | nmdc:mga06r32_400795_c1 | nmdc:mga06r32_400795_c1_223_1047 | 270 |
| 253 | 3300060353 | Ga0501082_0081705 | Ga0501082_0081705_1199_2011 | 270 |
| 254 | 3300060353 | Ga0501082_0085570 | Ga0501082_0085570_1083_1895 | 270 |
| 255 | 3300001979 | JGI24740J21852_10024533 | JGI24740J21852_100245332 | 271 |
| 256 | 3300002739 | JGI25158J39367_1000444 | JGI25158J39367_10004442 | 271 |
| 257 | 3300002773 | JGI25152J39213_1001036 | JGI25152J39213_10010364 | 271 |
| 258 | 3300003578 | Ga0006562J51391_1019409 | Ga0006562J51391_10194092 | 271 |
| 259 | 3300003578 | Ga0006562J51391_1019411 | Ga0006562J51391_10194111 | 271 |
| 260 | 3300005334 | Ga0068869_100088513 | Ga0068869_1000885132 | 271 |
| 261 | 3300005336 | Ga0070680_100003095 | Ga0070680_1000030953 | 271 |
| 262 | 3300005336 | Ga0070680_100015789 | Ga0070680_1000157893 | 271 |
| 263 | 3300005337 | Ga0070682_100000325 | Ga0070682_10000032514 | 271 |
| 264 | 3300005338 | Ga0068868_100049355 | Ga0068868_1000493553 | 271 |
| 265 | 3300005339 | Ga0070660_100093228 | Ga0070660_1000932284 | 271 |
| 266 | 3300005347 | Ga0070668_100329346 | Ga0070668_1003293461 | 271 |
| 267 | 3300005355 | Ga0070671_100059347 | Ga0070671_1000593472 | 271 |
| 268 | 3300005356 | Ga0070674_100151493 | Ga0070674_1001514932 | 271 |
| 269 | 3300005364 | Ga0070673_100015351 | Ga0070673_1000153514 | 271 |
| 270 | 3300005366 | Ga0070659_100139144 | Ga0070659_1001391444 | 271 |
| 271 | 3300005434 | Ga0070709_10004283 | Ga0070709_100042833 | 271 |
| 272 | 3300005435 | Ga0070714_100192600 | Ga0070714_1001926002 | 271 |
| 273 | 3300005436 | Ga0070713_100000710 | Ga0070713_1000007106 | 271 |
| 274 | 3300005436 | Ga0070713_100113050 | Ga0070713_1001130502 | 271 |
| 275 | 3300005436 | Ga0070713_100143630 | Ga0070713_1001436302 | 271 |
| 276 | 3300005437 | Ga0070710_10076497 | Ga0070710_100764972 | 271 |
| 277 | 3300005439 | Ga0070711_100025551 | Ga0070711_1000255513 | 271 |
| 278 | 3300005439 | Ga0070711_100316956 | Ga0070711_1003169561 | 271 |
| 279 | 3300005455 | Ga0070663_100046596 | Ga0070663_1000465963 | 271 |
| 280 | 3300005456 | Ga0070678_100450921 | Ga0070678_1004509212 | 271 |
| 281 | 3300005457 | Ga0070662_100106633 | Ga0070662_1001066331 | 271 |
| 282 | 3300005458 | Ga0070681_10099814 | Ga0070681_100998143 | 271 |
| 283 | 3300005466 | Ga0070685_10005299 | Ga0070685_100052992 | 271 |
| 284 | 3300005530 | Ga0070679_100012384 | Ga0070679_1000123843 | 271 |
| 285 | 3300005530 | Ga0070679_100093362 | Ga0070679_1000933624 | 271 |
| 286 | 3300005539 | Ga0068853_100000927 | Ga0068853_10000092710 | 271 |
| 287 | 3300005539 | Ga0068853_100165084 | Ga0068853_1001650843 | 271 |
| 288 | 3300005543 | Ga0070672_100251684 | Ga0070672_1002516842 | 271 |
| 289 | 3300005546 | Ga0070696_100071543 | Ga0070696_1000715432 | 271 |
| 290 | 3300005547 | Ga0070693_100079016 | Ga0070693_1000790162 | 271 |
| 291 | 3300005547 | Ga0070693_100113285 | Ga0070693_1001132852 | 271 |
| 292 | 3300005578 | Ga0068854_100273317 | Ga0068854_1002733171 | 271 |
| 293 | 3300005614 | Ga0068856_100044923 | Ga0068856_1000449234 | 271 |
| 294 | 3300005615 | Ga0070702_100002584 | Ga0070702_1000025847 | 271 |
| 295 | 3300005842 | Ga0068858_100116237 | Ga0068858_1001162374 | 271 |
| 296 | 3300005844 | Ga0068862_100138064 | Ga0068862_1001380643 | 271 |
| 297 | 3300006038 | Ga0075365_10374879 | Ga0075365_103748792 | 271 |
| 298 | 3300006163 | Ga0070715_10030309 | Ga0070715_100303093 | 271 |
| 299 | 3300006163 | Ga0070715_10122339 | Ga0070715_101223392 | 271 |
| 300 | 3300006173 | Ga0070716_100001066 | Ga0070716_1000010667 | 271 |
| 301 | 3300006175 | Ga0070712_100004156 | Ga0070712_1000041568 | 271 |
| 302 | 3300006175 | Ga0070712_100062512 | Ga0070712_1000625121 | 271 |
| 303 | 3300006175 | Ga0070712_100085094 | Ga0070712_1000850942 | 271 |
| 304 | 3300006175 | Ga0070712_100138151 | Ga0070712_1001381513 | 271 |
| 305 | 3300006237 | Ga0097621_100105056 | Ga0097621_1001050562 | 271 |
| 306 | 3300006358 | Ga0068871_100005222 | Ga0068871_1000052229 | 271 |
| 307 | 3300006846 | Ga0075430_100101579 | Ga0075430_1001015795 | 271 |
| 308 | 3300006847 | Ga0075431_100029270 | Ga0075431_1000292703 | 271 |
| 309 | 3300006880 | Ga0075429_100002407 | Ga0075429_10000240716 | 271 |
| 310 | 3300009011 | Ga0105251_10012277 | Ga0105251_100122773 | 271 |
| 311 | 3300009094 | Ga0111539_10000115 | Ga0111539_1000011564 | 271 |
| 312 | 3300009094 | Ga0111539_10349241 | Ga0111539_103492411 | 271 |
| 313 | 3300009147 | Ga0114129_10001209 | Ga0114129_100012097 | 271 |
| 314 | 3300009148 | Ga0105243_10029150 | Ga0105243_100291504 | 271 |
| 315 | 3300009174 | Ga0105241_10020240 | Ga0105241_100202407 | 271 |
| 316 | 3300009174 | Ga0105241_10105690 | Ga0105241_101056903 | 271 |
| 317 | 3300009551 | Ga0105238_10233006 | Ga0105238_102330062 | 271 |
| 318 | 3300012515 | Ga0157338_1000769 | Ga0157338_10007693 | 271 |
| 319 | 3300013104 | Ga0157370_10354246 | Ga0157370_103542462 | 271 |
| 320 | 3300013250 | Ga0171462_1015 | Ga0171462_101562 | 271 |
| 321 | 3300013307 | Ga0157372_10002662 | Ga0157372_1000266220 | 271 |
| 322 | 3300014326 | Ga0157380_10317133 | Ga0157380_103171332 | 271 |
| 323 | 3300017792 | Ga0163161_10047082 | Ga0163161_100470823 | 271 |
| 324 | 3300021384 | Ga0213876_10014594 | Ga0213876_100145945 | 271 |
| 325 | 3300024227 | Ga0228598_1000380 | Ga0228598_10003806 | 271 |
| 326 | 3300025898 | Ga0207692_10055610 | Ga0207692_100556102 | 271 |
| 327 | 3300025901 | Ga0207688_10086325 | Ga0207688_100863252 | 271 |
| 328 | 3300025904 | Ga0207647_10100472 | Ga0207647_101004722 | 271 |
| 329 | 3300025905 | Ga0207685_10007409 | Ga0207685_100074094 | 271 |
| 330 | 3300025906 | Ga0207699_10000275 | Ga0207699_1000027520 | 271 |
| 331 | 3300025906 | Ga0207699_10124875 | Ga0207699_101248752 | 271 |
| 332 | 3300025912 | Ga0207707_10122640 | Ga0207707_101226403 | 271 |
| 333 | 3300025915 | Ga0207693_10002367 | Ga0207693_1000236711 | 271 |
| 334 | 3300025916 | Ga0207663_10028187 | Ga0207663_100281873 | 271 |
| 335 | 3300025916 | Ga0207663_10155456 | Ga0207663_101554562 | 271 |
| 336 | 3300025917 | Ga0207660_10203959 | Ga0207660_102039592 | 271 |
| 337 | 3300025919 | Ga0207657_10027857 | Ga0207657_100278577 | 271 |
| 338 | 3300025919 | Ga0207657_10057016 | Ga0207657_100570162 | 271 |
| 339 | 3300025921 | Ga0207652_10350383 | Ga0207652_103503831 | 271 |
| 340 | 3300025921 | Ga0207652_10385697 | Ga0207652_103856971 | 271 |
| 341 | 3300025925 | Ga0207650_10087550 | Ga0207650_100875502 | 271 |
| 342 | 3300025926 | Ga0207659_10025129 | Ga0207659_100251295 | 271 |
| 343 | 3300025927 | Ga0207687_10250192 | Ga0207687_102501921 | 271 |
| 344 | 3300025928 | Ga0207700_10012436 | Ga0207700_100124365 | 271 |
| 345 | 3300025928 | Ga0207700_10080152 | Ga0207700_100801523 | 271 |
| 346 | 3300025929 | Ga0207664_10019573 | Ga0207664_100195735 | 271 |
| 347 | 3300025931 | Ga0207644_10016802 | Ga0207644_100168022 | 271 |
| 348 | 3300025931 | Ga0207644_10020596 | Ga0207644_100205966 | 271 |
| 349 | 3300025933 | Ga0207706_10064539 | Ga0207706_100645394 | 271 |
| 350 | 3300025933 | Ga0207706_10157511 | Ga0207706_101575113 | 271 |
| 351 | 3300025933 | Ga0207706_10275950 | Ga0207706_102759502 | 271 |
| 352 | 3300025937 | Ga0207669_10069245 | Ga0207669_100692452 | 271 |
| 353 | 3300025939 | Ga0207665_10001144 | Ga0207665_1000114413 | 271 |
| 354 | 3300025939 | Ga0207665_10087343 | Ga0207665_100873432 | 271 |
| 355 | 3300025940 | Ga0207691_10239155 | Ga0207691_102391552 | 271 |
| 356 | 3300025941 | Ga0207711_10366166 | Ga0207711_103661661 | 271 |
| 357 | 3300025942 | Ga0207689_10006586 | Ga0207689_100065863 | 271 |
| 358 | 3300025949 | Ga0207667_10143638 | Ga0207667_101436383 | 271 |
| 359 | 3300025960 | Ga0207651_10007088 | Ga0207651_100070882 | 271 |
| 360 | 3300025960 | Ga0207651_10186175 | Ga0207651_101861753 | 271 |
| 361 | 3300026035 | Ga0207703_10046398 | Ga0207703_100463985 | 271 |
| 362 | 3300026041 | Ga0207639_10291700 | Ga0207639_102917002 | 271 |
| 363 | 3300026067 | Ga0207678_10005212 | Ga0207678_100052123 | 271 |
| 364 | 3300026067 | Ga0207678_10461173 | Ga0207678_104611731 | 271 |
| 365 | 3300026095 | Ga0207676_10130943 | Ga0207676_101309432 | 271 |
| 366 | 3300027907 | Ga0207428_10123899 | Ga0207428_101238993 | 271 |
| 367 | 3300031241 | Ga0265325_10000238 | Ga0265325_1000023847 | 271 |
| 368 | 3300031548 | Ga0307408_100043956 | Ga0307408_1000439563 | 271 |
| 369 | 3300031548 | Ga0307408_100233416 | Ga0307408_1002334162 | 271 |
| 370 | 3300031852 | Ga0307410_10110103 | Ga0307410_101101033 | 271 |
| 371 | 3300031901 | Ga0307406_10114316 | Ga0307406_101143163 | 271 |
| 372 | 3300031911 | Ga0307412_10161954 | Ga0307412_101619542 | 271 |
| 373 | 3300031995 | Ga0307409_100140221 | Ga0307409_1001402213 | 271 |
| 374 | 3300032002 | Ga0307416_100187466 | Ga0307416_1001874662 | 271 |
| 375 | 3300032004 | Ga0307414_10097905 | Ga0307414_100979051 | 271 |
| 376 | 3300032005 | Ga0307411_10033825 | Ga0307411_100338253 | 271 |
| 377 | 3300032126 | Ga0307415_100368506 | Ga0307415_1003685062 | 271 |
| 378 | 3300034957 | Ga0373938_0015409 | Ga0373938_0015409_143_958 | 271 |
| 379 | 3300035089 | Ga0373944_0005793 | Ga0373944_0005793_2383_3210 | 271 |
| 380 | 3300035117 | Ga0373953_0021984 | Ga0373953_0021984_1091_1918 | 271 |
| 381 | 3300035119 | Ga0373956_0047690 | Ga0373956_0047690_106_933 | 271 |
| 382 | 3300035170 | Ga0373943_0001159 | Ga0373943_0001159_1018_1845 | 271 |
| 383 | 3300035171 | Ga0373946_0002367 | Ga0373946_0002367_176_1003 | 271 |
| 384 | 3300035410 | Ga0373924_0046675 | Ga0373924_0046675_779_1606 | 271 |
| 385 | 3300035410 | Ga0373924_0123877 | Ga0373924_0123877_15_842 | 271 |
| 386 | 3300035695 | Ga0373927_0077244 | Ga0373927_0077244_347_1174 | 271 |
| 387 | 3300035724 | Ga0373933_0303044 | Ga0373933_0303044_119_946 | 271 |
| 388 | 3300035725 | Ga0373947_0005019 | Ga0373947_0005019_5959_6786 | 271 |
| 389 | 3300036401 | Ga0373937_0019748 | Ga0373937_0019748_4050_4877 | 271 |
| 390 | 3300037068 | Ga0373925_0001534 | Ga0373925_0001534_872_1699 | 271 |
| 391 | 3300039437 | Ga0436365_1681640 | Ga0436365_1681640_3530_4345 | 271 |
| 392 | 3300042005 | Ga0439448_0032022 | Ga0439448_0032022_558_1373 | 271 |
| 393 | 3300044684 | Ga0466966_0141525 | Ga0466966_0141525_29_874 | 271 |
| 394 | 3300046459 | Ga0495629_0130513 | Ga0495629_0130513_123_950 | 271 |
| 395 | 3300046463 | Ga0495653_0123313 | Ga0495653_0123313_974_1801 | 271 |
| 396 | 3300046476 | Ga0495662_0005479 | Ga0495662_0005479_652_1479 | 271 |
| 397 | 3300046477 | Ga0495664_0002153 | Ga0495664_0002153_9084_9911 | 271 |
| 398 | 3300046477 | Ga0495664_0042051 | Ga0495664_0042051_1502_2329 | 271 |
| 399 | 3300046499 | Ga0495594_0093033 | Ga0495594_0093033_490_1305 | 271 |
| 400 | 3300046511 | Ga0495608_0143770 | Ga0495608_0143770_357_1184 | 271 |
| 401 | 3300046512 | Ga0495610_0028209 | Ga0495610_0028209_716_1531 | 271 |
| 402 | 3300046514 | Ga0495618_0001760 | Ga0495618_0001760_1049_1876 | 271 |
| 403 | 3300046516 | Ga0495628_0236571 | Ga0495628_0236571_476_1303 | 271 |
| 404 | 3300046517 | Ga0495630_0081458 | Ga0495630_0081458_902_1729 | 271 |
| 405 | 3300046517 | Ga0495630_0140866 | Ga0495630_0140866_566_1393 | 271 |
| 406 | 3300046529 | Ga0495652_0012826 | Ga0495652_0012826_1951_2778 | 271 |
| 407 | 3300046529 | Ga0495652_0128826 | Ga0495652_0128826_174_1001 | 271 |
| 408 | 3300046531 | Ga0495665_0035029 | Ga0495665_0035029_734_1561 | 271 |
| 409 | 3300046533 | Ga0495640_0040029 | Ga0495640_0040029_2020_2847 | 271 |
| 410 | 3300046535 | Ga0495586_0097959 | Ga0495586_0097959_725_1552 | 271 |
| 411 | 3300046543 | Ga0495645_0001651 | Ga0495645_0001651_6939_7766 | 271 |
| 412 | 3300046543 | Ga0495645_0154019 | Ga0495645_0154019_568_1395 | 271 |
| 413 | 3300046663 | Ga0495635_0056324 | Ga0495635_0056324_1622_2449 | 271 |
| 414 | 3300046679 | Ga0495623_0066383 | Ga0495623_0066383_1092_1919 | 271 |
| 415 | 3300046681 | Ga0495647_0036742 | Ga0495647_0036742_942_1769 | 271 |
| 416 | 3300046809 | Ga0495600_0019140 | Ga0495600_0019140_1980_2807 | 271 |
| 417 | 3300047315 | Ga0495581_0019057 | Ga0495581_0019057_2125_2952 | 271 |
| 418 | 3300047319 | Ga0495674_0013772 | Ga0495674_0013772_2001_2828 | 271 |
| 419 | 3300047319 | Ga0495674_0111154 | Ga0495674_0111154_1430_2257 | 271 |
| 420 | 3300047471 | Ga0495684_0049283 | Ga0495684_0049283_1451_2278 | 271 |
| 421 | 3300048903 | Ga0496100_0018258 | Ga0496100_0018258_1779_2594 | 271 |
| 422 | 3300048905 | Ga0496102_0047171 | Ga0496102_0047171_2852_3667 | 271 |
| 423 | 3300048907 | Ga0496104_0031281 | Ga0496104_0031281_1779_2594 | 271 |
| 424 | 3300048909 | Ga0496106_0020197 | Ga0496106_0020197_2369_3184 | 271 |
| 425 | 3300048910 | Ga0496107_0050133 | Ga0496107_0050133_443_1258 | 271 |
| 426 | 3300048911 | Ga0496108_0035079 | Ga0496108_0035079_1575_2390 | 271 |
| 427 | 3300048913 | Ga0496110_0041912 | Ga0496110_0041912_227_1042 | 271 |
| 428 | 3300048914 | Ga0496111_0015406 | Ga0496111_0015406_2537_3352 | 271 |
| 429 | 3300048915 | Ga0496112_0054114 | Ga0496112_0054114_1779_2594 | 271 |
| 430 | 3300048915 | Ga0496112_0160504 | Ga0496112_0160504_919_1734 | 271 |
| 431 | 3300048918 | Ga0496115_0044085 | Ga0496115_0044085_753_1580 | 271 |
| 432 | 3300048918 | Ga0496115_0355056 | Ga0496115_0355056_316_1131 | 271 |
| 433 | 3300048920 | Ga0496117_0031338 | Ga0496117_0031338_211_1026 | 271 |
| 434 | 3300048926 | Ga0496123_0107023 | Ga0496123_0107023_554_1369 | 271 |
| 435 | 3300048929 | Ga0496126_0372538 | Ga0496126_0372538_175_990 | 271 |
| 436 | 3300049569 | Ga0501032_0061484 | Ga0501032_0061484_26_841 | 271 |
| 437 | 3300049570 | Ga0501033_0148748 | Ga0501033_0148748_584_1399 | 271 |
| 438 | 3300049570 | Ga0501033_0168135 | Ga0501033_0168135_713_1528 | 271 |
| 439 | 3300049570 | Ga0501033_0257482 | Ga0501033_0257482_329_1150 | 271 |
| 440 | 3300049571 | Ga0501034_0082307 | Ga0501034_0082307_340_1155 | 271 |
| 441 | 3300049571 | Ga0501034_0226277 | Ga0501034_0226277_632_1447 | 271 |
| 442 | 3300049571 | Ga0501034_0374040 | Ga0501034_0374040_425_1246 | 271 |
| 443 | 3300049571 | Ga0501034_0403473 | Ga0501034_0403473_29_844 | 271 |
| 444 | 3300049572 | Ga0501036_0118099 | Ga0501036_0118099_623_1438 | 271 |
| 445 | 3300049573 | Ga0501037_0008896 | Ga0501037_0008896_4820_5635 | 271 |
| 446 | 3300049573 | Ga0501037_0153514 | Ga0501037_0153514_768_1583 | 271 |
| 447 | 3300049574 | Ga0501038_0179106 | Ga0501038_0179106_49_864 | 271 |
| 448 | 3300049575 | Ga0501039_0150536 | Ga0501039_0150536_53_874 | 271 |
| 449 | 3300049575 | Ga0501039_0248957 | Ga0501039_0248957_35_850 | 271 |
| 450 | 3300049577 | Ga0501041_0083493 | Ga0501041_0083493_479_1318 | 271 |
| 451 | 3300049578 | Ga0501042_0106091 | Ga0501042_0106091_174_1013 | 271 |
| 452 | 3300049579 | Ga0501043_0053079 | Ga0501043_0053079_107_922 | 271 |
| 453 | 3300049580 | Ga0501046_0001578 | Ga0501046_0001578_12577_13392 | 271 |
| 454 | 3300049581 | Ga0501047_0230989 | Ga0501047_0230989_41_856 | 271 |
| 455 | 3300049582 | Ga0501048_0048329 | Ga0501048_0048329_32_853 | 271 |
| 456 | 3300049585 | Ga0501069_0003295 | Ga0501069_0003295_736_1551 | 271 |
| 457 | 3300049586 | Ga0501070_0022871 | Ga0501070_0022871_3418_4233 | 271 |
| 458 | 3300049586 | Ga0501070_0197870 | Ga0501070_0197870_341_1156 | 271 |
| 459 | 3300049586 | Ga0501070_0311006 | Ga0501070_0311006_127_942 | 271 |
| 460 | 3300049587 | Ga0501071_0073381 | Ga0501071_0073381_972_1787 | 271 |
| 461 | 3300049587 | Ga0501071_0527876 | Ga0501071_0527876_64_885 | 271 |
| 462 | 3300049589 | Ga0501073_0122697 | Ga0501073_0122697_142_957 | 271 |
| 463 | 3300049591 | Ga0501075_0122040 | Ga0501075_0122040_826_1665 | 271 |
| 464 | 3300049592 | Ga0501076_0022154 | Ga0501076_0022154_1593_2414 | 271 |
| 465 | 3300049593 | Ga0501077_0003865 | Ga0501077_0003865_7168_7989 | 271 |
| 466 | 3300049741 | Ga0501079_0047049 | Ga0501079_0047049_644_1465 | 271 |
| 467 | 3300049742 | Ga0501080_0017640 | Ga0501080_0017640_2236_3057 | 271 |
| 468 | 3300049742 | Ga0501080_0355344 | Ga0501080_0355344_363_1178 | 271 |
| 469 | 3300049743 | Ga0501081_0063088 | Ga0501081_0063088_756_1577 | 271 |
| 470 | 3300049744 | Ga0501083_0202398 | Ga0501083_0202398_227_1042 | 271 |
| 471 | 3300049822 | Ga0501035_0001208 | Ga0501035_0001208_21472_22287 | 271 |
| 472 | 3300049822 | Ga0501035_0143049 | Ga0501035_0143049_599_1414 | 271 |
| 473 | 3300049823 | Ga0501044_0000122 | Ga0501044_0000122_31363_32178 | 271 |
| 474 | 3300049823 | Ga0501044_0245667 | Ga0501044_0245667_613_1434 | 271 |
| 475 | 3300049824 | Ga0501045_0029529 | Ga0501045_0029529_1597_2412 | 271 |
| 476 | 3300050491 | nmdc:mga00v17_271441_c1 | nmdc:mga00v17_271441_c1_213_1028 | 271 |
| 477 | 3300050491 | nmdc:mga00v17_398454_c1 | nmdc:mga00v17_398454_c1_52_867 | 271 |
| 478 | 3300050492 | nmdc:mga0yw44_202838_c1 | nmdc:mga0yw44_202838_c1_203_1018 | 271 |
| 479 | 3300050496 | nmdc:mga07m45_266770_c1 | nmdc:mga07m45_266770_c1_18_839 | 271 |
| 480 | 3300050507 | nmdc:mga05p37_7481_c1 | nmdc:mga05p37_7481_c1_3622_4437 | 271 |
| 481 | 3300050508 | nmdc:mga09592_1529_c1 | nmdc:mga09592_1529_c1_13362_14177 | 271 |
| 482 | 3300050509 | nmdc:mga0qj67_263920_c1 | nmdc:mga0qj67_263920_c1_197_1012 | 271 |
| 483 | 3300050510 | nmdc:mga06r32_47_c1 | nmdc:mga06r32_47_c1_2138_2953 | 271 |
| 484 | 3300050511 | nmdc:mga08y16_72_c1 | nmdc:mga08y16_72_c1_27098_27913 | 271 |
| 485 | 3300053077 | Ga0495601_0018199 | Ga0495601_0018199_1287_2114 | 271 |
| 486 | 3300053078 | Ga0495612_0002446 | Ga0495612_0002446_6509_7336 | 271 |
| 487 | 3300053084 | Ga0495595_0091465 | Ga0495595_0091465_224_1051 | 271 |
| 488 | 3300053085 | Ga0495619_0072173 | Ga0495619_0072173_454_1281 | 271 |
| 489 | 3300053153 | Ga0500616_0045484 | Ga0500616_0045484_1462_2277 | 271 |
| 490 | 3300053177 | Ga0500636_0013976 | Ga0500636_0013976_3615_4430 | 271 |
| 491 | 3300053730 | Ga0500645_015225 | Ga0500645_015225_1379_2194 | 271 |
| 492 | 3300054114 | Ga0501084_0004700 | Ga0501084_0004700_10142_10963 | 271 |
| 493 | 3300054114 | Ga0501084_0022961 | Ga0501084_0022961_35_850 | 271 |
| 494 | 3300054114 | Ga0501084_0064745 | Ga0501084_0064745_1170_1985 | 271 |
| 495 | 3300060353 | Ga0501082_0148038 | Ga0501082_0148038_49_864 | 271 |
| 496 | 3300061734 | Ga0530510_0042620 | Ga0530510_0042620_1450_2271 | 271 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ijp-assembly1.cif.gz_B | crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution | 0.9343 | 3 | 269 |
| 3ijp-assembly1.cif.gz_B | crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution | 0.931 | 3 | 269 |
| 5tej-assembly1.cif.gz_A | structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh | 0.9204 | 4 | 271 |
| 5us6-assembly1.cif.gz_D | structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag | 0.92 | 4 | 269 |
| 1arz-assembly1.cif.gz_C | escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate | 0.9196 | 1 | 271 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ijpA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9742 | 3 | 267 | 3.40.50.720 |
| 3ijpA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9622 | 3 | 267 | 3.40.50.720 |
| af_P04036_4_119_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9571 | 2 | 116 | 3.40.50.720 |
| af_Q57865_1_131_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9556 | 4 | 126 | 3.40.50.720 |
| 5ugjB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9552 | 4 | 269 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K0VT51-F1-model_v4 | Dihydrodipicolinate reductase (EC 1.17.1.8) | 0.9979 | 2 | 67 |
GO:0008839
GO:0009089 |
| AF-I5BWK1-F1-model_v4 | Dihydrodipicolinate reductase (EC 1.17.1.8) | 0.9933 | 1 | 113 |
GO:0008839
GO:0009089 |
| AF-A0A7X7RKE4-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate reductase | 0.9923 | 4 | 104 |
GO:0008839
GO:0009089 GO:0019877 |
| AF-A0A527ZRZ1-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate reductase | 0.9918 | 3 | 114 |
GO:0005829
GO:0008839 GO:0009089 GO:0019877 |
| AF-A0A530K2W3-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate reductase | 0.9912 | 3 | 74 |
GO:0008839
GO:0009089 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar