F454930

General Info

Members Datasets Scaffolds Average Seq Length
496 328 468 266

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0141525|Ga0466966_0141525_29_874
Length 281
Sequence MSEMRLVVVGAAGRMGRMLIRAVAEAEGCRLVGAIERPGSEAIGHDAGLLAGTGLLEVDVTDDPLPVFAQADGVLDFTAPAATVGFAALAAQARIVHVVGTTGLQEADFAKLEAAARHARIVQSGNMSLGVNLLAGLVRRAAATLGADFDIEILEMHHRMKVDAPSGTALLLGEAAAEGRGVRLAEHSVRSRDGHTGPRRSGDIGFATLRGGTVVGEHAVIFAGSGERLELTHKAEDRGIFARGAVRAALWGFDKKPGYYTMADVLGFDQPSFPDIRLETP

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
4 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
5 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
6 2643221734 Bosea sp. Root670 Isolate Unclassified
7 2643221736 Bosea sp. Root483D1 Isolate Unclassified
8 2773857925 Microvirga vignae BR3299 Isolate Unclassified
9 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
10 2818991467 Bosea vestrisii 3192 Isolate Unclassified
11 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
12 2841760612 Bosea sp. Tri-49 Isolate Nodule
13 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
14 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
15 2844104063 Bosea sp. Tri-39 Isolate Nodule
16 2851182111 Bosea sp. Tri-44 Isolate Nodule
17 2851246043 Bosea sp. Tri-54 Isolate Nodule
18 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
19 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
20 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
21 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
22 2909042592 Labrys sp. LIt4 Isolate Nodule
23 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
29 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
99 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
233 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
285 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
302 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
312 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
314 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
315 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
316 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
319 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
320 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
324 641522639 Methylobacterium sp. 4-46 Isolate Nodule
325 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
326 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
327 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
328 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0.6
Isolates 5.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.85
Nodule 3.02
Rhizoplane 6.45
Rhizosphere 80.85
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10024533 3300001979 Bacteria 2045
2 JGI25158J39367_1000444 3300002739 Bacteria 8576
3 JGI25152J39213_1001036 3300002773 Bacteria 13243
4 JGI25151J46595_10022994 3300003187 Bacteria 2577
5 Ga0006562J51391_1019409 3300003578 Bacteria 2281
6 Ga0006562J51391_1019411 3300003578 Bacteria 1000
7 Ga0055526_1001254 3300003771 Bacteria 18211
8 Ga0055524_1000011 3300003775 Bacteria 261442
9 Ga0065165_1000150 3300005262 Bacteria 121992
10 Ga0065707_10111613 3300005295 Bacteria 2389
11 Ga0070676_10105722 3300005328 Bacteria 1745
12 Ga0068869_100088513 3300005334 Bacteria 2324
13 Ga0070666_10003359 3300005335 Bacteria 9707
14 Ga0070680_100003095 3300005336 Bacteria 12348
15 Ga0070680_100015789 3300005336 Bacteria 5928
16 Ga0070682_100000325 3300005337 Bacteria 32746
17 Ga0068868_100049355 3300005338 Bacteria 3302
18 Ga0070660_100093228 3300005339 Bacteria 2378
19 Ga0070692_10135658 3300005345 Bacteria 1388
20 Ga0070668_100329346 3300005347 Bacteria 1287
21 Ga0070675_100127234 3300005354 Bacteria 2168
22 Ga0070671_100059347 3300005355 Bacteria 3184
23 Ga0070674_100151493 3300005356 Bacteria 1750
24 Ga0070673_100015351 3300005364 Bacteria 5376
25 Ga0070659_100139144 3300005366 Bacteria 1976
26 Ga0070667_100288111 3300005367 Bacteria 1476
27 Ga0070709_10004283 3300005434 Bacteria 7694
28 Ga0070709_10248009 3300005434 Bacteria 1281
29 Ga0070714_100192600 3300005435 Bacteria 1861
30 Ga0070713_100000710 3300005436 Bacteria 21366
31 Ga0070713_100113050 3300005436 Bacteria 2370
32 Ga0070713_100143630 3300005436 Bacteria 2116
33 Ga0070710_10076497 3300005437 Bacteria 1943
34 Ga0070711_100025551 3300005439 Bacteria 3866
35 Ga0070711_100316956 3300005439 Bacteria 1245
36 Ga0070705_100233518 3300005440 Bacteria 1281
37 Ga0070700_100150786 3300005441 Bacteria 1590
38 Ga0070663_100046596 3300005455 Bacteria 3068
39 Ga0070678_100084145 3300005456 Bacteria 2420
40 Ga0070678_100450921 3300005456 Bacteria 1127
41 Ga0070678_100609018 3300005456 Bacteria 976
42 Ga0070662_100106633 3300005457 Bacteria 2129
43 Ga0070681_10099814 3300005458 Bacteria 2849
44 Ga0068867_100216440 3300005459 Bacteria 1541
45 Ga0070685_10005299 3300005466 Bacteria 6538
46 Ga0070679_100012384 3300005530 Bacteria 8149
47 Ga0070679_100093362 3300005530 Bacteria 2997
48 Ga0070684_100185160 3300005535 Bacteria 1893
49 Ga0068853_100000927 3300005539 Bacteria 20513
50 Ga0068853_100165084 3300005539 Bacteria 2001
51 Ga0070672_100251684 3300005543 Bacteria 1488
52 Ga0070696_100020547 3300005546 Bacteria 4474
53 Ga0070696_100071543 3300005546 Bacteria 2441
54 Ga0070693_100079016 3300005547 Bacteria 1956
55 Ga0070693_100113285 3300005547 Bacteria 1672
56 Ga0070665_100025159 3300005548 Bacteria 5998
57 Ga0070665_100140738 3300005548 Bacteria 2416
58 Ga0068854_100273317 3300005578 Bacteria 1358
59 Ga0068856_100044923 3300005614 Bacteria 4348
60 Ga0068856_100311289 3300005614 Bacteria 1592
61 Ga0070702_100002584 3300005615 Bacteria 7873
62 Ga0068863_100241830 3300005841 Bacteria 1742
63 Ga0068858_100116237 3300005842 Bacteria 2500
64 Ga0068862_100138064 3300005844 Bacteria 2162
65 Ga0081455_10004792 3300005937 Bacteria 15036
66 Ga0081455_10097189 3300005937 Bacteria 2373
67 Ga0075365_10374879 3300006038 Bacteria 1004
68 Ga0075363_100074335 3300006048 Bacteria 1850
69 Ga0070715_10030309 3300006163 Bacteria 2186
70 Ga0070715_10122339 3300006163 Bacteria 1242
71 Ga0070715_10228916 3300006163 Unclassified 960
72 Ga0070716_100001066 3300006173 Bacteria 12003
73 Ga0070712_100004156 3300006175 Bacteria 8897
74 Ga0070712_100062512 3300006175 Bacteria 2633
75 Ga0070712_100085094 3300006175 Bacteria 2301
76 Ga0070712_100138151 3300006175 Bacteria 1856
77 Ga0097621_100007335 3300006237 Bacteria 7882
78 Ga0097621_100105056 3300006237 Bacteria 2380
79 Ga0068871_100005222 3300006358 Bacteria 9085
80 Ga0075428_100338120 3300006844 Bacteria 1617
81 Ga0075428_100364934 3300006844 Bacteria 1549
82 Ga0075428_100826631 3300006844 Bacteria 984
83 Ga0075430_100101579 3300006846 Bacteria 2401
84 Ga0075431_100018281 3300006847 Bacteria 7132
85 Ga0075431_100029270 3300006847 Bacteria 5667
86 Ga0075431_100568894 3300006847 Bacteria 1119
87 Ga0075434_100187736 3300006871 Bacteria 2087
88 Ga0075429_100002407 3300006880 Bacteria 15758
89 Ga0075436_100086862 3300006914 Bacteria 2172
90 Ga0075435_100081988 3300007076 Bacteria 2650
91 Ga0075435_100193680 3300007076 Bacteria 1721
92 Ga0105251_10012277 3300009011 Bacteria 4855
93 Ga0111539_10000115 3300009094 Bacteria 88645
94 Ga0111539_10349241 3300009094 Bacteria 1721
95 Ga0114129_10001209 3300009147 Bacteria 34278
96 Ga0114129_10081364 3300009147 Bacteria 4502
97 Ga0105243_10029150 3300009148 Bacteria 4243
98 Ga0105243_10213190 3300009148 Bacteria 1702
99 Ga0105241_10020240 3300009174 Bacteria 4915
100 Ga0105241_10105690 3300009174 Bacteria 2246
101 Ga0105241_10378747 3300009174 Bacteria 1236
102 Ga0105242_10457075 3300009176 Bacteria 1205
103 Ga0105248_10054127 3300009177 Bacteria 4500
104 Ga0105238_10233006 3300009551 Bacteria 1818
105 Ga0105249_10214044 3300009553 Bacteria 1893
106 Ga0157345_1001900 3300012498 Bacteria 1462
107 Ga0157338_1000769 3300012515 Bacteria 2057
108 Ga0157370_10354246 3300013104 Bacteria 1353
109 Ga0157369_10223892 3300013105 Bacteria 1968
110 Ga0171462_1015 3300013250 Bacteria 169578
111 Ga0157378_10239571 3300013297 Bacteria 1732
112 Ga0157372_10002662 3300013307 Bacteria 19349
113 Ga0157372_10013771 3300013307 Bacteria 8641
114 Ga0157372_10424791 3300013307 Bacteria 1549
115 Ga0157380_10317133 3300014326 Bacteria 1444
116 Ga0157377_10026832 3300014745 Bacteria 3087
117 Ga0163161_10047082 3300017792 Bacteria 3114
118 Ga0206353_11538153 3300020082 Bacteria 2040
119 Ga0213876_10014594 3300021384 Bacteria 4162
120 Ga0213876_10121845 3300021384 Bacteria 1385
121 Ga0228598_1000380 3300024227 Bacteria 8894
122 Ga0209130_1000187 3300025284 Bacteria 87082
123 Ga0209675_1002076 3300025291 Bacteria 10648
124 Ga0209025_1003913 3300025294 Bacteria 13420
125 Ga0209564_1000369 3300025295 Bacteria 83878
126 Ga0209256_1000317 3300025299 Bacteria 83179
127 Ga0207426_1010718 3300025302 Bacteria 3541
128 Ga0207692_10055610 3300025898 Bacteria 2027
129 Ga0207688_10086325 3300025901 Bacteria 1798
130 Ga0207647_10100472 3300025904 Bacteria 1717
131 Ga0207647_10232963 3300025904 Bacteria 1059
132 Ga0207685_10007409 3300025905 Bacteria 3057
133 Ga0207699_10000275 3300025906 Bacteria 28286
134 Ga0207699_10124875 3300025906 Bacteria 1670
135 Ga0207645_10024629 3300025907 Bacteria 3899
136 Ga0207707_10122640 3300025912 Bacteria 2272
137 Ga0207695_10227136 3300025913 Bacteria 1772
138 Ga0207693_10002367 3300025915 Bacteria 16372
139 Ga0207663_10028187 3300025916 Bacteria 3284
140 Ga0207663_10155456 3300025916 Bacteria 1608
141 Ga0207660_10203959 3300025917 Bacteria 1545
142 Ga0207657_10027857 3300025919 Bacteria 5167
143 Ga0207657_10057016 3300025919 Bacteria 3369
144 Ga0207652_10350383 3300025921 Bacteria 1332
145 Ga0207652_10385697 3300025921 Bacteria 1264
146 Ga0207650_10087550 3300025925 Bacteria 2373
147 Ga0207659_10025129 3300025926 Bacteria 3998
148 Ga0207687_10250192 3300025927 Bacteria 1409
149 Ga0207700_10012436 3300025928 Bacteria 5490
150 Ga0207700_10080152 3300025928 Bacteria 2545
151 Ga0207664_10019573 3300025929 Bacteria 5005
152 Ga0207644_10016802 3300025931 Bacteria 4928
153 Ga0207644_10020596 3300025931 Bacteria 4486
154 Ga0207706_10064539 3300025933 Bacteria 3224
155 Ga0207706_10157511 3300025933 Bacteria 1997
156 Ga0207706_10275950 3300025933 Bacteria 1466
157 Ga0207669_10069245 3300025937 Bacteria 2207
158 Ga0207704_10019872 3300025938 Bacteria 3539
159 Ga0207665_10001144 3300025939 Bacteria 17854
160 Ga0207665_10087343 3300025939 Bacteria 2155
161 Ga0207691_10239155 3300025940 Bacteria 1570
162 Ga0207711_10366166 3300025941 Bacteria 1336
163 Ga0207689_10006586 3300025942 Bacteria 10239
164 Ga0207667_10143638 3300025949 Bacteria 2457
165 Ga0207651_10007088 3300025960 Bacteria 5949
166 Ga0207651_10186175 3300025960 Bacteria 1652
167 Ga0207712_10322917 3300025961 Bacteria 1274
168 Ga0207668_10089270 3300025972 Bacteria 2260
169 Ga0207658_10294600 3300025986 Bacteria 1396
170 Ga0207703_10046398 3300026035 Bacteria 3499
171 Ga0207639_10291700 3300026041 Bacteria 1439
172 Ga0207678_10005212 3300026067 Bacteria 11649
173 Ga0207678_10461173 3300026067 Bacteria 1105
174 Ga0207708_10029680 3300026075 Bacteria 4145
175 Ga0207708_10232773 3300026075 Bacteria 1479
176 Ga0207641_10815704 3300026088 Bacteria 923
177 Ga0207648_10078410 3300026089 Bacteria 2881
178 Ga0207676_10130943 3300026095 Bacteria 2132
179 Ga0207674_10314816 3300026116 Bacteria 1514
180 Ga0207683_10059773 3300026121 Bacteria 3348
181 Ga0207428_10123899 3300027907 Bacteria 1980
182 Ga0268266_10044744 3300028379 Bacteria 3784
183 Ga0268264_10645366 3300028381 Bacteria 1047
184 Ga0265338_10068475 3300028800 Bacteria 3057
185 Ga0265328_10011043 3300031239 Bacteria 3619
186 Ga0265325_10000011 3300031241 Bacteria 150631
187 Ga0265325_10000238 3300031241 Bacteria 39199
188 Ga0265325_10051461 3300031241 Bacteria 2117
189 Ga0265340_10142496 3300031247 Bacteria 1096
190 Ga0265339_10000462 3300031249 Bacteria 31680
191 Ga0265339_10002208 3300031249 Bacteria 14116
192 Ga0265339_10030126 3300031249 Bacteria 3074
193 Ga0265331_10000007 3300031250 Bacteria 331074
194 Ga0265327_10013307 3300031251 Bacteria 5472
195 Ga0265316_10062483 3300031344 Bacteria 2890
196 Ga0265316_10064256 3300031344 Bacteria 2843
197 Ga0265316_10077334 3300031344 Bacteria 2556
198 Ga0307513_10059875 3300031456 Bacteria 4040
199 Ga0307408_100043956 3300031548 Bacteria 3181
200 Ga0307408_100233416 3300031548 Bacteria 1508
201 Ga0265313_10000088 3300031595 Bacteria 90711
202 Ga0265313_10002423 3300031595 Bacteria 16122
203 Ga0265313_10006548 3300031595 Bacteria 8214
204 Ga0265314_10006928 3300031711 Bacteria 9926
205 Ga0307410_10110103 3300031852 Bacteria 1991
206 Ga0307406_10114316 3300031901 Bacteria 1864
207 Ga0307412_10161954 3300031911 Bacteria 1663
208 Ga0307409_100140221 3300031995 Bacteria 2082
209 Ga0307416_100187466 3300032002 Bacteria 1946
210 Ga0307414_10097905 3300032004 Bacteria 2199
211 Ga0307411_10033825 3300032005 Bacteria 3174
212 Ga0307415_100368506 3300032126 Bacteria 1215
213 Ga0373959_0029260 3300034820 Bacteria 1104
214 Ga0373938_0015409 3300034957 Bacteria 1480
215 Ga0373940_0038989 3300035088 Bacteria 1299
216 Ga0373940_0059063 3300035088 Bacteria 1093
217 Ga0373944_0005793 3300035089 Bacteria 3267
218 Ga0373949_0009178 3300035090 Bacteria 2168
219 Ga0373951_0027208 3300035091 Bacteria 1334
220 Ga0373939_0001208 3300035114 Bacteria 6318
221 Ga0373939_0126866 3300035114 Bacteria 906
222 Ga0373945_0028317 3300035116 Bacteria 1963
223 Ga0373953_0021984 3300035117 Bacteria 2400
224 Ga0373956_0047690 3300035119 Bacteria 1917
225 Ga0373943_0001159 3300035170 Bacteria 11771
226 Ga0373943_0005890 3300035170 Bacteria 5504
227 Ga0373946_0002367 3300035171 Bacteria 6670
228 Ga0373942_0010249 3300035207 Bacteria 2203
229 Ga0373961_0009599 3300035241 Bacteria 2370
230 Ga0373924_0046675 3300035410 Bacteria 1785
231 Ga0373924_0123877 3300035410 Bacteria 1122
232 Ga0373931_0023099 3300035691 Bacteria 3137
233 Ga0373935_0002094 3300035692 Bacteria 11328
234 Ga0373935_0046914 3300035692 Bacteria 2730
235 Ga0373927_0077244 3300035695 Bacteria 2157
236 Ga0373927_0120903 3300035695 Bacteria 1709
237 Ga0373927_0128812 3300035695 Bacteria 1653
238 Ga0373933_0036394 3300035724 Bacteria 2881
239 Ga0373933_0303044 3300035724 Bacteria 1034
240 Ga0373947_0005019 3300035725 Bacteria 7748
241 Ga0373947_0013927 3300035725 Bacteria 4611
242 Ga0373947_0208421 3300035725 Bacteria 1281
243 Ga0373937_0013925 3300036401 Bacteria 7092
244 Ga0373937_0019748 3300036401 Bacteria 6035
245 Ga0373925_0001534 3300037068 Bacteria 19696
246 Ga0373925_0015415 3300037068 Bacteria 5526
247 Ga0373925_0084567 3300037068 Bacteria 2418
248 Ga0395900_0193565 3300037418 Bacteria 2061
249 Ga0395898_0042049 3300037466 Bacteria 4511
250 Ga0395901_0223842 3300038443 Bacteria 1966
251 Ga0436365_1681640 3300039437 Bacteria 9732
252 Ga0436360_1261257 3300039438 Bacteria 1584
253 Ga0436363_0378956 3300039450 Bacteria 815
254 Ga0439466_0038786 3300041411 Bacteria 1599
255 Ga0439448_0032022 3300042005 Bacteria 1672
256 Ga0450902_018198 3300042137 Bacteria 1151
257 Ga0466966_0141525 3300044684 Bacteria 1470
258 Ga0495629_0002525 3300046459 Bacteria 14034
259 Ga0495629_0130513 3300046459 Bacteria 1750
260 Ga0495629_0250075 3300046459 Bacteria 1220
261 Ga0495641_0037952 3300046461 Bacteria 2253
262 Ga0495653_0123313 3300046463 Bacteria 1843
263 Ga0495653_0392945 3300046463 Bacteria 883
264 Ga0495653_0398421 3300046463 Bacteria 875
265 Ga0495582_0006250 3300046473 Bacteria 6638
266 Ga0495605_0074017 3300046474 Bacteria 1604
267 Ga0495662_0005479 3300046476 Bacteria 6352
268 Ga0495664_0002153 3300046477 Bacteria 10544
269 Ga0495664_0042051 3300046477 Bacteria 2706
270 Ga0495594_0093033 3300046499 Bacteria 1691
271 Ga0495594_0146494 3300046499 Bacteria 1340
272 Ga0495608_0143770 3300046511 Bacteria 1522
273 Ga0495610_0028209 3300046512 Bacteria 2972
274 Ga0495618_0001760 3300046514 Bacteria 14373
275 Ga0495618_0109378 3300046514 Bacteria 1770
276 Ga0495628_0236571 3300046516 Bacteria 1367
277 Ga0495630_0011980 3300046517 Bacteria 6287
278 Ga0495630_0081458 3300046517 Bacteria 2442
279 Ga0495630_0136145 3300046517 Bacteria 1866
280 Ga0495630_0140866 3300046517 Bacteria 1834
281 Ga0495630_0347091 3300046517 Bacteria 1136
282 Ga0495666_0130453 3300046526 Bacteria 1175
283 Ga0495642_0232889 3300046528 Bacteria 804
284 Ga0495652_0012826 3300046529 Bacteria 7549
285 Ga0495652_0128826 3300046529 Bacteria 2006
286 Ga0495665_0035029 3300046531 Bacteria 2683
287 Ga0495665_0065538 3300046531 Bacteria 1917
288 Ga0495640_0040029 3300046533 Bacteria 3284
289 Ga0495640_0090705 3300046533 Bacteria 2017
290 Ga0495586_0097959 3300046535 Bacteria 1625
291 Ga0495645_0001651 3300046543 Bacteria 15142
292 Ga0495645_0154019 3300046543 Bacteria 1594
293 Ga0495622_0001360 3300046557 Bacteria 12503
294 Ga0495622_0044140 3300046557 Bacteria 2072
295 Ga0495611_0084959 3300046648 Bacteria 1459
296 Ga0495635_0056324 3300046663 Bacteria 2706
297 Ga0495623_0066383 3300046679 Bacteria 2254
298 Ga0495647_0036742 3300046681 Bacteria 1845
299 Ga0495658_0021249 3300046683 Bacteria 3420
300 Ga0495613_0020140 3300046689 Bacteria 4970
301 Ga0495649_0053494 3300046694 Bacteria 2185
302 Ga0495600_0019140 3300046809 Bacteria 4368
303 Ga0495581_0019057 3300047315 Bacteria 3982
304 Ga0495674_0013772 3300047319 Bacteria 7592
305 Ga0495674_0111154 3300047319 Bacteria 2323
306 Ga0495676_0165859 3300047321 Bacteria 1558
307 Ga0495680_0004614 3300047322 Bacteria 13127
308 Ga0495684_0049283 3300047471 Bacteria 3218
309 Ga0495686_0083098 3300047472 Bacteria 1954
310 Ga0495686_0353751 3300047472 Bacteria 798
311 Ga0495593_0010816 3300047673 Bacteria 5261
312 Ga0495602_0141955 3300048088 Bacteria 1900
313 Ga0496100_0018258 3300048903 Bacteria 4157
314 Ga0496101_0005822 3300048904 Bacteria 7884
315 Ga0496102_0047171 3300048905 Bacteria 3913
316 Ga0496102_0064300 3300048905 Bacteria 3360
317 Ga0496104_0000352 3300048907 Bacteria 41135
318 Ga0496104_0001360 3300048907 Bacteria 21160
319 Ga0496104_0031281 3300048907 Bacteria 4948
320 Ga0496104_0631278 3300048907 Bacteria 980
321 Ga0496105_0000295 3300048908 Bacteria 32782
322 Ga0496105_0000498 3300048908 Bacteria 25929
323 Ga0496105_0009338 3300048908 Bacteria 7665
324 Ga0496106_0020197 3300048909 Bacteria 4942
325 Ga0496107_0050133 3300048910 Bacteria 3008
326 Ga0496108_0035079 3300048911 Bacteria 4168
327 Ga0496108_0188192 3300048911 Bacteria 1789
328 Ga0496108_0322058 3300048911 Bacteria 1348
329 Ga0496109_0096362 3300048912 Bacteria 2741
330 Ga0496110_0041912 3300048913 Bacteria 3995
331 Ga0496111_0015406 3300048914 Bacteria 5246
332 Ga0496111_0194488 3300048914 Bacteria 1508
333 Ga0496112_0012247 3300048915 Bacteria 7875
334 Ga0496112_0038371 3300048915 Bacteria 4676
335 Ga0496112_0054114 3300048915 Bacteria 3942
336 Ga0496112_0160504 3300048915 Bacteria 2214
337 Ga0496113_0008690 3300048916 Bacteria 6628
338 Ga0496113_0333584 3300048916 Bacteria 1216
339 Ga0496115_0044085 3300048918 Bacteria 3557
340 Ga0496115_0054133 3300048918 Bacteria 3221
341 Ga0496115_0072357 3300048918 Bacteria 2797
342 Ga0496115_0160783 3300048918 Bacteria 1856
343 Ga0496115_0355056 3300048918 Bacteria 1195
344 Ga0496115_0700043 3300048918 Bacteria 796
345 Ga0496117_0031338 3300048920 Bacteria 4062
346 Ga0496119_0000483 3300048922 Bacteria 54518
347 Ga0496123_0107023 3300048926 Bacteria 1609
348 Ga0496126_0372538 3300048929 Bacteria 1164
349 Ga0501032_0061484 3300049569 Bacteria 2517
350 Ga0501033_0112706 3300049570 Bacteria 1978
351 Ga0501033_0148748 3300049570 Bacteria 1690
352 Ga0501033_0168135 3300049570 Bacteria 1575
353 Ga0501033_0257482 3300049570 Bacteria 1236
354 Ga0501034_0082307 3300049571 Bacteria 3220
355 Ga0501034_0144169 3300049571 Bacteria 2360
356 Ga0501034_0226277 3300049571 Bacteria 1821
357 Ga0501034_0374040 3300049571 Bacteria 1350
358 Ga0501034_0403473 3300049571 Bacteria 1289
359 Ga0501036_0118099 3300049572 Bacteria 2239
360 Ga0501036_0232553 3300049572 Bacteria 1546
361 Ga0501037_0008896 3300049573 Bacteria 7354
362 Ga0501037_0050257 3300049573 Bacteria 3052
363 Ga0501037_0153514 3300049573 Bacteria 1644
364 Ga0501037_0393060 3300049573 Bacteria 952
365 Ga0501038_0141259 3300049574 Bacteria 1970
366 Ga0501038_0179106 3300049574 Bacteria 1711
367 Ga0501039_0150536 3300049575 Bacteria 1828
368 Ga0501039_0248957 3300049575 Bacteria 1397
369 Ga0501041_0083493 3300049577 Bacteria 1969
370 Ga0501042_0106091 3300049578 Bacteria 2022
371 Ga0501043_0053079 3300049579 Bacteria 3183
372 Ga0501046_0001578 3300049580 Bacteria 21792
373 Ga0501047_0012474 3300049581 Bacteria 8048
374 Ga0501047_0083304 3300049581 Bacteria 3074
375 Ga0501047_0230989 3300049581 Bacteria 1703
376 Ga0501048_0048329 3300049582 Bacteria 3035
377 Ga0501067_0007392 3300049583 Bacteria 6103
378 Ga0501069_0003295 3300049585 Bacteria 8283
379 Ga0501070_0022871 3300049586 Bacteria 5232
380 Ga0501070_0054407 3300049586 Bacteria 3319
381 Ga0501070_0067324 3300049586 Bacteria 2966
382 Ga0501070_0127120 3300049586 Bacteria 2106
383 Ga0501070_0197870 3300049586 Bacteria 1650
384 Ga0501070_0311006 3300049586 Bacteria 1282
385 Ga0501071_0073381 3300049587 Bacteria 2496
386 Ga0501071_0527876 3300049587 Bacteria 906
387 Ga0501073_0027442 3300049589 Bacteria 4071
388 Ga0501073_0065939 3300049589 Bacteria 2524
389 Ga0501073_0120561 3300049589 Bacteria 1818
390 Ga0501073_0122697 3300049589 Bacteria 1801
391 Ga0501073_0364808 3300049589 Bacteria 997
392 Ga0501073_0528701 3300049589 Bacteria 815
393 Ga0501074_0077463 3300049590 Bacteria 2386
394 Ga0501074_0102785 3300049590 Bacteria 2046
395 Ga0501075_0122040 3300049591 Bacteria 1983
396 Ga0501076_0022154 3300049592 Bacteria 4882
397 Ga0501076_0062628 3300049592 Bacteria 2963
398 Ga0501076_0078634 3300049592 Bacteria 2647
399 Ga0501076_0137018 3300049592 Bacteria 1988
400 Ga0501077_0003865 3300049593 Bacteria 9027
401 Ga0501077_0128278 3300049593 Bacteria 1608
402 Ga0501077_0234282 3300049593 Bacteria 1167
403 Ga0501252_010513 3300049682 Bacteria 1095
404 Ga0501079_0047049 3300049741 Bacteria 3328
405 Ga0501080_0017640 3300049742 Bacteria 6603
406 Ga0501080_0019521 3300049742 Bacteria 6279
407 Ga0501080_0077906 3300049742 Bacteria 3083
408 Ga0501080_0309998 3300049742 Bacteria 1430
409 Ga0501080_0355344 3300049742 Bacteria 1322
410 Ga0501081_0063088 3300049743 Bacteria 2571
411 Ga0501081_0376277 3300049743 Bacteria 1049
412 Ga0501083_0000940 3300049744 Bacteria 19244
413 Ga0501083_0201037 3300049744 Bacteria 1299
414 Ga0501083_0202398 3300049744 Bacteria 1295
415 Ga0501035_0001208 3300049822 Bacteria 26922
416 Ga0501035_0131144 3300049822 Bacteria 2185
417 Ga0501035_0143049 3300049822 Bacteria 2078
418 Ga0501035_0267698 3300049822 Bacteria 1447
419 Ga0501035_0445842 3300049822 Bacteria 1071
420 Ga0501035_0654640 3300049822 Bacteria 851
421 Ga0501044_0000122 3300049823 Bacteria 93246
422 Ga0501044_0228461 3300049823 Bacteria 1809
423 Ga0501044_0245667 3300049823 Bacteria 1733
424 Ga0501045_0029529 3300049824 Bacteria 3964
425 nmdc:mga03n38_119552_c1 3300050490 Bacteria 1293
426 nmdc:mga00v17_271441_c1 3300050491 Bacteria 1101
427 nmdc:mga00v17_398454_c1 3300050491 Bacteria 894
428 nmdc:mga0yw44_202838_c1 3300050492 Bacteria 1310
429 nmdc:mga06z11_153047_c1 3300050494 Bacteria 1313
430 nmdc:mga06z11_246075_c1 3300050494 Bacteria 1052
431 nmdc:mga04h51_18509_c1 3300050495 Bacteria 2053
432 nmdc:mga07m45_266770_c1 3300050496 Bacteria 996
433 nmdc:mga05p37_144428_c1 3300050507 Bacteria 2914
434 nmdc:mga05p37_7481_c1 3300050507 Bacteria 12877
435 nmdc:mga09592_1529_c1 3300050508 Bacteria 18637
436 nmdc:mga0qj67_263920_c1 3300050509 Bacteria 1397
437 nmdc:mga0qj67_4938_c1 3300050509 Bacteria 9695
438 nmdc:mga06r32_3841_c1 3300050510 Bacteria 13443
439 nmdc:mga06r32_400795_c1 3300050510 Bacteria 1354
440 nmdc:mga06r32_47_c1 3300050510 Bacteria 74242
441 nmdc:mga08y16_32930_c1 3300050511 Bacteria 5446
442 nmdc:mga08y16_72_c1 3300050511 Bacteria 84439
443 nmdc:mga0n895_196422_c1 3300050512 Bacteria 2049
444 nmdc:mga0n895_339891_c1 3300050512 Bacteria 1520
445 nmdc:mga0rr50_278905_c1 3300050513 Bacteria 1394
446 Ga0495601_0018199 3300053077 Bacteria 4273
447 Ga0495601_0020265 3300053077 Bacteria 4061
448 Ga0495612_0002446 3300053078 Bacteria 7645
449 Ga0495595_0091465 3300053084 Bacteria 1460
450 Ga0495619_0000387 3300053085 Bacteria 30124
451 Ga0495619_0072173 3300053085 Bacteria 2311
452 Ga0500650_0089458 3300053098 Bacteria 1441
453 Ga0500555_020301 3300053103 Bacteria 1914
454 Ga0500593_008845 3300053117 Bacteria 4154
455 Ga0500616_0045484 3300053153 Bacteria 2338
456 Ga0500636_0013976 3300053177 Bacteria 4719
457 Ga0500637_0002549 3300053178 Bacteria 8133
458 Ga0500645_015225 3300053730 Bacteria 2439
459 Ga0501084_0004700 3300054114 Bacteria 11153
460 Ga0501084_0022961 3300054114 Bacteria 5207
461 Ga0501084_0064745 3300054114 Bacteria 3059
462 Ga0501084_0078122 3300054114 Bacteria 2774
463 Ga0501082_0029624 3300060353 Bacteria 4716
464 Ga0501082_0081705 3300060353 Bacteria 2788
465 Ga0501082_0085570 3300060353 Bacteria 2719
466 Ga0501082_0148038 3300060353 Bacteria 2039
467 Ga0501082_0247110 3300060353 Bacteria 1553
468 Ga0530510_0042620 3300061734 Bacteria 3279

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0193565 Ga0395900_0193565_369_1229 217
2 3300037466 Ga0395898_0042049 Ga0395898_0042049_642_1502 217
3 3300039450 Ga0436363_0378956 Ga0436363_0378956_19_792 226
4 3300047472 Ga0495686_0353751 Ga0495686_0353751_32_724 230
5 3300031251 Ga0265327_10013307 Ga0265327_100133077 232
6 3300031344 Ga0265316_10064256 Ga0265316_100642564 232
7 3300039438 Ga0436360_1261257 Ga0436360_1261257_130_999 233
8 3300048918 Ga0496115_0700043 Ga0496115_0700043_25_729 234
9 3300005614 Ga0068856_100311289 Ga0068856_1003112892 236
10 3300049593 Ga0501077_0234282 Ga0501077_0234282_440_1153 237
11 3300006163 Ga0070715_10228916 Ga0070715_102289162 239
12 3300035114 Ga0373939_0001208 Ga0373939_0001208_1084_1974 240
13 3300050512 nmdc:mga0n895_196422_c1 nmdc:mga0n895_196422_c1_72_842 241
14 3300035114 Ga0373939_0126866 Ga0373939_0126866_19_792 242
15 3300046463 Ga0495653_0398421 Ga0495653_0398421_23_796 242
16 3300050495 nmdc:mga04h51_18509_c1 nmdc:mga04h51_18509_c1_10_741 243
17 3300046517 Ga0495630_0011980 Ga0495630_0011980_3638_4447 244
18 3300013307 Ga0157372_10013771 Ga0157372_100137717 245
19 3300035692 Ga0373935_0046914 Ga0373935_0046914_782_1525 245
20 3300035695 Ga0373927_0120903 Ga0373927_0120903_859_1602 245
21 3300037068 Ga0373925_0084567 Ga0373925_0084567_783_1526 245
22 3300046459 Ga0495629_0250075 Ga0495629_0250075_275_1018 245
23 3300006844 Ga0075428_100364934 Ga0075428_1003649341 247
24 3300049682 Ga0501252_010513 Ga0501252_010513_244_1059 247
25 3300050511 nmdc:mga08y16_32930_c1 nmdc:mga08y16_32930_c1_3229_4038 247
26 3300005535 Ga0070684_100185160 Ga0070684_1001851603 248
27 3300005262 Ga0065165_1000150 Ga0065165_100015045 249
28 3300025284 Ga0209130_1000187 Ga0209130_100018761 249
29 3300025302 Ga0207426_1010718 Ga0207426_10107184 249
30 3300047472 Ga0495686_0083098 Ga0495686_0083098_1175_1924 249
31 3300048911 Ga0496108_0322058 Ga0496108_0322058_501_1307 249
32 3300028800 Ga0265338_10068475 Ga0265338_100684753 250
33 3300031249 Ga0265339_10000462 Ga0265339_1000046228 250
34 3300031595 Ga0265313_10000088 Ga0265313_1000008825 250
35 3300031711 Ga0265314_10006928 Ga0265314_100069286 250
36 3300048918 Ga0496115_0160783 Ga0496115_0160783_141_962 250
37 3300031249 Ga0265339_10030126 Ga0265339_100301265 251
38 3300031344 Ga0265316_10077334 Ga0265316_100773342 251
39 3300046499 Ga0495594_0146494 Ga0495594_0146494_113_922 251
40 3300046557 Ga0495622_0044140 Ga0495622_0044140_48_857 251
41 3300049589 Ga0501073_0364808 Ga0501073_0364808_14_769 251
42 3300003187 JGI25151J46595_10022994 JGI25151J46595_100229944 252
43 3300005441 Ga0070700_100150786 Ga0070700_1001507862 252
44 3300025294 Ga0209025_1003913 Ga0209025_10039135 252
45 3300053117 Ga0500593_008845 Ga0500593_008845_1855_2670 252
46 3300003771 Ga0055526_1001254 Ga0055526_10012542 253
47 3300003775 Ga0055524_1000011 Ga0055524_1000011167 253
48 3300005345 Ga0070692_10135658 Ga0070692_101356582 253
49 3300005434 Ga0070709_10248009 Ga0070709_102480091 253
50 3300009174 Ga0105241_10378747 Ga0105241_103787472 253
51 3300013105 Ga0157369_10223892 Ga0157369_102238923 253
52 3300013307 Ga0157372_10424791 Ga0157372_104247912 253
53 3300020082 Ga0206353_11538153 Ga0206353_115381533 253
54 3300025291 Ga0209675_1002076 Ga0209675_100207613 253
55 3300025295 Ga0209564_1000369 Ga0209564_100036977 253
56 3300025299 Ga0209256_1000317 Ga0209256_100031713 253
57 3300025913 Ga0207695_10227136 Ga0207695_102271362 253
58 3300031241 Ga0265325_10000011 Ga0265325_10000011141 253
59 3300031595 Ga0265313_10006548 Ga0265313_100065482 253
60 iso_pu_bacteria 2582581867 2585399072 253
61 iso_pu_bacteria 2585427590 2585818807 253
62 3300038443 Ga0395901_0223842 Ga0395901_0223842_1000_1860 254
63 3300042137 Ga0450902_018198 Ga0450902_018198_355_1119 254
64 3300049573 Ga0501037_0393060 Ga0501037_0393060_172_936 254
65 3300005295 Ga0065707_10111613 Ga0065707_101116131 255
66 3300007076 Ga0075435_100081988 Ga0075435_1000819882 255
67 3300009553 Ga0105249_10214044 Ga0105249_102140442 255
68 3300025961 Ga0207712_10322917 Ga0207712_103229172 255
69 3300034820 Ga0373959_0029260 Ga0373959_0029260_318_1085 255
70 3300035724 Ga0373933_0036394 Ga0373933_0036394_505_1293 255
71 3300036401 Ga0373937_0013925 Ga0373937_0013925_715_1503 255
72 3300046528 Ga0495642_0232889 Ga0495642_0232889_25_792 255
73 3300048088 Ga0495602_0141955 Ga0495602_0141955_253_1041 255
74 3300005328 Ga0070676_10105722 Ga0070676_101057223 256
75 3300005335 Ga0070666_10003359 Ga0070666_100033599 256
76 3300005354 Ga0070675_100127234 Ga0070675_1001272343 256
77 3300005456 Ga0070678_100084145 Ga0070678_1000841454 256
78 3300005459 Ga0068867_100216440 Ga0068867_1002164403 256
79 3300005548 Ga0070665_100140738 Ga0070665_1001407383 256
80 3300006844 Ga0075428_100826631 Ga0075428_1008266311 256
81 3300006871 Ga0075434_100187736 Ga0075434_1001877363 256
82 3300007076 Ga0075435_100193680 Ga0075435_1001936802 256
83 3300009177 Ga0105248_10054127 Ga0105248_100541272 256
84 3300012498 Ga0157345_1001900 Ga0157345_10019002 256
85 3300013297 Ga0157378_10239571 Ga0157378_102395712 256
86 3300014745 Ga0157377_10026832 Ga0157377_100268325 256
87 3300025907 Ga0207645_10024629 Ga0207645_100246295 256
88 3300025938 Ga0207704_10019872 Ga0207704_100198724 256
89 3300026075 Ga0207708_10029680 Ga0207708_100296803 256
90 3300026089 Ga0207648_10078410 Ga0207648_100784104 256
91 3300026116 Ga0207674_10314816 Ga0207674_103148162 256
92 3300026121 Ga0207683_10059773 Ga0207683_100597733 256
93 3300028379 Ga0268266_10044744 Ga0268266_100447443 256
94 3300035088 Ga0373940_0059063 Ga0373940_0059063_153_968 256
95 3300035090 Ga0373949_0009178 Ga0373949_0009178_793_1608 256
96 3300035091 Ga0373951_0027208 Ga0373951_0027208_14_829 256
97 3300035170 Ga0373943_0005890 Ga0373943_0005890_3117_3932 256
98 3300035207 Ga0373942_0010249 Ga0373942_0010249_94_909 256
99 3300035241 Ga0373961_0009599 Ga0373961_0009599_1033_1848 256
100 3300035691 Ga0373931_0023099 Ga0373931_0023099_1681_2496 256
101 3300035692 Ga0373935_0002094 Ga0373935_0002094_5219_6034 256
102 3300035725 Ga0373947_0013927 Ga0373947_0013927_142_957 256
103 3300037068 Ga0373925_0015415 Ga0373925_0015415_1579_2394 256
104 3300046459 Ga0495629_0002525 Ga0495629_0002525_5439_6254 256
105 3300046461 Ga0495641_0037952 Ga0495641_0037952_73_888 256
106 3300046473 Ga0495582_0006250 Ga0495582_0006250_5784_6599 256
107 3300046517 Ga0495630_0347091 Ga0495630_0347091_236_1051 256
108 3300046683 Ga0495658_0021249 Ga0495658_0021249_1149_1964 256
109 3300046689 Ga0495613_0020140 Ga0495613_0020140_1689_2504 256
110 3300047321 Ga0495676_0165859 Ga0495676_0165859_393_1208 256
111 3300047322 Ga0495680_0004614 Ga0495680_0004614_8820_9635 256
112 3300047673 Ga0495593_0010816 Ga0495593_0010816_1054_1869 256
113 3300048905 Ga0496102_0064300 Ga0496102_0064300_699_1514 256
114 3300050513 nmdc:mga0rr50_278905_c1 nmdc:mga0rr50_278905_c1_339_1154 256
115 3300053085 Ga0495619_0000387 Ga0495619_0000387_22050_22865 256
116 3300025904 Ga0207647_10232963 Ga0207647_102329632 257
117 3300026075 Ga0207708_10232773 Ga0207708_102327732 257
118 3300046463 Ga0495653_0392945 Ga0495653_0392945_88_861 257
119 3300046526 Ga0495666_0130453 Ga0495666_0130453_23_796 257
120 3300046531 Ga0495665_0065538 Ga0495665_0065538_17_790 257
121 3300049589 Ga0501073_0528701 Ga0501073_0528701_23_796 257
122 3300049822 Ga0501035_0267698 Ga0501035_0267698_525_1385 257
123 3300005937 Ga0081455_10097189 Ga0081455_100971893 258
124 3300006237 Ga0097621_100007335 Ga0097621_1000073357 258
125 3300006914 Ga0075436_100086862 Ga0075436_1000868622 258
126 3300031344 Ga0265316_10062483 Ga0265316_100624832 258
127 3300006048 Ga0075363_100074335 Ga0075363_1000743352 260
128 3300050490 nmdc:mga03n38_119552_c1 nmdc:mga03n38_119552_c1_286_1068 260
129 3300050494 nmdc:mga06z11_153047_c1 nmdc:mga06z11_153047_c1_415_1197 260
130 3300050494 nmdc:mga06z11_246075_c1 nmdc:mga06z11_246075_c1_59_841 260
131 3300053098 Ga0500650_0089458 Ga0500650_0089458_111_893 260
132 3300053103 Ga0500555_020301 Ga0500555_020301_194_976 260
133 3300049574 Ga0501038_0141259 Ga0501038_0141259_587_1372 261
134 iso_pu_bacteria 2545555834 2545673101 261
135 iso_pu_bacteria 641522639 641642295 261
136 iso_pu_bacteria 643348564 643598224 261
137 3300049589 Ga0501073_0027442 Ga0501073_0027442_1511_2317 262
138 3300025972 Ga0207668_10089270 Ga0207668_100892704 263
139 3300049581 Ga0501047_0083304 Ga0501047_0083304_937_1749 264
140 3300021384 Ga0213876_10121845 Ga0213876_101218452 265
141 3300031456 Ga0307513_10059875 Ga0307513_100598753 265
142 3300005937 Ga0081455_10004792 Ga0081455_100047928 266
143 iso_pu_bacteria 2513237087 2513590375 266
144 iso_pu_bacteria 2884298095 2884301324 266
145 3300005440 Ga0070705_100233518 Ga0070705_1002335182 267
146 3300005546 Ga0070696_100020547 Ga0070696_1000205475 267
147 3300009148 Ga0105243_10213190 Ga0105243_102131903 267
148 3300041411 Ga0439466_0038786 Ga0439466_0038786_706_1509 267
149 3300049822 Ga0501035_0654640 Ga0501035_0654640_15_818 267
150 iso_pu_bacteria 2508501114 2509077496 267
151 iso_pu_bacteria 2643221734 2644736040 267
152 iso_pu_bacteria 2643221736 2644742597 267
153 iso_pu_bacteria 2773857925 2774868739 267
154 iso_pu_bacteria 2775506901 2776258345 267
155 iso_pu_bacteria 2818991467 2819722079 267
156 iso_pu_bacteria 2835312727 2835318518 267
157 iso_pu_bacteria 2841760612 2841764002 267
158 iso_pu_bacteria 2841911363 2841915533 267
159 iso_pu_bacteria 2841917233 2841920735 267
160 iso_pu_bacteria 2844104063 2844108543 267
161 iso_pu_bacteria 2851182111 2851185243 267
162 iso_pu_bacteria 2851246043 2851250437 267
163 iso_pu_bacteria 2882456835 2882457573 267
164 iso_pu_bacteria 2891088606 2891088799 267
165 iso_pu_bacteria 2894232714 2894235964 267
166 iso_pu_bacteria 2909042592 2909046797 267
167 iso_pu_bacteria 2917699015 2917701910 267
168 iso_pu_bacteria 8001845381 8001848087 267
169 iso_pu_bacteria 8002060224 8002061883 267
170 iso_pu_bacteria 8057529695 8057534074 267
171 3300035116 Ga0373945_0028317 Ga0373945_0028317_950_1756 268
172 3300035725 Ga0373947_0208421 Ga0373947_0208421_316_1122 268
173 3300046514 Ga0495618_0109378 Ga0495618_0109378_395_1201 268
174 3300046517 Ga0495630_0136145 Ga0495630_0136145_596_1402 268
175 3300046533 Ga0495640_0090705 Ga0495640_0090705_596_1402 268
176 3300048904 Ga0496101_0005822 Ga0496101_0005822_6795_7601 268
177 3300048907 Ga0496104_0000352 Ga0496104_0000352_33959_34765 268
178 3300048907 Ga0496104_0001360 Ga0496104_0001360_8145_8951 268
179 3300048907 Ga0496104_0631278 Ga0496104_0631278_42_848 268
180 3300048908 Ga0496105_0000295 Ga0496105_0000295_27763_28569 268
181 3300048908 Ga0496105_0000498 Ga0496105_0000498_20737_21543 268
182 3300048908 Ga0496105_0009338 Ga0496105_0009338_6634_7440 268
183 3300048911 Ga0496108_0188192 Ga0496108_0188192_91_897 268
184 3300048912 Ga0496109_0096362 Ga0496109_0096362_1844_2650 268
185 3300048914 Ga0496111_0194488 Ga0496111_0194488_437_1243 268
186 3300048915 Ga0496112_0012247 Ga0496112_0012247_1533_2339 268
187 3300048915 Ga0496112_0038371 Ga0496112_0038371_209_1015 268
188 3300048916 Ga0496113_0008690 Ga0496113_0008690_3644_4450 268
189 3300048916 Ga0496113_0333584 Ga0496113_0333584_75_881 268
190 3300048918 Ga0496115_0054133 Ga0496115_0054133_638_1444 268
191 3300048918 Ga0496115_0072357 Ga0496115_0072357_955_1761 268
192 3300048922 Ga0496119_0000483 Ga0496119_0000483_17555_18361 268
193 3300049570 Ga0501033_0112706 Ga0501033_0112706_906_1712 268
194 3300049571 Ga0501034_0144169 Ga0501034_0144169_1152_1958 268
195 3300049572 Ga0501036_0232553 Ga0501036_0232553_638_1444 268
196 3300049583 Ga0501067_0007392 Ga0501067_0007392_355_1161 268
197 3300049586 Ga0501070_0127120 Ga0501070_0127120_1226_2032 268
198 3300049589 Ga0501073_0065939 Ga0501073_0065939_714_1520 268
199 3300049592 Ga0501076_0062628 Ga0501076_0062628_2055_2861 268
200 3300049822 Ga0501035_0131144 Ga0501035_0131144_1244_2050 268
201 3300049823 Ga0501044_0228461 Ga0501044_0228461_766_1572 268
202 3300050512 nmdc:mga0n895_339891_c1 nmdc:mga0n895_339891_c1_607_1425 268
203 3300053077 Ga0495601_0020265 Ga0495601_0020265_543_1349 268
204 3300054114 Ga0501084_0078122 Ga0501084_0078122_1705_2511 268
205 3300060353 Ga0501082_0029624 Ga0501082_0029624_2471_3277 268
206 3300005456 Ga0070678_100609018 Ga0070678_1006090181 269
207 3300005841 Ga0068863_100241830 Ga0068863_1002418303 269
208 3300009176 Ga0105242_10457075 Ga0105242_104570751 269
209 3300026088 Ga0207641_10815704 Ga0207641_108157041 269
210 3300031239 Ga0265328_10011043 Ga0265328_100110433 269
211 3300031241 Ga0265325_10051461 Ga0265325_100514612 269
212 3300031247 Ga0265340_10142496 Ga0265340_101424961 269
213 3300031249 Ga0265339_10002208 Ga0265339_1000220813 269
214 3300031250 Ga0265331_10000007 Ga0265331_1000000754 269
215 3300031595 Ga0265313_10002423 Ga0265313_100024239 269
216 3300035088 Ga0373940_0038989 Ga0373940_0038989_272_1081 269
217 3300046474 Ga0495605_0074017 Ga0495605_0074017_555_1364 269
218 3300046557 Ga0495622_0001360 Ga0495622_0001360_1003_1812 269
219 3300046648 Ga0495611_0084959 Ga0495611_0084959_30_839 269
220 3300046694 Ga0495649_0053494 Ga0495649_0053494_83_892 269
221 3300049573 Ga0501037_0050257 Ga0501037_0050257_1884_2693 269
222 3300049581 Ga0501047_0012474 Ga0501047_0012474_6902_7723 269
223 3300049586 Ga0501070_0054407 Ga0501070_0054407_765_1574 269
224 3300049586 Ga0501070_0067324 Ga0501070_0067324_34_855 269
225 3300049589 Ga0501073_0120561 Ga0501073_0120561_649_1470 269
226 3300049590 Ga0501074_0102785 Ga0501074_0102785_497_1318 269
227 3300049593 Ga0501077_0128278 Ga0501077_0128278_705_1523 269
228 3300049742 Ga0501080_0077906 Ga0501080_0077906_1207_2016 269
229 3300049742 Ga0501080_0309998 Ga0501080_0309998_528_1349 269
230 3300049822 Ga0501035_0445842 Ga0501035_0445842_20_841 269
231 3300053178 Ga0500637_0002549 Ga0500637_0002549_6050_6859 269
232 3300060353 Ga0501082_0247110 Ga0501082_0247110_139_951 269
233 3300005367 Ga0070667_100288111 Ga0070667_1002881111 270
234 3300005548 Ga0070665_100025159 Ga0070665_1000251593 270
235 3300006844 Ga0075428_100338120 Ga0075428_1003381201 270
236 3300006847 Ga0075431_100018281 Ga0075431_1000182814 270
237 3300006847 Ga0075431_100568894 Ga0075431_1005688941 270
238 3300009147 Ga0114129_10081364 Ga0114129_100813644 270
239 3300025986 Ga0207658_10294600 Ga0207658_102946002 270
240 3300028381 Ga0268264_10645366 Ga0268264_106453661 270
241 3300035695 Ga0373927_0128812 Ga0373927_0128812_277_1089 270
242 3300049590 Ga0501074_0077463 Ga0501074_0077463_865_1677 270
243 3300049592 Ga0501076_0078634 Ga0501076_0078634_1112_1924 270
244 3300049592 Ga0501076_0137018 Ga0501076_0137018_1119_1931 270
245 3300049742 Ga0501080_0019521 Ga0501080_0019521_2456_3268 270
246 3300049743 Ga0501081_0376277 Ga0501081_0376277_206_1018 270
247 3300049744 Ga0501083_0000940 Ga0501083_0000940_11874_12686 270
248 3300049744 Ga0501083_0201037 Ga0501083_0201037_208_1020 270
249 3300050507 nmdc:mga05p37_144428_c1 nmdc:mga05p37_144428_c1_1641_2465 270
250 3300050509 nmdc:mga0qj67_4938_c1 nmdc:mga0qj67_4938_c1_3390_4217 270
251 3300050510 nmdc:mga06r32_3841_c1 nmdc:mga06r32_3841_c1_5516_6343 270
252 3300050510 nmdc:mga06r32_400795_c1 nmdc:mga06r32_400795_c1_223_1047 270
253 3300060353 Ga0501082_0081705 Ga0501082_0081705_1199_2011 270
254 3300060353 Ga0501082_0085570 Ga0501082_0085570_1083_1895 270
255 3300001979 JGI24740J21852_10024533 JGI24740J21852_100245332 271
256 3300002739 JGI25158J39367_1000444 JGI25158J39367_10004442 271
257 3300002773 JGI25152J39213_1001036 JGI25152J39213_10010364 271
258 3300003578 Ga0006562J51391_1019409 Ga0006562J51391_10194092 271
259 3300003578 Ga0006562J51391_1019411 Ga0006562J51391_10194111 271
260 3300005334 Ga0068869_100088513 Ga0068869_1000885132 271
261 3300005336 Ga0070680_100003095 Ga0070680_1000030953 271
262 3300005336 Ga0070680_100015789 Ga0070680_1000157893 271
263 3300005337 Ga0070682_100000325 Ga0070682_10000032514 271
264 3300005338 Ga0068868_100049355 Ga0068868_1000493553 271
265 3300005339 Ga0070660_100093228 Ga0070660_1000932284 271
266 3300005347 Ga0070668_100329346 Ga0070668_1003293461 271
267 3300005355 Ga0070671_100059347 Ga0070671_1000593472 271
268 3300005356 Ga0070674_100151493 Ga0070674_1001514932 271
269 3300005364 Ga0070673_100015351 Ga0070673_1000153514 271
270 3300005366 Ga0070659_100139144 Ga0070659_1001391444 271
271 3300005434 Ga0070709_10004283 Ga0070709_100042833 271
272 3300005435 Ga0070714_100192600 Ga0070714_1001926002 271
273 3300005436 Ga0070713_100000710 Ga0070713_1000007106 271
274 3300005436 Ga0070713_100113050 Ga0070713_1001130502 271
275 3300005436 Ga0070713_100143630 Ga0070713_1001436302 271
276 3300005437 Ga0070710_10076497 Ga0070710_100764972 271
277 3300005439 Ga0070711_100025551 Ga0070711_1000255513 271
278 3300005439 Ga0070711_100316956 Ga0070711_1003169561 271
279 3300005455 Ga0070663_100046596 Ga0070663_1000465963 271
280 3300005456 Ga0070678_100450921 Ga0070678_1004509212 271
281 3300005457 Ga0070662_100106633 Ga0070662_1001066331 271
282 3300005458 Ga0070681_10099814 Ga0070681_100998143 271
283 3300005466 Ga0070685_10005299 Ga0070685_100052992 271
284 3300005530 Ga0070679_100012384 Ga0070679_1000123843 271
285 3300005530 Ga0070679_100093362 Ga0070679_1000933624 271
286 3300005539 Ga0068853_100000927 Ga0068853_10000092710 271
287 3300005539 Ga0068853_100165084 Ga0068853_1001650843 271
288 3300005543 Ga0070672_100251684 Ga0070672_1002516842 271
289 3300005546 Ga0070696_100071543 Ga0070696_1000715432 271
290 3300005547 Ga0070693_100079016 Ga0070693_1000790162 271
291 3300005547 Ga0070693_100113285 Ga0070693_1001132852 271
292 3300005578 Ga0068854_100273317 Ga0068854_1002733171 271
293 3300005614 Ga0068856_100044923 Ga0068856_1000449234 271
294 3300005615 Ga0070702_100002584 Ga0070702_1000025847 271
295 3300005842 Ga0068858_100116237 Ga0068858_1001162374 271
296 3300005844 Ga0068862_100138064 Ga0068862_1001380643 271
297 3300006038 Ga0075365_10374879 Ga0075365_103748792 271
298 3300006163 Ga0070715_10030309 Ga0070715_100303093 271
299 3300006163 Ga0070715_10122339 Ga0070715_101223392 271
300 3300006173 Ga0070716_100001066 Ga0070716_1000010667 271
301 3300006175 Ga0070712_100004156 Ga0070712_1000041568 271
302 3300006175 Ga0070712_100062512 Ga0070712_1000625121 271
303 3300006175 Ga0070712_100085094 Ga0070712_1000850942 271
304 3300006175 Ga0070712_100138151 Ga0070712_1001381513 271
305 3300006237 Ga0097621_100105056 Ga0097621_1001050562 271
306 3300006358 Ga0068871_100005222 Ga0068871_1000052229 271
307 3300006846 Ga0075430_100101579 Ga0075430_1001015795 271
308 3300006847 Ga0075431_100029270 Ga0075431_1000292703 271
309 3300006880 Ga0075429_100002407 Ga0075429_10000240716 271
310 3300009011 Ga0105251_10012277 Ga0105251_100122773 271
311 3300009094 Ga0111539_10000115 Ga0111539_1000011564 271
312 3300009094 Ga0111539_10349241 Ga0111539_103492411 271
313 3300009147 Ga0114129_10001209 Ga0114129_100012097 271
314 3300009148 Ga0105243_10029150 Ga0105243_100291504 271
315 3300009174 Ga0105241_10020240 Ga0105241_100202407 271
316 3300009174 Ga0105241_10105690 Ga0105241_101056903 271
317 3300009551 Ga0105238_10233006 Ga0105238_102330062 271
318 3300012515 Ga0157338_1000769 Ga0157338_10007693 271
319 3300013104 Ga0157370_10354246 Ga0157370_103542462 271
320 3300013250 Ga0171462_1015 Ga0171462_101562 271
321 3300013307 Ga0157372_10002662 Ga0157372_1000266220 271
322 3300014326 Ga0157380_10317133 Ga0157380_103171332 271
323 3300017792 Ga0163161_10047082 Ga0163161_100470823 271
324 3300021384 Ga0213876_10014594 Ga0213876_100145945 271
325 3300024227 Ga0228598_1000380 Ga0228598_10003806 271
326 3300025898 Ga0207692_10055610 Ga0207692_100556102 271
327 3300025901 Ga0207688_10086325 Ga0207688_100863252 271
328 3300025904 Ga0207647_10100472 Ga0207647_101004722 271
329 3300025905 Ga0207685_10007409 Ga0207685_100074094 271
330 3300025906 Ga0207699_10000275 Ga0207699_1000027520 271
331 3300025906 Ga0207699_10124875 Ga0207699_101248752 271
332 3300025912 Ga0207707_10122640 Ga0207707_101226403 271
333 3300025915 Ga0207693_10002367 Ga0207693_1000236711 271
334 3300025916 Ga0207663_10028187 Ga0207663_100281873 271
335 3300025916 Ga0207663_10155456 Ga0207663_101554562 271
336 3300025917 Ga0207660_10203959 Ga0207660_102039592 271
337 3300025919 Ga0207657_10027857 Ga0207657_100278577 271
338 3300025919 Ga0207657_10057016 Ga0207657_100570162 271
339 3300025921 Ga0207652_10350383 Ga0207652_103503831 271
340 3300025921 Ga0207652_10385697 Ga0207652_103856971 271
341 3300025925 Ga0207650_10087550 Ga0207650_100875502 271
342 3300025926 Ga0207659_10025129 Ga0207659_100251295 271
343 3300025927 Ga0207687_10250192 Ga0207687_102501921 271
344 3300025928 Ga0207700_10012436 Ga0207700_100124365 271
345 3300025928 Ga0207700_10080152 Ga0207700_100801523 271
346 3300025929 Ga0207664_10019573 Ga0207664_100195735 271
347 3300025931 Ga0207644_10016802 Ga0207644_100168022 271
348 3300025931 Ga0207644_10020596 Ga0207644_100205966 271
349 3300025933 Ga0207706_10064539 Ga0207706_100645394 271
350 3300025933 Ga0207706_10157511 Ga0207706_101575113 271
351 3300025933 Ga0207706_10275950 Ga0207706_102759502 271
352 3300025937 Ga0207669_10069245 Ga0207669_100692452 271
353 3300025939 Ga0207665_10001144 Ga0207665_1000114413 271
354 3300025939 Ga0207665_10087343 Ga0207665_100873432 271
355 3300025940 Ga0207691_10239155 Ga0207691_102391552 271
356 3300025941 Ga0207711_10366166 Ga0207711_103661661 271
357 3300025942 Ga0207689_10006586 Ga0207689_100065863 271
358 3300025949 Ga0207667_10143638 Ga0207667_101436383 271
359 3300025960 Ga0207651_10007088 Ga0207651_100070882 271
360 3300025960 Ga0207651_10186175 Ga0207651_101861753 271
361 3300026035 Ga0207703_10046398 Ga0207703_100463985 271
362 3300026041 Ga0207639_10291700 Ga0207639_102917002 271
363 3300026067 Ga0207678_10005212 Ga0207678_100052123 271
364 3300026067 Ga0207678_10461173 Ga0207678_104611731 271
365 3300026095 Ga0207676_10130943 Ga0207676_101309432 271
366 3300027907 Ga0207428_10123899 Ga0207428_101238993 271
367 3300031241 Ga0265325_10000238 Ga0265325_1000023847 271
368 3300031548 Ga0307408_100043956 Ga0307408_1000439563 271
369 3300031548 Ga0307408_100233416 Ga0307408_1002334162 271
370 3300031852 Ga0307410_10110103 Ga0307410_101101033 271
371 3300031901 Ga0307406_10114316 Ga0307406_101143163 271
372 3300031911 Ga0307412_10161954 Ga0307412_101619542 271
373 3300031995 Ga0307409_100140221 Ga0307409_1001402213 271
374 3300032002 Ga0307416_100187466 Ga0307416_1001874662 271
375 3300032004 Ga0307414_10097905 Ga0307414_100979051 271
376 3300032005 Ga0307411_10033825 Ga0307411_100338253 271
377 3300032126 Ga0307415_100368506 Ga0307415_1003685062 271
378 3300034957 Ga0373938_0015409 Ga0373938_0015409_143_958 271
379 3300035089 Ga0373944_0005793 Ga0373944_0005793_2383_3210 271
380 3300035117 Ga0373953_0021984 Ga0373953_0021984_1091_1918 271
381 3300035119 Ga0373956_0047690 Ga0373956_0047690_106_933 271
382 3300035170 Ga0373943_0001159 Ga0373943_0001159_1018_1845 271
383 3300035171 Ga0373946_0002367 Ga0373946_0002367_176_1003 271
384 3300035410 Ga0373924_0046675 Ga0373924_0046675_779_1606 271
385 3300035410 Ga0373924_0123877 Ga0373924_0123877_15_842 271
386 3300035695 Ga0373927_0077244 Ga0373927_0077244_347_1174 271
387 3300035724 Ga0373933_0303044 Ga0373933_0303044_119_946 271
388 3300035725 Ga0373947_0005019 Ga0373947_0005019_5959_6786 271
389 3300036401 Ga0373937_0019748 Ga0373937_0019748_4050_4877 271
390 3300037068 Ga0373925_0001534 Ga0373925_0001534_872_1699 271
391 3300039437 Ga0436365_1681640 Ga0436365_1681640_3530_4345 271
392 3300042005 Ga0439448_0032022 Ga0439448_0032022_558_1373 271
393 3300044684 Ga0466966_0141525 Ga0466966_0141525_29_874 271
394 3300046459 Ga0495629_0130513 Ga0495629_0130513_123_950 271
395 3300046463 Ga0495653_0123313 Ga0495653_0123313_974_1801 271
396 3300046476 Ga0495662_0005479 Ga0495662_0005479_652_1479 271
397 3300046477 Ga0495664_0002153 Ga0495664_0002153_9084_9911 271
398 3300046477 Ga0495664_0042051 Ga0495664_0042051_1502_2329 271
399 3300046499 Ga0495594_0093033 Ga0495594_0093033_490_1305 271
400 3300046511 Ga0495608_0143770 Ga0495608_0143770_357_1184 271
401 3300046512 Ga0495610_0028209 Ga0495610_0028209_716_1531 271
402 3300046514 Ga0495618_0001760 Ga0495618_0001760_1049_1876 271
403 3300046516 Ga0495628_0236571 Ga0495628_0236571_476_1303 271
404 3300046517 Ga0495630_0081458 Ga0495630_0081458_902_1729 271
405 3300046517 Ga0495630_0140866 Ga0495630_0140866_566_1393 271
406 3300046529 Ga0495652_0012826 Ga0495652_0012826_1951_2778 271
407 3300046529 Ga0495652_0128826 Ga0495652_0128826_174_1001 271
408 3300046531 Ga0495665_0035029 Ga0495665_0035029_734_1561 271
409 3300046533 Ga0495640_0040029 Ga0495640_0040029_2020_2847 271
410 3300046535 Ga0495586_0097959 Ga0495586_0097959_725_1552 271
411 3300046543 Ga0495645_0001651 Ga0495645_0001651_6939_7766 271
412 3300046543 Ga0495645_0154019 Ga0495645_0154019_568_1395 271
413 3300046663 Ga0495635_0056324 Ga0495635_0056324_1622_2449 271
414 3300046679 Ga0495623_0066383 Ga0495623_0066383_1092_1919 271
415 3300046681 Ga0495647_0036742 Ga0495647_0036742_942_1769 271
416 3300046809 Ga0495600_0019140 Ga0495600_0019140_1980_2807 271
417 3300047315 Ga0495581_0019057 Ga0495581_0019057_2125_2952 271
418 3300047319 Ga0495674_0013772 Ga0495674_0013772_2001_2828 271
419 3300047319 Ga0495674_0111154 Ga0495674_0111154_1430_2257 271
420 3300047471 Ga0495684_0049283 Ga0495684_0049283_1451_2278 271
421 3300048903 Ga0496100_0018258 Ga0496100_0018258_1779_2594 271
422 3300048905 Ga0496102_0047171 Ga0496102_0047171_2852_3667 271
423 3300048907 Ga0496104_0031281 Ga0496104_0031281_1779_2594 271
424 3300048909 Ga0496106_0020197 Ga0496106_0020197_2369_3184 271
425 3300048910 Ga0496107_0050133 Ga0496107_0050133_443_1258 271
426 3300048911 Ga0496108_0035079 Ga0496108_0035079_1575_2390 271
427 3300048913 Ga0496110_0041912 Ga0496110_0041912_227_1042 271
428 3300048914 Ga0496111_0015406 Ga0496111_0015406_2537_3352 271
429 3300048915 Ga0496112_0054114 Ga0496112_0054114_1779_2594 271
430 3300048915 Ga0496112_0160504 Ga0496112_0160504_919_1734 271
431 3300048918 Ga0496115_0044085 Ga0496115_0044085_753_1580 271
432 3300048918 Ga0496115_0355056 Ga0496115_0355056_316_1131 271
433 3300048920 Ga0496117_0031338 Ga0496117_0031338_211_1026 271
434 3300048926 Ga0496123_0107023 Ga0496123_0107023_554_1369 271
435 3300048929 Ga0496126_0372538 Ga0496126_0372538_175_990 271
436 3300049569 Ga0501032_0061484 Ga0501032_0061484_26_841 271
437 3300049570 Ga0501033_0148748 Ga0501033_0148748_584_1399 271
438 3300049570 Ga0501033_0168135 Ga0501033_0168135_713_1528 271
439 3300049570 Ga0501033_0257482 Ga0501033_0257482_329_1150 271
440 3300049571 Ga0501034_0082307 Ga0501034_0082307_340_1155 271
441 3300049571 Ga0501034_0226277 Ga0501034_0226277_632_1447 271
442 3300049571 Ga0501034_0374040 Ga0501034_0374040_425_1246 271
443 3300049571 Ga0501034_0403473 Ga0501034_0403473_29_844 271
444 3300049572 Ga0501036_0118099 Ga0501036_0118099_623_1438 271
445 3300049573 Ga0501037_0008896 Ga0501037_0008896_4820_5635 271
446 3300049573 Ga0501037_0153514 Ga0501037_0153514_768_1583 271
447 3300049574 Ga0501038_0179106 Ga0501038_0179106_49_864 271
448 3300049575 Ga0501039_0150536 Ga0501039_0150536_53_874 271
449 3300049575 Ga0501039_0248957 Ga0501039_0248957_35_850 271
450 3300049577 Ga0501041_0083493 Ga0501041_0083493_479_1318 271
451 3300049578 Ga0501042_0106091 Ga0501042_0106091_174_1013 271
452 3300049579 Ga0501043_0053079 Ga0501043_0053079_107_922 271
453 3300049580 Ga0501046_0001578 Ga0501046_0001578_12577_13392 271
454 3300049581 Ga0501047_0230989 Ga0501047_0230989_41_856 271
455 3300049582 Ga0501048_0048329 Ga0501048_0048329_32_853 271
456 3300049585 Ga0501069_0003295 Ga0501069_0003295_736_1551 271
457 3300049586 Ga0501070_0022871 Ga0501070_0022871_3418_4233 271
458 3300049586 Ga0501070_0197870 Ga0501070_0197870_341_1156 271
459 3300049586 Ga0501070_0311006 Ga0501070_0311006_127_942 271
460 3300049587 Ga0501071_0073381 Ga0501071_0073381_972_1787 271
461 3300049587 Ga0501071_0527876 Ga0501071_0527876_64_885 271
462 3300049589 Ga0501073_0122697 Ga0501073_0122697_142_957 271
463 3300049591 Ga0501075_0122040 Ga0501075_0122040_826_1665 271
464 3300049592 Ga0501076_0022154 Ga0501076_0022154_1593_2414 271
465 3300049593 Ga0501077_0003865 Ga0501077_0003865_7168_7989 271
466 3300049741 Ga0501079_0047049 Ga0501079_0047049_644_1465 271
467 3300049742 Ga0501080_0017640 Ga0501080_0017640_2236_3057 271
468 3300049742 Ga0501080_0355344 Ga0501080_0355344_363_1178 271
469 3300049743 Ga0501081_0063088 Ga0501081_0063088_756_1577 271
470 3300049744 Ga0501083_0202398 Ga0501083_0202398_227_1042 271
471 3300049822 Ga0501035_0001208 Ga0501035_0001208_21472_22287 271
472 3300049822 Ga0501035_0143049 Ga0501035_0143049_599_1414 271
473 3300049823 Ga0501044_0000122 Ga0501044_0000122_31363_32178 271
474 3300049823 Ga0501044_0245667 Ga0501044_0245667_613_1434 271
475 3300049824 Ga0501045_0029529 Ga0501045_0029529_1597_2412 271
476 3300050491 nmdc:mga00v17_271441_c1 nmdc:mga00v17_271441_c1_213_1028 271
477 3300050491 nmdc:mga00v17_398454_c1 nmdc:mga00v17_398454_c1_52_867 271
478 3300050492 nmdc:mga0yw44_202838_c1 nmdc:mga0yw44_202838_c1_203_1018 271
479 3300050496 nmdc:mga07m45_266770_c1 nmdc:mga07m45_266770_c1_18_839 271
480 3300050507 nmdc:mga05p37_7481_c1 nmdc:mga05p37_7481_c1_3622_4437 271
481 3300050508 nmdc:mga09592_1529_c1 nmdc:mga09592_1529_c1_13362_14177 271
482 3300050509 nmdc:mga0qj67_263920_c1 nmdc:mga0qj67_263920_c1_197_1012 271
483 3300050510 nmdc:mga06r32_47_c1 nmdc:mga06r32_47_c1_2138_2953 271
484 3300050511 nmdc:mga08y16_72_c1 nmdc:mga08y16_72_c1_27098_27913 271
485 3300053077 Ga0495601_0018199 Ga0495601_0018199_1287_2114 271
486 3300053078 Ga0495612_0002446 Ga0495612_0002446_6509_7336 271
487 3300053084 Ga0495595_0091465 Ga0495595_0091465_224_1051 271
488 3300053085 Ga0495619_0072173 Ga0495619_0072173_454_1281 271
489 3300053153 Ga0500616_0045484 Ga0500616_0045484_1462_2277 271
490 3300053177 Ga0500636_0013976 Ga0500636_0013976_3615_4430 271
491 3300053730 Ga0500645_015225 Ga0500645_015225_1379_2194 271
492 3300054114 Ga0501084_0004700 Ga0501084_0004700_10142_10963 271
493 3300054114 Ga0501084_0022961 Ga0501084_0022961_35_850 271
494 3300054114 Ga0501084_0064745 Ga0501084_0064745_1170_1985 271
495 3300060353 Ga0501082_0148038 Ga0501082_0148038_49_864 271
496 3300061734 Ga0530510_0042620 Ga0530510_0042620_1450_2271 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01113

DapB_N

Dihydrodipicolinate reductase, N-terminus

4

127

0.99

PF05173

DapB_C

Dihydrodipicolinate reductase, C-terminus

130

266

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ijp-assembly1.cif.gz_B crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution 0.9343 3 269
3ijp-assembly1.cif.gz_B crystal structure of dihydrodipicolinate reductase from bartonella henselae at 2.0a resolution 0.931 3 269
5tej-assembly1.cif.gz_A structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh 0.9204 4 271
5us6-assembly1.cif.gz_D structure of dihydrodipicolinate reductase from vibrio vulnificus bound to nadh and 2,6 pyridine dicarboxylic acid with intact polyhistidine tag 0.92 4 269
1arz-assembly1.cif.gz_C escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate 0.9196 1 271
ID Description Score Start End Superfamily
3ijpA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9742 3 267 3.40.50.720
3ijpA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 3 267 3.40.50.720
af_P04036_4_119_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9571 2 116 3.40.50.720
af_Q57865_1_131_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9556 4 126 3.40.50.720
5ugjB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9552 4 269 3.40.50.720
ID Description Score Start End GO Terms
AF-K0VT51-F1-model_v4 Dihydrodipicolinate reductase (EC 1.17.1.8) 0.9979 2 67 GO:0008839
GO:0009089
AF-I5BWK1-F1-model_v4 Dihydrodipicolinate reductase (EC 1.17.1.8) 0.9933 1 113 GO:0008839
GO:0009089
AF-A0A7X7RKE4-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 0.9923 4 104 GO:0008839
GO:0009089
GO:0019877
AF-A0A527ZRZ1-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 0.9918 3 114 GO:0005829
GO:0008839
GO:0009089
GO:0019877
AF-A0A530K2W3-F1-model_v4 4-hydroxy-tetrahydrodipicolinate reductase 0.9912 3 74 GO:0008839
GO:0009089

Feature Viewer

pLDDT pTM Quality
93.72 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map