F454761

General Info

Members Datasets Scaffolds Average Seq Length
495 341 448 337

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0115993|Ga0466959_0115993_368_1438
Length 356
Sequence VGEAAAAEPVDLKGNAMAKRHLAITMGDPAGIGPEIIVKACTKLRDRLEASDLKLLIIGSRRALEQANRQIAAGLEVAEVGIDDNDWPNLSFLQADDESIAIEPGVLSADGGRFAYKAVEHGVRLSLSGRVGGIVTAPLNKEALNKAGYHYPGHTEMLAALTGVRGSVMLLAHGNMRVSHVSTHVALQDVPARLTPERLRLVIHLTDKALRAMGMARPKIAVAALNPHAGEGGLFGRQDIDISRPTIEKAVADGLDVVGPIPGDTIFVKLRAGQYDAVVAMYHDQGHIPVKLLGFEVDPTTGKWQELSGVNITLGLPIIRTSVDHGTAFDIAGKGIANERSMIEAIEYAERLAGNA

Samples

Sample ID Description Type Environment
1 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
2 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
3 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
4 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
5 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
6 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
7 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
8 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
9 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
10 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
11 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
12 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
13 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
14 2643221733 Bosea sp. Root381 Isolate Unclassified
15 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
16 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
17 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
18 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
19 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
20 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
21 2818991467 Bosea vestrisii 3192 Isolate Unclassified
22 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
23 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
24 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
25 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
26 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
27 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
28 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
29 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
30 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
31 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
32 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
33 2902330777 Methylobacterium sp. 2A Isolate Unclassified
34 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
35 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
36 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
37 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
38 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
39 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
40 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
41 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
42 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
43 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
44 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
45 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
46 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
47 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
48 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
67 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
123 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
124 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
125 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
174 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
279 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
305 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
306 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
309 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
314 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
317 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
318 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
319 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
320 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
321 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
322 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
323 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
324 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
325 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
326 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
327 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
328 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
329 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
330 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
335 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
336 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
337 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
338 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
339 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
340 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
341 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.51
Metatranscriptomes 0
Isolates 9.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.73
Nodule 4.04
Rhizoplane 3.64
Rhizosphere 64.04
Stem 0
Stem Tuber 0
Unclassified 15.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10019283 3300001979 Bacteria 2405
2 JGI25155J39150_1000012 3300002704 Bacteria 199435
3 JGI25156J39149_1000049 3300002705 Bacteria 91988
4 JGI25162J39368_1000695 3300002737 Bacteria 23406
5 JGI25162J39368_1001578 3300002737 Bacteria 11602
6 JGI25154J39366_1000033 3300002738 Bacteria 184379
7 JGI25157J39369_1000055 3300002741 Bacteria 107875
8 JGI25165J46597_1000905 3300003214 Bacteria 20576
9 JGI25165J46597_1004234 3300003214 Bacteria 3158
10 JGI25160J50197_1000006 3300003354 Bacteria 316247
11 JGI25161J50226_1000004 3300003374 Bacteria 316212
12 Ga0055539_1003688 3300003752 Bacteria 2100
13 Ga0055540_1001550 3300003792 Bacteria 13468
14 Ga0055540_1002250 3300003792 Bacteria 10427
15 Ga0055543_1000002 3300004625 Bacteria 390020
16 Ga0065165_1000217 3300005262 Bacteria 100170
17 Ga0070683_100007448 3300005329 Bacteria 9246
18 Ga0070670_100067698 3300005331 Bacteria 3064
19 Ga0068869_100182458 3300005334 Bacteria 1646
20 Ga0070682_100019723 3300005337 Bacteria 3959
21 Ga0070689_100238912 3300005340 Bacteria 1496
22 Ga0070668_100148861 3300005347 Bacteria 1891
23 Ga0070675_100145038 3300005354 Bacteria 2032
24 Ga0070671_100001622 3300005355 Bacteria 16950
25 Ga0070674_100022453 3300005356 Bacteria 4070
26 Ga0070688_100066374 3300005365 Bacteria 2296
27 Ga0070709_10010635 3300005434 Bacteria 5102
28 Ga0070709_10013745 3300005434 Bacteria 4559
29 Ga0070709_10035384 3300005434 Bacteria 3034
30 Ga0070709_10114485 3300005434 Bacteria 1818
31 Ga0070714_100022122 3300005435 Bacteria 5211
32 Ga0070714_100195952 3300005435 Bacteria 1846
33 Ga0070714_100398197 3300005435 Bacteria 1301
34 Ga0070713_100023616 3300005436 Bacteria 4774
35 Ga0070713_100104925 3300005436 Bacteria 2454
36 Ga0070710_10005571 3300005437 Bacteria 5995
37 Ga0070711_100002094 3300005439 Bacteria 11278
38 Ga0070711_100009431 3300005439 Bacteria 6012
39 Ga0070711_100022701 3300005439 Bacteria 4071
40 Ga0070700_100008029 3300005441 Bacteria 5736
41 Ga0070700_100313272 3300005441 Bacteria 1150
42 Ga0070663_100016214 3300005455 Bacteria 4831
43 Ga0070662_100180190 3300005457 Bacteria 1665
44 Ga0070681_10037795 3300005458 Bacteria 4842
45 Ga0070681_10054570 3300005458 Bacteria 3982
46 Ga0070681_10055134 3300005458 Bacteria 3959
47 Ga0068867_100082825 3300005459 Bacteria 2421
48 Ga0070685_10189642 3300005466 Bacteria 1329
49 Ga0070698_100067751 3300005471 Bacteria 3589
50 Ga0070679_100055225 3300005530 Bacteria 3955
51 Ga0070679_100126962 3300005530 Bacteria 2532
52 Ga0070684_100001944 3300005535 Bacteria 15159
53 Ga0070665_100007190 3300005548 Bacteria 11316
54 Ga0070665_100043721 3300005548 Bacteria 4501
55 Ga0068855_100544243 3300005563 Bacteria 1257
56 Ga0068857_100034266 3300005577 Bacteria 4491
57 Ga0068859_100168809 3300005617 Bacteria 2268
58 Ga0068859_100454491 3300005617 Bacteria 1377
59 Ga0068861_100076591 3300005719 Bacteria 2607
60 Ga0068863_100267383 3300005841 Bacteria 1654
61 Ga0068860_100000441 3300005843 Bacteria 52446
62 Ga0081539_10106110 3300005985 Bacteria 1423
63 Ga0070717_10095167 3300006028 Bacteria 2520
64 Ga0070717_10210529 3300006028 Bacteria 1706
65 Ga0075365_10008336 3300006038 Bacteria 5875
66 Ga0075365_10136396 3300006038 Bacteria 1701
67 Ga0075365_10145376 3300006038 Bacteria 1647
68 Ga0075364_10011646 3300006051 Bacteria 5348
69 Ga0070712_100014922 3300006175 Bacteria 4995
70 Ga0070712_100025960 3300006175 Bacteria 3898
71 Ga0070712_100034203 3300006175 Bacteria 3443
72 Ga0070712_100129902 3300006175 Bacteria 1908
73 Ga0075362_10031783 3300006177 Bacteria 2287
74 Ga0075366_10208031 3300006195 Bacteria 1191
75 Ga0075428_100054241 3300006844 Bacteria 4393
76 Ga0075430_100133130 3300006846 Bacteria 2072
77 Ga0075431_100024748 3300006847 Bacteria 6154
78 Ga0075434_100014581 3300006871 Bacteria 7517
79 Ga0075429_100016272 3300006880 Bacteria 6446
80 Ga0068865_100050901 3300006881 Bacteria 2864
81 Ga0097620_100168813 3300006931 Bacteria 2268
82 Ga0097620_100454508 3300006931 Bacteria 1377
83 Ga0105251_10024668 3300009011 Bacteria 3086
84 Ga0105244_10001196 3300009036 Bacteria 21355
85 Ga0105244_10012693 3300009036 Bacteria 4966
86 Ga0105250_10002562 3300009092 Bacteria 9077
87 Ga0105240_10000019 3300009093 Bacteria 406211
88 Ga0105240_10063330 3300009093 Bacteria 4601
89 Ga0111539_10019802 3300009094 Bacteria 8294
90 Ga0105245_10028125 3300009098 Bacteria 4956
91 Ga0114129_10030052 3300009147 Bacteria 7693
92 Ga0105241_10136447 3300009174 Bacteria 1993
93 Ga0105242_10044193 3300009176 Bacteria 3606
94 Ga0105242_10338971 3300009176 Bacteria 1385
95 Ga0105248_10218262 3300009177 Bacteria 2147
96 Ga0105237_10005613 3300009545 Bacteria 14143
97 Ga0105238_10052110 3300009551 Bacteria 4114
98 Ga0105238_10365962 3300009551 Bacteria 1432
99 Ga0105239_10310214 3300010375 Bacteria 1778
100 Ga0105246_10133121 3300011119 Bacteria 1860
101 Ga0157373_10175354 3300013100 Bacteria 1509
102 Ga0157370_10016613 3300013104 Bacteria 7447
103 Ga0157370_10108832 3300013104 Bacteria 2591
104 Ga0157369_10006837 3300013105 Bacteria 13158
105 Ga0157369_10015170 3300013105 Bacteria 8697
106 Ga0157369_10024108 3300013105 Bacteria 6772
107 Ga0157369_10112167 3300013105 Bacteria 2897
108 Ga0163162_10024175 3300013306 Bacteria 5996
109 Ga0157372_10099862 3300013307 Bacteria 3311
110 Ga0157375_10002151 3300013308 Bacteria 17028
111 Ga0157380_10006982 3300014326 Bacteria 7992
112 Ga0157380_10096145 3300014326 Bacteria 2455
113 Ga0157380_10145054 3300014326 Bacteria 2045
114 Ga0182007_10002379 3300015262 Bacteria 9402
115 Ga0182005_1029636 3300015265 Bacteria 1492
116 Ga0213872_10000768 3300021361 Bacteria 23526
117 Ga0213876_10001452 3300021384 Bacteria 14742
118 Ga0213876_10022915 3300021384 Bacteria 3299
119 Ga0213875_10011424 3300021388 Bacteria 4417
120 Ga0213875_10037283 3300021388 Bacteria 2291
121 Ga0213871_10008482 3300021441 Bacteria 2269
122 Ga0213871_10032034 3300021441 Bacteria 1376
123 Ga0228598_1001174 3300024227 Bacteria 5787
124 Ga0209435_100005 3300025206 Bacteria 573745
125 Ga0209437_100078 3300025233 Bacteria 278088
126 Ga0209437_100174 3300025233 Bacteria 138811
127 Ga0209646_1000011 3300025246 Bacteria 573745
128 Ga0209026_1000008 3300025250 Bacteria 573745
129 Ga0209677_100155 3300025253 Bacteria 62873
130 Ga0209677_100598 3300025253 Bacteria 19523
131 Ga0209759_1000004 3300025256 Bacteria 573745
132 Ga0209759_1002549 3300025256 Bacteria 7908
133 Ga0209233_1000163 3300025261 Bacteria 152912
134 Ga0209233_1000295 3300025261 Bacteria 62548
135 Ga0209233_1000397 3300025261 Bacteria 36444
136 Ga0209233_1000654 3300025261 Bacteria 16891
137 Ga0209455_1000954 3300025272 Bacteria 14747
138 Ga0209455_1003971 3300025272 Bacteria 5017
139 Ga0209130_1000032 3300025284 Bacteria 316240
140 Ga0209025_1003950 3300025294 Bacteria 13306
141 Ga0209564_1000017 3300025295 Bacteria 594063
142 Ga0207426_1000077 3300025302 Bacteria 316246
143 Ga0209051_1001417 3300025303 Bacteria 20592
144 Ga0209051_1005356 3300025303 Bacteria 7535
145 Ga0209051_1013228 3300025303 Bacteria 3941
146 Ga0207655_1003385 3300025728 Bacteria 11908
147 Ga0207655_1004837 3300025728 Bacteria 9360
148 Ga0207713_1002531 3300025735 Bacteria 13225
149 Ga0207692_10004323 3300025898 Bacteria 5619
150 Ga0207699_10008748 3300025906 Bacteria 5010
151 Ga0207699_10022463 3300025906 Bacteria 3419
152 Ga0207699_10103786 3300025906 Bacteria 1809
153 Ga0207699_10148168 3300025906 Bacteria 1550
154 Ga0207705_10171427 3300025909 Bacteria 1634
155 Ga0207707_10037974 3300025912 Bacteria 4207
156 Ga0207707_10042266 3300025912 Bacteria 3979
157 Ga0207707_10165142 3300025912 Bacteria 1935
158 Ga0207695_10000049 3300025913 Bacteria 406233
159 Ga0207695_10067367 3300025913 Bacteria 3673
160 Ga0207695_10176771 3300025913 Bacteria 2057
161 Ga0207671_10000556 3300025914 Bacteria 50250
162 Ga0207671_10061221 3300025914 Bacteria 2793
163 Ga0207693_10018049 3300025915 Bacteria 5623
164 Ga0207693_10022995 3300025915 Bacteria 4950
165 Ga0207693_10047684 3300025915 Bacteria 3366
166 Ga0207693_10048585 3300025915 Bacteria 3332
167 Ga0207693_10052746 3300025915 Bacteria 3190
168 Ga0207663_10006154 3300025916 Bacteria 6112
169 Ga0207663_10018000 3300025916 Bacteria 3947
170 Ga0207649_10085651 3300025920 Bacteria 2051
171 Ga0207652_10088133 3300025921 Bacteria 2722
172 Ga0207652_10108202 3300025921 Bacteria 2463
173 Ga0207681_10290684 3300025923 Bacteria 1290
174 Ga0207694_10075214 3300025924 Bacteria 2644
175 Ga0207694_10086265 3300025924 Bacteria 2472
176 Ga0207694_10348417 3300025924 Bacteria 1226
177 Ga0207650_10108645 3300025925 Bacteria 2144
178 Ga0207659_10133852 3300025926 Bacteria 1917
179 Ga0207700_10028157 3300025928 Bacteria 3946
180 Ga0207700_10101308 3300025928 Bacteria 2297
181 Ga0207664_10019954 3300025929 Bacteria 4962
182 Ga0207664_10197589 3300025929 Bacteria 1734
183 Ga0207644_10006361 3300025931 Bacteria 7690
184 Ga0207670_10035160 3300025936 Bacteria 3246
185 Ga0207665_10008791 3300025939 Bacteria 6641
186 Ga0207661_10001176 3300025944 Bacteria 17500
187 Ga0207661_10042710 3300025944 Bacteria 3575
188 Ga0207679_10081020 3300025945 Bacteria 2481
189 Ga0207667_10219314 3300025949 Bacteria 1949
190 Ga0207667_10277669 3300025949 Bacteria 1712
191 Ga0207651_10059304 3300025960 Bacteria 2650
192 Ga0207651_10119073 3300025960 Bacteria 1999
193 Ga0207651_10249098 3300025960 Bacteria 1452
194 Ga0207678_10016418 3300026067 Bacteria 6500
195 Ga0207708_10008896 3300026075 Bacteria 7432
196 Ga0207702_10111127 3300026078 Bacteria 2437
197 Ga0207641_10134404 3300026088 Bacteria 2225
198 Ga0207648_10070370 3300026089 Bacteria 3050
199 Ga0207674_10040652 3300026116 Bacteria 4816
200 Ga0207674_10191715 3300026116 Bacteria 1994
201 Ga0207683_10268259 3300026121 Bacteria 1559
202 Ga0207698_10515897 3300026142 Bacteria 1165
203 Ga0209371_1002800 3300027312 Bacteria 9283
204 Ga0268266_10007178 3300028379 Bacteria 10094
205 Ga0268266_10027444 3300028379 Bacteria 4841
206 Ga0268264_10000042 3300028381 Bacteria 372069
207 Ga0307515_10078454 3300028794 Bacteria 4342
208 Ga0268256_1002695 3300030500 Bacteria 8741
209 Ga0307511_10097007 3300030521 Bacteria 1960
210 Ga0265339_10019029 3300031249 Bacteria 4038
211 Ga0307513_10003954 3300031456 Bacteria 19915
212 Ga0307508_10173606 3300031616 Bacteria 1758
213 Ga0265314_10022701 3300031711 Bacteria 4803
214 Ga0265342_10009985 3300031712 Bacteria 6633
215 Ga0307413_10005055 3300031824 Bacteria 5829
216 Ga0307410_10038401 3300031852 Bacteria 3136
217 Ga0307406_10024853 3300031901 Bacteria 3582
218 Ga0307406_10219077 3300031901 Bacteria 1413
219 Ga0307407_10014499 3300031903 Bacteria 3863
220 Ga0307412_10180659 3300031911 Bacteria 1587
221 Ga0307416_100019262 3300032002 Bacteria 4834
222 Ga0307414_10177345 3300032004 Bacteria 1710
223 Ga0307411_10011644 3300032005 Bacteria 4760
224 Ga0307507_10083854 3300033179 Bacteria 2783
225 Ga0373934_0046481 3300035086 Bacteria 1717
226 Ga0373923_0038706 3300035111 Bacteria 1955
227 Ga0373923_0165466 3300035111 Bacteria 1011
228 Ga0373936_0011298 3300035113 Bacteria 3379
229 Ga0373936_0011501 3300035113 Bacteria 3351
230 Ga0373953_0052044 3300035117 Bacteria 1657
231 Ga0373956_0074454 3300035119 Bacteria 1552
232 Ga0373946_0008038 3300035171 Bacteria 3873
233 Ga0373924_0023028 3300035410 Bacteria 2438
234 Ga0373935_0203343 3300035692 Bacteria 1370
235 Ga0373927_0224097 3300035695 Bacteria 1235
236 Ga0373947_0043733 3300035725 Bacteria 2676
237 Ga0373937_0022374 3300036401 Bacteria 5684
238 Ga0373937_0040115 3300036401 Bacteria 4268
239 Ga0373937_0072791 3300036401 Bacteria 3170
240 Ga0373925_0024925 3300037068 Bacteria 4369
241 Ga0395900_0165254 3300037418 Bacteria 2256
242 Ga0395898_0105076 3300037466 Bacteria 2708
243 Ga0395898_0185241 3300037466 Bacteria 1989
244 Ga0395898_0238098 3300037466 Bacteria 1736
245 Ga0395898_0378642 3300037466 Bacteria 1350
246 Ga0436364_0162304 3300037853 Bacteria 33275
247 Ga0436364_0541108 3300037853 Bacteria 4556
248 Ga0436364_0919460 3300037853 Bacteria 3894
249 Ga0436364_1070350 3300037853 Bacteria 2220
250 Ga0436364_1353674 3300037853 Bacteria 1547
251 Ga0395901_0048997 3300038443 Bacteria 4388
252 Ga0436365_0017671 3300039437 Bacteria 2557
253 Ga0436365_0879402 3300039437 Bacteria 3086
254 Ga0436365_1095754 3300039437 Bacteria 43052
255 Ga0436360_0757752 3300039438 Bacteria 1923
256 Ga0436360_1272471 3300039438 Bacteria 3768
257 Ga0436360_1360442 3300039438 Bacteria 6037
258 Ga0436361_1007353 3300039447 Bacteria 3193
259 Ga0436363_0222309 3300039450 Bacteria 2461
260 Ga0436363_0737283 3300039450 Bacteria 1763
261 Ga0436363_0895910 3300039450 Bacteria 2030
262 Ga0436363_1667015 3300039450 Bacteria 2327
263 Ga0436362_0460244 3300039453 Bacteria 2387
264 Ga0439464_0005549 3300042439 Bacteria 3267
265 Ga0466969_0011981 3300044656 Bacteria 4585
266 Ga0466972_0031172 3300044658 Bacteria 2623
267 Ga0466972_0090062 3300044658 Bacteria 1455
268 Ga0466966_0044278 3300044684 Bacteria 2850
269 Ga0466961_0139699 3300044693 Bacteria 1517
270 Ga0466963_0047691 3300044694 Bacteria 2828
271 Ga0466971_0040553 3300044719 Bacteria 2091
272 Ga0466968_0014002 3300044735 Bacteria 3163
273 Ga0466970_0005887 3300044765 Bacteria 6107
274 Ga0466957_0093176 3300044842 Bacteria 1890
275 Ga0466959_0088321 3300045049 Bacteria 2229
276 Ga0466959_0115993 3300045049 Bacteria 1907
277 Ga0466959_0128908 3300045049 Bacteria 1794
278 Ga0451576_0019109 3300045051 Bacteria 7488
279 Ga0466967_0075379 3300045976 Bacteria 3032
280 Ga0495627_000423 3300046453 Bacteria 36816
281 Ga0495592_0053457 3300046454 Bacteria 2996
282 Ga0495629_0105228 3300046459 Bacteria 1968
283 Ga0495651_0111992 3300046462 Bacteria 2017
284 Ga0495651_0296345 3300046462 Bacteria 1086
285 Ga0495580_0004348 3300046472 Bacteria 11900
286 Ga0495605_0007922 3300046474 Bacteria 6017
287 Ga0495639_0009703 3300046475 Bacteria 4131
288 Ga0495639_0119834 3300046475 Bacteria 1255
289 Ga0495662_0013829 3300046476 Bacteria 3928
290 Ga0495664_0006091 3300046477 Bacteria 6657
291 Ga0495594_0016990 3300046499 Bacteria 3840
292 Ga0495606_0097780 3300046507 Bacteria 1793
293 Ga0495628_0024176 3300046516 Bacteria 4975
294 Ga0495630_0046966 3300046517 Bacteria 3228
295 Ga0495652_0194426 3300046529 Bacteria 1545
296 Ga0495652_0225534 3300046529 Bacteria 1405
297 Ga0495665_0102049 3300046531 Bacteria 1505
298 Ga0495587_0059255 3300046536 Bacteria 2248
299 Ga0495645_0035897 3300046543 Bacteria 3614
300 Ga0495667_0051566 3300046559 Bacteria 2714
301 Ga0495668_0007763 3300046616 Bacteria 6806
302 Ga0495634_0008098 3300046642 Bacteria 7838
303 Ga0495625_0013004 3300046660 Bacteria 6714
304 Ga0495625_0056106 3300046660 Bacteria 2806
305 Ga0495635_0039786 3300046663 Bacteria 3252
306 Ga0495635_0075072 3300046663 Bacteria 2316
307 Ga0495657_0048384 3300046675 Bacteria 2869
308 Ga0495599_0102050 3300046678 Bacteria 1788
309 Ga0495623_0014468 3300046679 Bacteria 5106
310 Ga0495623_0083488 3300046679 Bacteria 1973
311 Ga0495646_0013256 3300046680 Bacteria 5239
312 Ga0495647_0004757 3300046681 Bacteria 4431
313 Ga0495658_0028738 3300046683 Bacteria 3004
314 Ga0495624_0005173 3300046690 Bacteria 9428
315 Ga0495589_0162703 3300046794 Bacteria 1063
316 Ga0495660_0000877 3300046810 Bacteria 22235
317 Ga0495604_0022267 3300047317 Bacteria 5059
318 Ga0495604_0097283 3300047317 Bacteria 2171
319 Ga0495674_0136332 3300047319 Bacteria 2065
320 Ga0495676_0047432 3300047321 Bacteria 3474
321 Ga0495673_0016628 3300047469 Bacteria 3757
322 Ga0495684_0004151 3300047471 Bacteria 11313
323 Ga0495684_0040306 3300047471 Bacteria 3581
324 Ga0495686_0004028 3300047472 Bacteria 12284
325 Ga0495686_0007807 3300047472 Bacteria 7959
326 Ga0495593_0010939 3300047673 Bacteria 5226
327 Ga0495602_0063231 3300048088 Bacteria 3208
328 Ga0495602_0067942 3300048088 Bacteria 3063
329 Ga0496100_0120033 3300048903 Bacteria 1838
330 Ga0496101_0175316 3300048904 Bacteria 1649
331 Ga0496102_0009659 3300048905 Bacteria 8299
332 Ga0496103_0004829 3300048906 Bacteria 8142
333 Ga0496105_0035311 3300048908 Bacteria 4114
334 Ga0496106_0002146 3300048909 Bacteria 14733
335 Ga0496109_0214013 3300048912 Bacteria 1812
336 Ga0496110_0095742 3300048913 Bacteria 2659
337 Ga0496111_0199785 3300048914 Bacteria 1486
338 Ga0496112_0007297 3300048915 Bacteria 9801
339 Ga0496112_0190965 3300048915 Bacteria 2010
340 Ga0496113_0083614 3300048916 Bacteria 2449
341 Ga0496113_0431116 3300048916 Bacteria 1059
342 Ga0496114_0246721 3300048917 Bacteria 1571
343 Ga0496115_0017858 3300048918 Bacteria 5434
344 Ga0496115_0065002 3300048918 Bacteria 2946
345 Ga0496117_0016845 3300048920 Bacteria 6138
346 Ga0496117_0041667 3300048920 Bacteria 3361
347 Ga0496117_0052520 3300048920 Bacteria 2870
348 Ga0496118_0004894 3300048921 Bacteria 15573
349 Ga0496118_0006640 3300048921 Bacteria 12631
350 Ga0496119_0007476 3300048922 Bacteria 9825
351 Ga0496119_0016957 3300048922 Bacteria 5509
352 Ga0496119_0044548 3300048922 Bacteria 2792
353 Ga0496119_0107850 3300048922 Bacteria 1551
354 Ga0496120_0032802 3300048923 Bacteria 3127
355 Ga0496120_0035608 3300048923 Bacteria 2971
356 Ga0496120_0085406 3300048923 Bacteria 1699
357 Ga0496121_0000146 3300048924 Bacteria 154459
358 Ga0496121_0006205 3300048924 Bacteria 14981
359 Ga0496121_0020045 3300048924 Bacteria 6647
360 Ga0496121_0157879 3300048924 Bacteria 1662
361 Ga0496122_0017690 3300048925 Bacteria 6641
362 Ga0496122_0030899 3300048925 Bacteria 4474
363 Ga0496122_0047820 3300048925 Bacteria 3297
364 Ga0496122_0069355 3300048925 Bacteria 2525
365 Ga0496124_0001236 3300048927 Bacteria 39269
366 Ga0496124_0018901 3300048927 Bacteria 6434
367 Ga0496124_0035661 3300048927 Bacteria 4350
368 Ga0496124_0060724 3300048927 Bacteria 3170
369 Ga0496125_0013383 3300048928 Bacteria 8068
370 Ga0496125_0028332 3300048928 Bacteria 5062
371 Ga0496125_0049449 3300048928 Bacteria 3494
372 Ga0496126_0008637 3300048929 Bacteria 10953
373 Ga0496126_0027701 3300048929 Bacteria 5408
374 Ga0496126_0051454 3300048929 Bacteria 3749
375 Ga0496126_0055680 3300048929 Bacteria 3576
376 Ga0496126_0061033 3300048929 Bacteria 3388
377 Ga0496126_0086626 3300048929 Bacteria 2760
378 Ga0496126_0187426 3300048929 Bacteria 1754
379 Ga0501032_0045469 3300049569 Bacteria 2969
380 Ga0501034_0025675 3300049571 Bacteria 5999
381 Ga0501038_0163731 3300049574 Bacteria 1806
382 Ga0501039_0160657 3300049575 Bacteria 1766
383 Ga0501039_0185769 3300049575 Bacteria 1635
384 Ga0501043_0045550 3300049579 Bacteria 3450
385 Ga0501046_0043115 3300049580 Bacteria 3593
386 Ga0501046_0080917 3300049580 Bacteria 2509
387 Ga0501047_0032527 3300049581 Bacteria 5035
388 Ga0501047_0075852 3300049581 Bacteria 3235
389 Ga0501067_0006020 3300049583 Bacteria 6722
390 Ga0501068_0001433 3300049584 Bacteria 12653
391 Ga0501069_0025014 3300049585 Bacteria 3260
392 Ga0501069_0040418 3300049585 Bacteria 2578
393 Ga0501070_0017083 3300049586 Bacteria 6090
394 Ga0501070_0034524 3300049586 Bacteria 4228
395 Ga0501071_0080791 3300049587 Bacteria 2378
396 Ga0501073_0001736 3300049589 Bacteria 16195
397 Ga0501073_0038051 3300049589 Bacteria 3414
398 Ga0501074_0005978 3300049590 Bacteria 8780
399 Ga0501074_0014830 3300049590 Bacteria 5666
400 Ga0501076_0077423 3300049592 Bacteria 2668
401 Ga0501076_0078447 3300049592 Bacteria 2650
402 Ga0501079_0010640 3300049741 Bacteria 7002
403 Ga0501079_0036089 3300049741 Bacteria 3807
404 Ga0501080_0000921 3300049742 Bacteria 24022
405 Ga0501080_0012855 3300049742 Bacteria 7680
406 Ga0501080_0062784 3300049742 Bacteria 3457
407 Ga0501083_0007148 3300049744 Bacteria 7924
408 Ga0501044_0026430 3300049823 Bacteria 6142
409 Ga0501044_0071296 3300049823 Bacteria 3533
410 nmdc:mga03683_74735_c1 3300050489 Bacteria 1454
411 nmdc:mga00v17_40819_c1 3300050491 Bacteria 2785
412 nmdc:mga0yw44_4280_c1 3300050492 Bacteria 6511
413 nmdc:mga05p37_8009_c1 3300050507 Bacteria 12473
414 nmdc:mga0qj67_147969_c1 3300050509 Bacteria 1904
415 nmdc:mga06r32_19850_c1 3300050510 Bacteria 6176
416 nmdc:mga0n895_9573_c1 3300050512 Bacteria 8485
417 nmdc:mga0rr50_169867_c1 3300050513 Bacteria 1776
418 Ga0495601_0010821 3300053077 Bacteria 5442
419 Ga0495601_0071871 3300053077 Bacteria 2210
420 Ga0500635_0006112 3300053080 Bacteria 3201
421 Ga0500635_0006310 3300053080 Bacteria 3161
422 Ga0500647_0048081 3300053091 Bacteria 2051
423 Ga0500566_0000492 3300053094 Bacteria 22010
424 Ga0500640_002350 3300053095 Bacteria 6226
425 Ga0500572_000497 3300053111 Bacteria 13512
426 Ga0500572_001028 3300053111 Bacteria 8377
427 Ga0500608_013262 3300053122 Bacteria 3648
428 Ga0500614_002677 3300053123 Bacteria 3939
429 Ga0500559_0000640 3300053136 Bacteria 23656
430 Ga0500559_0001778 3300053136 Bacteria 11833
431 Ga0500573_0026483 3300053140 Bacteria 3332
432 Ga0500590_000321 3300053148 Bacteria 15389
433 Ga0500590_034482 3300053148 Bacteria 2620
434 Ga0500603_008527 3300053150 Bacteria 2277
435 Ga0500630_001509 3300053159 Bacteria 11111
436 Ga0500638_068961 3300053162 Bacteria 1692
437 Ga0500638_101165 3300053162 Bacteria 1344
438 Ga0500639_000065 3300053163 Bacteria 48250
439 Ga0500636_0047483 3300053177 Bacteria 2528
440 Ga0500636_0066432 3300053177 Bacteria 2097
441 Ga0500637_0009953 3300053178 Bacteria 4861
442 Ga0500637_0097779 3300053178 Bacteria 1701
443 Ga0500576_004552 3300053725 Bacteria 5629
444 Ga0500596_000776 3300053735 Bacteria 6294
445 Ga0500596_004899 3300053735 Bacteria 2411
446 Ga0501084_0078898 3300054114 Bacteria 2759
447 Ga0501082_0046640 3300060353 Bacteria 3735
448 Ga0466962_0105887 3300061719 Bacteria 1352

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_100180190 Ga0070662_1001801902 275
2 3300044656 Ga0466969_0011981 Ga0466969_0011981_3657_4565 282
3 iso_pu_bacteria 2901300506 2901306212 286
4 iso_pu_bacteria 2901300506 2901311458 286
5 3300046794 Ga0495589_0162703 Ga0495589_0162703_125_1051 298
6 3300035111 Ga0373923_0165466 Ga0373923_0165466_13_921 301
7 3300054114 Ga0501084_0078898 Ga0501084_0078898_1813_2748 305
8 3300028794 Ga0307515_10078454 Ga0307515_100784542 310
9 3300044658 Ga0466972_0090062 Ga0466972_0090062_155_1132 310
10 3300048916 Ga0496113_0431116 Ga0496113_0431116_61_1035 310
11 3300009176 Ga0105242_10044193 Ga0105242_100441931 312
12 3300045976 Ga0466967_0075379 Ga0466967_0075379_1829_2863 312
13 3300053111 Ga0500572_000497 Ga0500572_000497_4175_5209 312
14 3300053136 Ga0500559_0000640 Ga0500559_0000640_1187_2221 312
15 3300053725 Ga0500576_004552 Ga0500576_004552_4342_5376 312
16 3300053735 Ga0500596_004899 Ga0500596_004899_268_1302 312
17 3300005347 Ga0070668_100148861 Ga0070668_1001488612 313
18 3300005356 Ga0070674_100022453 Ga0070674_1000224533 313
19 iso_pu_bacteria 2818991465 2819707594 314
20 3300037466 Ga0395898_0105076 Ga0395898_0105076_572_1531 316
21 iso_pu_bacteria 2599185155 2599330368 316
22 3300031824 Ga0307413_10005055 Ga0307413_100050556 317
23 3300031901 Ga0307406_10024853 Ga0307406_100248532 317
24 3300031903 Ga0307407_10014499 Ga0307407_100144992 317
25 3300031911 Ga0307412_10180659 Ga0307412_101806591 317
26 3300032002 Ga0307416_100019262 Ga0307416_1000192622 317
27 3300032005 Ga0307411_10011644 Ga0307411_100116445 317
28 3300003792 Ga0055540_1001550 Ga0055540_100155011 318
29 3300003792 Ga0055540_1002250 Ga0055540_10022507 318
30 3300005334 Ga0068869_100182458 Ga0068869_1001824581 318
31 3300005354 Ga0070675_100145038 Ga0070675_1001450382 318
32 3300005365 Ga0070688_100066374 Ga0070688_1000663742 318
33 3300005441 Ga0070700_100008029 Ga0070700_1000080292 318
34 3300005441 Ga0070700_100313272 Ga0070700_1003132721 318
35 3300005459 Ga0068867_100082825 Ga0068867_1000828252 318
36 3300005466 Ga0070685_10189642 Ga0070685_101896422 318
37 3300005548 Ga0070665_100007190 Ga0070665_1000071903 318
38 3300005617 Ga0068859_100454491 Ga0068859_1004544912 318
39 3300005719 Ga0068861_100076591 Ga0068861_1000765912 318
40 3300005841 Ga0068863_100267383 Ga0068863_1002673832 318
41 3300006038 Ga0075365_10136396 Ga0075365_101363962 318
42 3300006038 Ga0075365_10145376 Ga0075365_101453762 318
43 3300006881 Ga0068865_100050901 Ga0068865_1000509012 318
44 3300006931 Ga0097620_100454508 Ga0097620_1004545082 318
45 3300009011 Ga0105251_10024668 Ga0105251_100246682 318
46 3300009036 Ga0105244_10001196 Ga0105244_100011966 318
47 3300009036 Ga0105244_10012693 Ga0105244_100126933 318
48 3300009092 Ga0105250_10002562 Ga0105250_100025626 318
49 3300013306 Ga0163162_10024175 Ga0163162_100241751 318
50 3300013308 Ga0157375_10002151 Ga0157375_100021513 318
51 3300014326 Ga0157380_10006982 Ga0157380_100069822 318
52 3300014326 Ga0157380_10096145 Ga0157380_100961451 318
53 3300014326 Ga0157380_10145054 Ga0157380_101450542 318
54 3300021361 Ga0213872_10000768 Ga0213872_1000076815 318
55 3300025256 Ga0209759_1002549 Ga0209759_10025492 318
56 3300025303 Ga0209051_1001417 Ga0209051_100141712 318
57 3300025303 Ga0209051_1005356 Ga0209051_10053565 318
58 3300025303 Ga0209051_1013228 Ga0209051_10132284 318
59 3300025728 Ga0207655_1003385 Ga0207655_10033855 318
60 3300025728 Ga0207655_1004837 Ga0207655_10048373 318
61 3300025735 Ga0207713_1002531 Ga0207713_10025317 318
62 3300025909 Ga0207705_10171427 Ga0207705_101714272 318
63 3300025920 Ga0207649_10085651 Ga0207649_100856511 318
64 3300025925 Ga0207650_10108645 Ga0207650_101086452 318
65 3300025926 Ga0207659_10133852 Ga0207659_101338522 318
66 3300025960 Ga0207651_10119073 Ga0207651_101190732 318
67 3300025960 Ga0207651_10249098 Ga0207651_102490982 318
68 3300026075 Ga0207708_10008896 Ga0207708_100088965 318
69 3300026088 Ga0207641_10134404 Ga0207641_101344042 318
70 3300026089 Ga0207648_10070370 Ga0207648_100703702 318
71 3300026116 Ga0207674_10191715 Ga0207674_101917152 318
72 3300028379 Ga0268266_10007178 Ga0268266_100071782 318
73 3300031456 Ga0307513_10003954 Ga0307513_100039547 318
74 3300031852 Ga0307410_10038401 Ga0307410_100384012 318
75 3300031901 Ga0307406_10219077 Ga0307406_102190772 318
76 3300032004 Ga0307414_10177345 Ga0307414_101773452 318
77 3300042439 Ga0439464_0005549 Ga0439464_0005549_1433_2455 318
78 3300044658 Ga0466972_0031172 Ga0466972_0031172_285_1298 318
79 3300046453 Ga0495627_000423 Ga0495627_000423_31058_32080 318
80 3300046474 Ga0495605_0007922 Ga0495605_0007922_4613_5635 318
81 3300046616 Ga0495668_0007763 Ga0495668_0007763_2755_3777 318
82 3300046660 Ga0495625_0013004 Ga0495625_0013004_4049_5071 318
83 3300046810 Ga0495660_0000877 Ga0495660_0000877_12160_13182 318
84 3300048903 Ga0496100_0120033 Ga0496100_0120033_86_1093 318
85 3300048908 Ga0496105_0035311 Ga0496105_0035311_1483_2490 318
86 3300048912 Ga0496109_0214013 Ga0496109_0214013_338_1345 318
87 3300048913 Ga0496110_0095742 Ga0496110_0095742_1511_2518 318
88 3300048914 Ga0496111_0199785 Ga0496111_0199785_460_1467 318
89 3300048927 Ga0496124_0018901 Ga0496124_0018901_2165_3187 318
90 3300049575 Ga0501039_0160657 Ga0501039_0160657_215_1204 318
91 3300049584 Ga0501068_0001433 Ga0501068_0001433_9536_10525 318
92 3300049585 Ga0501069_0040418 Ga0501069_0040418_1302_2291 318
93 3300049587 Ga0501071_0080791 Ga0501071_0080791_1051_2040 318
94 3300049589 Ga0501073_0001736 Ga0501073_0001736_13111_14100 318
95 3300049590 Ga0501074_0005978 Ga0501074_0005978_2161_3150 318
96 3300049592 Ga0501076_0078447 Ga0501076_0078447_227_1216 318
97 3300049741 Ga0501079_0010640 Ga0501079_0010640_5799_6788 318
98 3300049742 Ga0501080_0000921 Ga0501080_0000921_9923_10912 318
99 3300049744 Ga0501083_0007148 Ga0501083_0007148_871_1860 318
100 3300053140 Ga0500573_0026483 Ga0500573_0026483_1240_2262 318
101 3300009093 Ga0105240_10063330 Ga0105240_100633302 328
102 3300013104 Ga0157370_10108832 Ga0157370_101088324 328
103 3300013105 Ga0157369_10015170 Ga0157369_100151704 328
104 3300013307 Ga0157372_10099862 Ga0157372_100998624 328
105 3300025916 Ga0207663_10006154 Ga0207663_100061548 328
106 3300035725 Ga0373947_0043733 Ga0373947_0043733_412_1407 328
107 3300037418 Ga0395900_0165254 Ga0395900_0165254_137_1126 328
108 3300037466 Ga0395898_0185241 Ga0395898_0185241_464_1453 328
109 3300038443 Ga0395901_0048997 Ga0395901_0048997_157_1146 328
110 3300048909 Ga0496106_0002146 Ga0496106_0002146_9521_10516 328
111 3300048917 Ga0496114_0246721 Ga0496114_0246721_118_1107 328
112 3300048918 Ga0496115_0017858 Ga0496115_0017858_3691_4680 328
113 3300048920 Ga0496117_0041667 Ga0496117_0041667_542_1537 328
114 3300048921 Ga0496118_0006640 Ga0496118_0006640_2607_3602 328
115 3300048922 Ga0496119_0044548 Ga0496119_0044548_1197_2192 328
116 3300048924 Ga0496121_0000146 Ga0496121_0000146_3522_4517 328
117 3300048927 Ga0496124_0001236 Ga0496124_0001236_4299_5294 328
118 3300048928 Ga0496125_0028332 Ga0496125_0028332_77_1072 328
119 3300048929 Ga0496126_0008637 Ga0496126_0008637_2732_3727 328
120 3300053080 Ga0500635_0006310 Ga0500635_0006310_1374_2369 328
121 3300053162 Ga0500638_068961 Ga0500638_068961_245_1240 328
122 3300053177 Ga0500636_0047483 Ga0500636_0047483_21_1016 328
123 3300053178 Ga0500637_0097779 Ga0500637_0097779_521_1516 328
124 3300009094 Ga0111539_10019802 Ga0111539_100198026 329
125 3300039438 Ga0436360_0757752 Ga0436360_0757752_645_1643 329
126 3300039438 Ga0436360_1360442 Ga0436360_1360442_1584_2597 329
127 3300039450 Ga0436363_0737283 Ga0436363_0737283_643_1644 329
128 3300047469 Ga0495673_0016628 Ga0495673_0016628_1125_2159 329
129 3300048904 Ga0496101_0175316 Ga0496101_0175316_103_1113 329
130 3300048905 Ga0496102_0009659 Ga0496102_0009659_4928_5920 329
131 3300048906 Ga0496103_0004829 Ga0496103_0004829_4789_5781 329
132 3300048916 Ga0496113_0083614 Ga0496113_0083614_1334_2326 329
133 3300048920 Ga0496117_0016845 Ga0496117_0016845_2957_3949 329
134 3300048921 Ga0496118_0004894 Ga0496118_0004894_5004_5996 329
135 3300048922 Ga0496119_0107850 Ga0496119_0107850_162_1154 329
136 3300048923 Ga0496120_0035608 Ga0496120_0035608_1813_2805 329
137 3300048924 Ga0496121_0006205 Ga0496121_0006205_11502_12494 329
138 3300048925 Ga0496122_0030899 Ga0496122_0030899_1062_2054 329
139 3300048927 Ga0496124_0060724 Ga0496124_0060724_1055_2047 329
140 3300048928 Ga0496125_0013383 Ga0496125_0013383_2210_3202 329
141 3300048929 Ga0496126_0055680 Ga0496126_0055680_1506_2498 329
142 3300050507 nmdc:mga05p37_8009_c1 nmdc:mga05p37_8009_c1_4127_5143 329
143 3300050509 nmdc:mga0qj67_147969_c1 nmdc:mga0qj67_147969_c1_720_1736 329
144 3300050510 nmdc:mga06r32_19850_c1 nmdc:mga06r32_19850_c1_4038_5054 329
145 iso_pu_bacteria 643348564 643592645 332
146 iso_pu_bacteria 643348564 643599200 332
147 iso_pu_bacteria 2524023209 2524461031 333
148 iso_pu_bacteria 2524023210 2524470778 333
149 iso_pu_bacteria 2582581308 2585282913 333
150 iso_pu_bacteria 2582581315 2585322374 333
151 iso_pu_bacteria 2582581316 2585335065 333
152 iso_pu_bacteria 2585427527 2585532320 333
153 iso_pu_bacteria 2585427530 2585557565 333
154 iso_pu_bacteria 2615840626 2616307525 333
155 iso_pu_bacteria 2615840698 2616555072 333
156 iso_pu_bacteria 2617270742 2617384301 333
157 iso_pu_bacteria 2643221733 2644730704 333
158 iso_pu_bacteria 2667528174 2671112307 333
159 iso_pu_bacteria 2775507266 2778176135 333
160 iso_pu_bacteria 2818991448 2819613536 333
161 iso_pu_bacteria 2818991453 2819644047 333
162 iso_pu_bacteria 2818991467 2819718445 333
163 iso_pu_bacteria 2838029111 2838034676 333
164 iso_pu_bacteria 2842298080 2842298834 333
165 iso_pu_bacteria 2842357229 2842359298 333
166 iso_pu_bacteria 2842475841 2842481431 333
167 iso_pu_bacteria 2842482326 2842483263 333
168 iso_pu_bacteria 2842502639 2842508323 333
169 iso_pu_bacteria 2842509118 2842510865 333
170 iso_pu_bacteria 2889306138 2889309933 333
171 iso_pu_bacteria 2902330777 2902330778 333
172 iso_pu_bacteria 2902405164 2902406482 333
173 iso_pu_bacteria 2919408235 2919410793 333
174 iso_pu_bacteria 2919450847 2919451756 333
175 iso_pu_bacteria 3005416602 3005418357 333
176 iso_pu_bacteria 8005314921 8005318751 333
177 iso_pu_bacteria 8005484373 8005486832 333
178 iso_pu_bacteria 8005645114 8005647287 333
179 iso_pu_bacteria 8005682033 8005682072 333
180 iso_pu_bacteria 8024486573 8024492590 333
181 iso_pu_bacteria 2513237104 2513715146 334
182 iso_pu_bacteria 8006926726 8006928184 334
183 3300005617 Ga0068859_100168809 Ga0068859_1001688092 335
184 3300005843 Ga0068860_100000441 Ga0068860_10000044117 335
185 3300006931 Ga0097620_100168813 Ga0097620_1001688132 335
186 3300028379 Ga0268266_10027444 Ga0268266_100274441 335
187 3300028381 Ga0268264_10000042 Ga0268264_1000004266 335
188 3300030521 Ga0307511_10097007 Ga0307511_100970072 335
189 3300031616 Ga0307508_10173606 Ga0307508_101736062 335
190 3300033179 Ga0307507_10083854 Ga0307507_100838542 335
191 3300049569 Ga0501032_0045469 Ga0501032_0045469_1697_2725 335
192 3300049571 Ga0501034_0025675 Ga0501034_0025675_4378_5406 335
193 3300049574 Ga0501038_0163731 Ga0501038_0163731_430_1458 335
194 3300049575 Ga0501039_0185769 Ga0501039_0185769_105_1133 335
195 3300049579 Ga0501043_0045550 Ga0501043_0045550_1980_3008 335
196 3300049580 Ga0501046_0043115 Ga0501046_0043115_1763_2791 335
197 3300049581 Ga0501047_0075852 Ga0501047_0075852_1988_3016 335
198 3300049583 Ga0501067_0006020 Ga0501067_0006020_3633_4661 335
199 3300049585 Ga0501069_0025014 Ga0501069_0025014_525_1553 335
200 3300049586 Ga0501070_0034524 Ga0501070_0034524_2851_3879 335
201 3300049589 Ga0501073_0038051 Ga0501073_0038051_211_1239 335
202 3300049590 Ga0501074_0014830 Ga0501074_0014830_886_1914 335
203 3300049592 Ga0501076_0077423 Ga0501076_0077423_1418_2446 335
204 3300049741 Ga0501079_0036089 Ga0501079_0036089_1971_2999 335
205 3300049742 Ga0501080_0062784 Ga0501080_0062784_710_1738 335
206 3300049823 Ga0501044_0071296 Ga0501044_0071296_880_1908 335
207 3300060353 Ga0501082_0046640 Ga0501082_0046640_863_1891 335
208 iso_pu_bacteria 2524023205 2524440960 335
209 iso_pu_bacteria 2744054633 2745082515 335
210 iso_pu_bacteria 2876761206 2876764446 335
211 iso_pu_bacteria 2883291878 2883295584 335
212 3300005331 Ga0070670_100067698 Ga0070670_1000676981 336
213 3300005340 Ga0070689_100238912 Ga0070689_1002389121 336
214 3300005355 Ga0070671_100001622 Ga0070671_10000162220 336
215 3300005434 Ga0070709_10114485 Ga0070709_101144852 336
216 3300005436 Ga0070713_100104925 Ga0070713_1001049252 336
217 3300005439 Ga0070711_100002094 Ga0070711_1000020945 336
218 3300005548 Ga0070665_100043721 Ga0070665_1000437214 336
219 3300006028 Ga0070717_10095167 Ga0070717_100951672 336
220 3300006175 Ga0070712_100034203 Ga0070712_1000342031 336
221 3300009098 Ga0105245_10028125 Ga0105245_100281254 336
222 3300009176 Ga0105242_10338971 Ga0105242_103389712 336
223 3300009177 Ga0105248_10218262 Ga0105248_102182622 336
224 3300010375 Ga0105239_10310214 Ga0105239_103102141 336
225 3300011119 Ga0105246_10133121 Ga0105246_101331212 336
226 3300013105 Ga0157369_10024108 Ga0157369_100241084 336
227 3300021384 Ga0213876_10022915 Ga0213876_100229152 336
228 3300024227 Ga0228598_1001174 Ga0228598_10011745 336
229 3300025906 Ga0207699_10103786 Ga0207699_101037862 336
230 3300025906 Ga0207699_10148168 Ga0207699_101481681 336
231 3300025913 Ga0207695_10176771 Ga0207695_101767712 336
232 3300025915 Ga0207693_10048585 Ga0207693_100485854 336
233 3300025915 Ga0207693_10052746 Ga0207693_100527463 336
234 3300025923 Ga0207681_10290684 Ga0207681_102906841 336
235 3300025924 Ga0207694_10075214 Ga0207694_100752141 336
236 3300025924 Ga0207694_10348417 Ga0207694_103484171 336
237 3300025929 Ga0207664_10197589 Ga0207664_101975892 336
238 3300025931 Ga0207644_10006361 Ga0207644_100063617 336
239 3300025936 Ga0207670_10035160 Ga0207670_100351602 336
240 3300025945 Ga0207679_10081020 Ga0207679_100810202 336
241 3300025949 Ga0207667_10277669 Ga0207667_102776693 336
242 3300025960 Ga0207651_10059304 Ga0207651_100593044 336
243 3300026078 Ga0207702_10111127 Ga0207702_101111273 336
244 3300035117 Ga0373953_0052044 Ga0373953_0052044_451_1470 336
245 3300035692 Ga0373935_0203343 Ga0373935_0203343_188_1207 336
246 3300036401 Ga0373937_0022374 Ga0373937_0022374_3820_4839 336
247 3300037466 Ga0395898_0378642 Ga0395898_0378642_313_1332 336
248 3300037853 Ga0436364_0162304 Ga0436364_0162304_16096_17130 336
249 3300037853 Ga0436364_1353674 Ga0436364_1353674_113_1147 336
250 3300039437 Ga0436365_0017671 Ga0436365_0017671_1125_2159 336
251 3300039437 Ga0436365_0879402 Ga0436365_0879402_1891_2907 336
252 3300046516 Ga0495628_0024176 Ga0495628_0024176_2945_3964 336
253 3300046559 Ga0495667_0051566 Ga0495667_0051566_55_1074 336
254 3300046663 Ga0495635_0039786 Ga0495635_0039786_280_1299 336
255 3300046678 Ga0495599_0102050 Ga0495599_0102050_412_1431 336
256 3300046679 Ga0495623_0014468 Ga0495623_0014468_3837_4856 336
257 3300047319 Ga0495674_0136332 Ga0495674_0136332_1012_2031 336
258 3300047471 Ga0495684_0040306 Ga0495684_0040306_721_1740 336
259 3300047472 Ga0495686_0004028 Ga0495686_0004028_5326_6336 336
260 3300048088 Ga0495602_0067942 Ga0495602_0067942_1506_2525 336
261 3300048915 Ga0496112_0007297 Ga0496112_0007297_1952_2965 336
262 3300048915 Ga0496112_0190965 Ga0496112_0190965_271_1284 336
263 3300048925 Ga0496122_0069355 Ga0496122_0069355_429_1445 336
264 3300048929 Ga0496126_0086626 Ga0496126_0086626_1510_2526 336
265 3300053077 Ga0495601_0010821 Ga0495601_0010821_350_1369 336
266 iso_pu_bacteria 8055431914 8055432631 336
267 3300001979 JGI24740J21852_10019283 JGI24740J21852_100192832 337
268 3300002704 JGI25155J39150_1000012 JGI25155J39150_100001236 337
269 3300002705 JGI25156J39149_1000049 JGI25156J39149_100004957 337
270 3300002737 JGI25162J39368_1000695 JGI25162J39368_10006956 337
271 3300002737 JGI25162J39368_1001578 JGI25162J39368_10015789 337
272 3300002738 JGI25154J39366_1000033 JGI25154J39366_1000033137 337
273 3300002741 JGI25157J39369_1000055 JGI25157J39369_100005536 337
274 3300003214 JGI25165J46597_1000905 JGI25165J46597_10009054 337
275 3300003214 JGI25165J46597_1004234 JGI25165J46597_10042343 337
276 3300003354 JGI25160J50197_1000006 JGI25160J50197_1000006238 337
277 3300003374 JGI25161J50226_1000004 JGI25161J50226_1000004238 337
278 3300003752 Ga0055539_1003688 Ga0055539_10036881 337
279 3300004625 Ga0055543_1000002 Ga0055543_100000297 337
280 3300005262 Ga0065165_1000217 Ga0065165_100021724 337
281 3300005329 Ga0070683_100007448 Ga0070683_1000074481 337
282 3300005337 Ga0070682_100019723 Ga0070682_1000197231 337
283 3300005434 Ga0070709_10010635 Ga0070709_100106356 337
284 3300005434 Ga0070709_10013745 Ga0070709_100137454 337
285 3300005434 Ga0070709_10035384 Ga0070709_100353845 337
286 3300005435 Ga0070714_100022122 Ga0070714_1000221223 337
287 3300005435 Ga0070714_100195952 Ga0070714_1001959521 337
288 3300005435 Ga0070714_100398197 Ga0070714_1003981971 337
289 3300005436 Ga0070713_100023616 Ga0070713_1000236163 337
290 3300005437 Ga0070710_10005571 Ga0070710_100055715 337
291 3300005439 Ga0070711_100009431 Ga0070711_1000094316 337
292 3300005439 Ga0070711_100022701 Ga0070711_1000227012 337
293 3300005455 Ga0070663_100016214 Ga0070663_1000162145 337
294 3300005458 Ga0070681_10037795 Ga0070681_100377952 337
295 3300005458 Ga0070681_10054570 Ga0070681_100545702 337
296 3300005458 Ga0070681_10055134 Ga0070681_100551341 337
297 3300005471 Ga0070698_100067751 Ga0070698_1000677513 337
298 3300005530 Ga0070679_100055225 Ga0070679_1000552254 337
299 3300005530 Ga0070679_100126962 Ga0070679_1001269623 337
300 3300005535 Ga0070684_100001944 Ga0070684_1000019447 337
301 3300005563 Ga0068855_100544243 Ga0068855_1005442432 337
302 3300005577 Ga0068857_100034266 Ga0068857_1000342664 337
303 3300005985 Ga0081539_10106110 Ga0081539_101061102 337
304 3300006028 Ga0070717_10210529 Ga0070717_102105291 337
305 3300006038 Ga0075365_10008336 Ga0075365_100083363 337
306 3300006051 Ga0075364_10011646 Ga0075364_100116462 337
307 3300006175 Ga0070712_100014922 Ga0070712_1000149222 337
308 3300006175 Ga0070712_100025960 Ga0070712_1000259605 337
309 3300006175 Ga0070712_100129902 Ga0070712_1001299022 337
310 3300006177 Ga0075362_10031783 Ga0075362_100317832 337
311 3300006195 Ga0075366_10208031 Ga0075366_102080311 337
312 3300006844 Ga0075428_100054241 Ga0075428_1000542413 337
313 3300006846 Ga0075430_100133130 Ga0075430_1001331301 337
314 3300006847 Ga0075431_100024748 Ga0075431_1000247482 337
315 3300006871 Ga0075434_100014581 Ga0075434_1000145817 337
316 3300006880 Ga0075429_100016272 Ga0075429_1000162726 337
317 3300009093 Ga0105240_10000019 Ga0105240_1000001937 337
318 3300009147 Ga0114129_10030052 Ga0114129_100300526 337
319 3300009174 Ga0105241_10136447 Ga0105241_101364471 337
320 3300009545 Ga0105237_10005613 Ga0105237_100056134 337
321 3300009551 Ga0105238_10052110 Ga0105238_100521104 337
322 3300009551 Ga0105238_10365962 Ga0105238_103659621 337
323 3300013100 Ga0157373_10175354 Ga0157373_101753542 337
324 3300013104 Ga0157370_10016613 Ga0157370_100166133 337
325 3300013105 Ga0157369_10006837 Ga0157369_100068372 337
326 3300013105 Ga0157369_10112167 Ga0157369_101121672 337
327 3300015262 Ga0182007_10002379 Ga0182007_100023796 337
328 3300015265 Ga0182005_1029636 Ga0182005_10296362 337
329 3300021384 Ga0213876_10001452 Ga0213876_100014529 337
330 3300021388 Ga0213875_10011424 Ga0213875_100114242 337
331 3300021388 Ga0213875_10037283 Ga0213875_100372832 337
332 3300021441 Ga0213871_10008482 Ga0213871_100084822 337
333 3300021441 Ga0213871_10032034 Ga0213871_100320341 337
334 3300025206 Ga0209435_100005 Ga0209435_10000536 337
335 3300025233 Ga0209437_100078 Ga0209437_10007860 337
336 3300025233 Ga0209437_100174 Ga0209437_100174126 337
337 3300025246 Ga0209646_1000011 Ga0209646_100001136 337
338 3300025250 Ga0209026_1000008 Ga0209026_100000836 337
339 3300025253 Ga0209677_100155 Ga0209677_10015558 337
340 3300025253 Ga0209677_100598 Ga0209677_1005989 337
341 3300025256 Ga0209759_1000004 Ga0209759_100000436 337
342 3300025261 Ga0209233_1000163 Ga0209233_100016360 337
343 3300025261 Ga0209233_1000295 Ga0209233_100029512 337
344 3300025261 Ga0209233_1000397 Ga0209233_100039719 337
345 3300025261 Ga0209233_1000654 Ga0209233_100065417 337
346 3300025272 Ga0209455_1000954 Ga0209455_10009544 337
347 3300025272 Ga0209455_1003971 Ga0209455_10039712 337
348 3300025284 Ga0209130_1000032 Ga0209130_1000032229 337
349 3300025294 Ga0209025_1003950 Ga0209025_10039505 337
350 3300025295 Ga0209564_1000017 Ga0209564_1000017356 337
351 3300025302 Ga0207426_1000077 Ga0207426_1000077229 337
352 3300025898 Ga0207692_10004323 Ga0207692_100043232 337
353 3300025906 Ga0207699_10008748 Ga0207699_100087482 337
354 3300025906 Ga0207699_10022463 Ga0207699_100224634 337
355 3300025912 Ga0207707_10037974 Ga0207707_100379742 337
356 3300025912 Ga0207707_10042266 Ga0207707_100422661 337
357 3300025912 Ga0207707_10165142 Ga0207707_101651421 337
358 3300025913 Ga0207695_10000049 Ga0207695_1000004938 337
359 3300025913 Ga0207695_10067367 Ga0207695_100673672 337
360 3300025914 Ga0207671_10000556 Ga0207671_1000055614 337
361 3300025914 Ga0207671_10061221 Ga0207671_100612212 337
362 3300025915 Ga0207693_10018049 Ga0207693_100180492 337
363 3300025915 Ga0207693_10022995 Ga0207693_100229955 337
364 3300025915 Ga0207693_10047684 Ga0207693_100476843 337
365 3300025916 Ga0207663_10018000 Ga0207663_100180002 337
366 3300025921 Ga0207652_10088133 Ga0207652_100881331 337
367 3300025921 Ga0207652_10108202 Ga0207652_101082023 337
368 3300025924 Ga0207694_10086265 Ga0207694_100862652 337
369 3300025928 Ga0207700_10028157 Ga0207700_100281574 337
370 3300025928 Ga0207700_10101308 Ga0207700_101013083 337
371 3300025929 Ga0207664_10019954 Ga0207664_100199542 337
372 3300025939 Ga0207665_10008791 Ga0207665_100087913 337
373 3300025944 Ga0207661_10001176 Ga0207661_1000117618 337
374 3300025944 Ga0207661_10042710 Ga0207661_100427101 337
375 3300025949 Ga0207667_10219314 Ga0207667_102193142 337
376 3300026067 Ga0207678_10016418 Ga0207678_100164184 337
377 3300026116 Ga0207674_10040652 Ga0207674_100406524 337
378 3300026121 Ga0207683_10268259 Ga0207683_102682592 337
379 3300026142 Ga0207698_10515897 Ga0207698_105158971 337
380 3300027312 Ga0209371_1002800 Ga0209371_10028007 337
381 3300030500 Ga0268256_1002695 Ga0268256_10026954 337
382 3300031249 Ga0265339_10019029 Ga0265339_100190292 337
383 3300031711 Ga0265314_10022701 Ga0265314_100227012 337
384 3300031712 Ga0265342_10009985 Ga0265342_100099851 337
385 3300035086 Ga0373934_0046481 Ga0373934_0046481_668_1690 337
386 3300035111 Ga0373923_0038706 Ga0373923_0038706_579_1601 337
387 3300035113 Ga0373936_0011298 Ga0373936_0011298_1962_2984 337
388 3300035113 Ga0373936_0011501 Ga0373936_0011501_1018_2046 337
389 3300035119 Ga0373956_0074454 Ga0373956_0074454_479_1501 337
390 3300035171 Ga0373946_0008038 Ga0373946_0008038_2028_3050 337
391 3300035410 Ga0373924_0023028 Ga0373924_0023028_726_1748 337
392 3300035695 Ga0373927_0224097 Ga0373927_0224097_150_1172 337
393 3300036401 Ga0373937_0040115 Ga0373937_0040115_1565_2587 337
394 3300036401 Ga0373937_0072791 Ga0373937_0072791_1092_2114 337
395 3300037068 Ga0373925_0024925 Ga0373925_0024925_1145_2167 337
396 3300037466 Ga0395898_0238098 Ga0395898_0238098_480_1508 337
397 3300037853 Ga0436364_0541108 Ga0436364_0541108_1156_2187 337
398 3300037853 Ga0436364_0919460 Ga0436364_0919460_1333_2373 337
399 3300037853 Ga0436364_1070350 Ga0436364_1070350_144_1184 337
400 3300039437 Ga0436365_1095754 Ga0436365_1095754_27949_28980 337
401 3300039438 Ga0436360_1272471 Ga0436360_1272471_509_1546 337
402 3300039447 Ga0436361_1007353 Ga0436361_1007353_68_1108 337
403 3300039450 Ga0436363_0222309 Ga0436363_0222309_1385_2425 337
404 3300039450 Ga0436363_0895910 Ga0436363_0895910_956_1975 337
405 3300039450 Ga0436363_1667015 Ga0436363_1667015_528_1559 337
406 3300039453 Ga0436362_0460244 Ga0436362_0460244_499_1530 337
407 3300044684 Ga0466966_0044278 Ga0466966_0044278_1722_2744 337
408 3300044693 Ga0466961_0139699 Ga0466961_0139699_175_1197 337
409 3300044694 Ga0466963_0047691 Ga0466963_0047691_480_1496 337
410 3300044719 Ga0466971_0040553 Ga0466971_0040553_154_1176 337
411 3300044735 Ga0466968_0014002 Ga0466968_0014002_702_1727 337
412 3300044765 Ga0466970_0005887 Ga0466970_0005887_3174_4190 337
413 3300044842 Ga0466957_0093176 Ga0466957_0093176_271_1305 337
414 3300045049 Ga0466959_0088321 Ga0466959_0088321_690_1730 337
415 3300045049 Ga0466959_0115993 Ga0466959_0115993_368_1438 337
416 3300045049 Ga0466959_0128908 Ga0466959_0128908_423_1445 337
417 3300045051 Ga0451576_0019109 Ga0451576_0019109_2603_3634 337
418 3300046454 Ga0495592_0053457 Ga0495592_0053457_645_1667 337
419 3300046459 Ga0495629_0105228 Ga0495629_0105228_313_1335 337
420 3300046462 Ga0495651_0111992 Ga0495651_0111992_281_1300 337
421 3300046462 Ga0495651_0296345 Ga0495651_0296345_54_1076 337
422 3300046472 Ga0495580_0004348 Ga0495580_0004348_5454_6476 337
423 3300046475 Ga0495639_0009703 Ga0495639_0009703_1369_2391 337
424 3300046475 Ga0495639_0119834 Ga0495639_0119834_74_1090 337
425 3300046476 Ga0495662_0013829 Ga0495662_0013829_1293_2312 337
426 3300046477 Ga0495664_0006091 Ga0495664_0006091_5456_6478 337
427 3300046499 Ga0495594_0016990 Ga0495594_0016990_1445_2467 337
428 3300046507 Ga0495606_0097780 Ga0495606_0097780_219_1235 337
429 3300046517 Ga0495630_0046966 Ga0495630_0046966_852_1874 337
430 3300046529 Ga0495652_0194426 Ga0495652_0194426_58_1080 337
431 3300046529 Ga0495652_0225534 Ga0495652_0225534_361_1377 337
432 3300046531 Ga0495665_0102049 Ga0495665_0102049_416_1438 337
433 3300046536 Ga0495587_0059255 Ga0495587_0059255_101_1120 337
434 3300046543 Ga0495645_0035897 Ga0495645_0035897_591_1613 337
435 3300046642 Ga0495634_0008098 Ga0495634_0008098_1860_2882 337
436 3300046660 Ga0495625_0056106 Ga0495625_0056106_1439_2455 337
437 3300046663 Ga0495635_0075072 Ga0495635_0075072_443_1465 337
438 3300046675 Ga0495657_0048384 Ga0495657_0048384_366_1382 337
439 3300046679 Ga0495623_0083488 Ga0495623_0083488_852_1874 337
440 3300046680 Ga0495646_0013256 Ga0495646_0013256_1097_2119 337
441 3300046681 Ga0495647_0004757 Ga0495647_0004757_2460_3482 337
442 3300046683 Ga0495658_0028738 Ga0495658_0028738_1335_2354 337
443 3300046690 Ga0495624_0005173 Ga0495624_0005173_7148_8170 337
444 3300047317 Ga0495604_0022267 Ga0495604_0022267_3293_4312 337
445 3300047317 Ga0495604_0097283 Ga0495604_0097283_46_1068 337
446 3300047321 Ga0495676_0047432 Ga0495676_0047432_1249_2271 337
447 3300047471 Ga0495684_0004151 Ga0495684_0004151_937_1959 337
448 3300047472 Ga0495686_0007807 Ga0495686_0007807_5604_6620 337
449 3300047673 Ga0495593_0010939 Ga0495593_0010939_570_1592 337
450 3300048088 Ga0495602_0063231 Ga0495602_0063231_1704_2723 337
451 3300048918 Ga0496115_0065002 Ga0496115_0065002_632_1654 337
452 3300048920 Ga0496117_0052520 Ga0496117_0052520_17_1048 337
453 3300048922 Ga0496119_0007476 Ga0496119_0007476_855_1886 337
454 3300048922 Ga0496119_0016957 Ga0496119_0016957_2481_3494 337
455 3300048923 Ga0496120_0032802 Ga0496120_0032802_531_1547 337
456 3300048923 Ga0496120_0085406 Ga0496120_0085406_332_1363 337
457 3300048924 Ga0496121_0020045 Ga0496121_0020045_2449_3465 337
458 3300048924 Ga0496121_0157879 Ga0496121_0157879_315_1346 337
459 3300048925 Ga0496122_0017690 Ga0496122_0017690_1993_3006 337
460 3300048925 Ga0496122_0047820 Ga0496122_0047820_1808_2842 337
461 3300048927 Ga0496124_0035661 Ga0496124_0035661_1909_2922 337
462 3300048928 Ga0496125_0049449 Ga0496125_0049449_2421_3452 337
463 3300048929 Ga0496126_0027701 Ga0496126_0027701_2016_3035 337
464 3300048929 Ga0496126_0051454 Ga0496126_0051454_814_1836 337
465 3300048929 Ga0496126_0061033 Ga0496126_0061033_979_2001 337
466 3300048929 Ga0496126_0187426 Ga0496126_0187426_436_1461 337
467 3300049580 Ga0501046_0080917 Ga0501046_0080917_548_1570 337
468 3300049581 Ga0501047_0032527 Ga0501047_0032527_1156_2178 337
469 3300049586 Ga0501070_0017083 Ga0501070_0017083_1389_2411 337
470 3300049742 Ga0501080_0012855 Ga0501080_0012855_4349_5371 337
471 3300049823 Ga0501044_0026430 Ga0501044_0026430_896_1918 337
472 3300050489 nmdc:mga03683_74735_c1 nmdc:mga03683_74735_c1_363_1394 337
473 3300050491 nmdc:mga00v17_40819_c1 nmdc:mga00v17_40819_c1_1253_2284 337
474 3300050492 nmdc:mga0yw44_4280_c1 nmdc:mga0yw44_4280_c1_3899_4930 337
475 3300050512 nmdc:mga0n895_9573_c1 nmdc:mga0n895_9573_c1_1227_2258 337
476 3300050513 nmdc:mga0rr50_169867_c1 nmdc:mga0rr50_169867_c1_686_1717 337
477 3300053077 Ga0495601_0071871 Ga0495601_0071871_231_1253 337
478 3300053080 Ga0500635_0006112 Ga0500635_0006112_937_1971 337
479 3300053091 Ga0500647_0048081 Ga0500647_0048081_229_1314 337
480 3300053094 Ga0500566_0000492 Ga0500566_0000492_3947_4975 337
481 3300053095 Ga0500640_002350 Ga0500640_002350_3946_4974 337
482 3300053111 Ga0500572_001028 Ga0500572_001028_3957_4985 337
483 3300053122 Ga0500608_013262 Ga0500608_013262_325_1353 337
484 3300053123 Ga0500614_002677 Ga0500614_002677_2542_3570 337
485 3300053136 Ga0500559_0001778 Ga0500559_0001778_30_1058 337
486 3300053148 Ga0500590_000321 Ga0500590_000321_8824_9840 337
487 3300053148 Ga0500590_034482 Ga0500590_034482_1449_2477 337
488 3300053150 Ga0500603_008527 Ga0500603_008527_687_1709 337
489 3300053159 Ga0500630_001509 Ga0500630_001509_2082_3110 337
490 3300053162 Ga0500638_101165 Ga0500638_101165_17_1033 337
491 3300053163 Ga0500639_000065 Ga0500639_000065_43757_44785 337
492 3300053177 Ga0500636_0066432 Ga0500636_0066432_911_1927 337
493 3300053178 Ga0500637_0009953 Ga0500637_0009953_1985_3019 337
494 3300053735 Ga0500596_000776 Ga0500596_000776_30_1058 337
495 3300061719 Ga0466962_0105887 Ga0466962_0105887_70_1092 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04166

PdxA

Pyridoxal phosphate biosynthetic protein PdxA

51

349

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ps6-assembly1.cif.gz_A crystal structure of e.coli pdxa 0.8715 2 336
6xmy-assembly1.cif.gz_A crystal structure of 4-hydroxythreonine-4-phosphate dehydrogenase from legionella pneumophila in complex with nad 0.8652 1 336
1r8k-assembly1.cif.gz_B pdxa protein; nad-dependent dehydrogenase/carboxylase; subunit of pyridoxine phosphate biosynthetic protein pdxj-pdxa [salmonella typhimurium] 0.8618 3 336
1ps6-assembly1.cif.gz_A crystal structure of e.coli pdxa 0.8564 2 336
6xmy-assembly1.cif.gz_A crystal structure of 4-hydroxythreonine-4-phosphate dehydrogenase from legionella pneumophila in complex with nad 0.853 1 336
ID Description Score Start End Superfamily
1r8kA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8702 1 334 3.40.718.10
1r8kA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8573 1 334 3.40.718.10
2hi1B00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8188 2 333 3.40.718.10
2hi1B00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8141 2 333 3.40.718.10
4jqpB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.7822 1 334 3.40.718.10
ID Description Score Start End GO Terms
AF-Q3V819-F1-model_v4 Pyridoxal phosphate biosynthetic protein variant 0.9283 166 276 GO:0016491
GO:0046872
GO:0051287
AF-A0A436MXH2-F1-model_v4 deleted 0.9275 9 188
AF-A0A800AG34-F1-model_v4 4-hydroxythreonine-4-phosphate dehydrogenase PdxA 0.9246 101 335 GO:0016491
GO:0046872
GO:0051287
AF-A0A349VIK0-F1-model_v4 4-hydroxythreonine-4-phosphate dehydrogenase PdxA 0.924 9 195 GO:0016491
GO:0046872
GO:0051287
AF-A0A358AG47-F1-model_v4 4-hydroxythreonine-4-phosphate dehydrogenase PdxA 0.9158 87 336 GO:0016491
GO:0046872
GO:0051287

Feature Viewer

pLDDT pTM Quality
87.7 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map