F454761
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 495 | 341 | 448 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300045049|Ga0466959_0115993|Ga0466959_0115993_368_1438 |
| Length | 356 |
| Sequence | VGEAAAAEPVDLKGNAMAKRHLAITMGDPAGIGPEIIVKACTKLRDRLEASDLKLLIIGSRRALEQANRQIAAGLEVAEVGIDDNDWPNLSFLQADDESIAIEPGVLSADGGRFAYKAVEHGVRLSLSGRVGGIVTAPLNKEALNKAGYHYPGHTEMLAALTGVRGSVMLLAHGNMRVSHVSTHVALQDVPARLTPERLRLVIHLTDKALRAMGMARPKIAVAALNPHAGEGGLFGRQDIDISRPTIEKAVADGLDVVGPIPGDTIFVKLRAGQYDAVVAMYHDQGHIPVKLLGFEVDPTTGKWQELSGVNITLGLPIIRTSVDHGTAFDIAGKGIANERSMIEAIEYAERLAGNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 2 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 3 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 4 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 5 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 6 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 7 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 8 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 9 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 10 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 11 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 12 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 13 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 14 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 15 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 16 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 17 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 18 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 19 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 20 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 21 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 22 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 23 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 24 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 25 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 26 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 27 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 28 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 29 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 30 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 31 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 32 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 33 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 34 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 35 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 36 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 37 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 38 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 39 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 40 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 41 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 42 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 43 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 44 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 45 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 46 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 47 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 49 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 123 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 124 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 174 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 176 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 190 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 208 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 209 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 210 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 211 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 212 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 213 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 219 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 277 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 278 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 279 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 306 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 314 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 315 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 317 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 318 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 319 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 320 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 321 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 322 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 323 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 324 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 325 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 326 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 327 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 329 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 330 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 334 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 335 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 336 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 337 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 338 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 339 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 340 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 341 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.51 |
| Metatranscriptomes | 0 |
| Isolates | 9.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.73 |
| Nodule | 4.04 |
| Rhizoplane | 3.64 |
| Rhizosphere | 64.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10019283 | 3300001979 | Bacteria | 2405 |
| 2 | JGI25155J39150_1000012 | 3300002704 | Bacteria | 199435 |
| 3 | JGI25156J39149_1000049 | 3300002705 | Bacteria | 91988 |
| 4 | JGI25162J39368_1000695 | 3300002737 | Bacteria | 23406 |
| 5 | JGI25162J39368_1001578 | 3300002737 | Bacteria | 11602 |
| 6 | JGI25154J39366_1000033 | 3300002738 | Bacteria | 184379 |
| 7 | JGI25157J39369_1000055 | 3300002741 | Bacteria | 107875 |
| 8 | JGI25165J46597_1000905 | 3300003214 | Bacteria | 20576 |
| 9 | JGI25165J46597_1004234 | 3300003214 | Bacteria | 3158 |
| 10 | JGI25160J50197_1000006 | 3300003354 | Bacteria | 316247 |
| 11 | JGI25161J50226_1000004 | 3300003374 | Bacteria | 316212 |
| 12 | Ga0055539_1003688 | 3300003752 | Bacteria | 2100 |
| 13 | Ga0055540_1001550 | 3300003792 | Bacteria | 13468 |
| 14 | Ga0055540_1002250 | 3300003792 | Bacteria | 10427 |
| 15 | Ga0055543_1000002 | 3300004625 | Bacteria | 390020 |
| 16 | Ga0065165_1000217 | 3300005262 | Bacteria | 100170 |
| 17 | Ga0070683_100007448 | 3300005329 | Bacteria | 9246 |
| 18 | Ga0070670_100067698 | 3300005331 | Bacteria | 3064 |
| 19 | Ga0068869_100182458 | 3300005334 | Bacteria | 1646 |
| 20 | Ga0070682_100019723 | 3300005337 | Bacteria | 3959 |
| 21 | Ga0070689_100238912 | 3300005340 | Bacteria | 1496 |
| 22 | Ga0070668_100148861 | 3300005347 | Bacteria | 1891 |
| 23 | Ga0070675_100145038 | 3300005354 | Bacteria | 2032 |
| 24 | Ga0070671_100001622 | 3300005355 | Bacteria | 16950 |
| 25 | Ga0070674_100022453 | 3300005356 | Bacteria | 4070 |
| 26 | Ga0070688_100066374 | 3300005365 | Bacteria | 2296 |
| 27 | Ga0070709_10010635 | 3300005434 | Bacteria | 5102 |
| 28 | Ga0070709_10013745 | 3300005434 | Bacteria | 4559 |
| 29 | Ga0070709_10035384 | 3300005434 | Bacteria | 3034 |
| 30 | Ga0070709_10114485 | 3300005434 | Bacteria | 1818 |
| 31 | Ga0070714_100022122 | 3300005435 | Bacteria | 5211 |
| 32 | Ga0070714_100195952 | 3300005435 | Bacteria | 1846 |
| 33 | Ga0070714_100398197 | 3300005435 | Bacteria | 1301 |
| 34 | Ga0070713_100023616 | 3300005436 | Bacteria | 4774 |
| 35 | Ga0070713_100104925 | 3300005436 | Bacteria | 2454 |
| 36 | Ga0070710_10005571 | 3300005437 | Bacteria | 5995 |
| 37 | Ga0070711_100002094 | 3300005439 | Bacteria | 11278 |
| 38 | Ga0070711_100009431 | 3300005439 | Bacteria | 6012 |
| 39 | Ga0070711_100022701 | 3300005439 | Bacteria | 4071 |
| 40 | Ga0070700_100008029 | 3300005441 | Bacteria | 5736 |
| 41 | Ga0070700_100313272 | 3300005441 | Bacteria | 1150 |
| 42 | Ga0070663_100016214 | 3300005455 | Bacteria | 4831 |
| 43 | Ga0070662_100180190 | 3300005457 | Bacteria | 1665 |
| 44 | Ga0070681_10037795 | 3300005458 | Bacteria | 4842 |
| 45 | Ga0070681_10054570 | 3300005458 | Bacteria | 3982 |
| 46 | Ga0070681_10055134 | 3300005458 | Bacteria | 3959 |
| 47 | Ga0068867_100082825 | 3300005459 | Bacteria | 2421 |
| 48 | Ga0070685_10189642 | 3300005466 | Bacteria | 1329 |
| 49 | Ga0070698_100067751 | 3300005471 | Bacteria | 3589 |
| 50 | Ga0070679_100055225 | 3300005530 | Bacteria | 3955 |
| 51 | Ga0070679_100126962 | 3300005530 | Bacteria | 2532 |
| 52 | Ga0070684_100001944 | 3300005535 | Bacteria | 15159 |
| 53 | Ga0070665_100007190 | 3300005548 | Bacteria | 11316 |
| 54 | Ga0070665_100043721 | 3300005548 | Bacteria | 4501 |
| 55 | Ga0068855_100544243 | 3300005563 | Bacteria | 1257 |
| 56 | Ga0068857_100034266 | 3300005577 | Bacteria | 4491 |
| 57 | Ga0068859_100168809 | 3300005617 | Bacteria | 2268 |
| 58 | Ga0068859_100454491 | 3300005617 | Bacteria | 1377 |
| 59 | Ga0068861_100076591 | 3300005719 | Bacteria | 2607 |
| 60 | Ga0068863_100267383 | 3300005841 | Bacteria | 1654 |
| 61 | Ga0068860_100000441 | 3300005843 | Bacteria | 52446 |
| 62 | Ga0081539_10106110 | 3300005985 | Bacteria | 1423 |
| 63 | Ga0070717_10095167 | 3300006028 | Bacteria | 2520 |
| 64 | Ga0070717_10210529 | 3300006028 | Bacteria | 1706 |
| 65 | Ga0075365_10008336 | 3300006038 | Bacteria | 5875 |
| 66 | Ga0075365_10136396 | 3300006038 | Bacteria | 1701 |
| 67 | Ga0075365_10145376 | 3300006038 | Bacteria | 1647 |
| 68 | Ga0075364_10011646 | 3300006051 | Bacteria | 5348 |
| 69 | Ga0070712_100014922 | 3300006175 | Bacteria | 4995 |
| 70 | Ga0070712_100025960 | 3300006175 | Bacteria | 3898 |
| 71 | Ga0070712_100034203 | 3300006175 | Bacteria | 3443 |
| 72 | Ga0070712_100129902 | 3300006175 | Bacteria | 1908 |
| 73 | Ga0075362_10031783 | 3300006177 | Bacteria | 2287 |
| 74 | Ga0075366_10208031 | 3300006195 | Bacteria | 1191 |
| 75 | Ga0075428_100054241 | 3300006844 | Bacteria | 4393 |
| 76 | Ga0075430_100133130 | 3300006846 | Bacteria | 2072 |
| 77 | Ga0075431_100024748 | 3300006847 | Bacteria | 6154 |
| 78 | Ga0075434_100014581 | 3300006871 | Bacteria | 7517 |
| 79 | Ga0075429_100016272 | 3300006880 | Bacteria | 6446 |
| 80 | Ga0068865_100050901 | 3300006881 | Bacteria | 2864 |
| 81 | Ga0097620_100168813 | 3300006931 | Bacteria | 2268 |
| 82 | Ga0097620_100454508 | 3300006931 | Bacteria | 1377 |
| 83 | Ga0105251_10024668 | 3300009011 | Bacteria | 3086 |
| 84 | Ga0105244_10001196 | 3300009036 | Bacteria | 21355 |
| 85 | Ga0105244_10012693 | 3300009036 | Bacteria | 4966 |
| 86 | Ga0105250_10002562 | 3300009092 | Bacteria | 9077 |
| 87 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 88 | Ga0105240_10063330 | 3300009093 | Bacteria | 4601 |
| 89 | Ga0111539_10019802 | 3300009094 | Bacteria | 8294 |
| 90 | Ga0105245_10028125 | 3300009098 | Bacteria | 4956 |
| 91 | Ga0114129_10030052 | 3300009147 | Bacteria | 7693 |
| 92 | Ga0105241_10136447 | 3300009174 | Bacteria | 1993 |
| 93 | Ga0105242_10044193 | 3300009176 | Bacteria | 3606 |
| 94 | Ga0105242_10338971 | 3300009176 | Bacteria | 1385 |
| 95 | Ga0105248_10218262 | 3300009177 | Bacteria | 2147 |
| 96 | Ga0105237_10005613 | 3300009545 | Bacteria | 14143 |
| 97 | Ga0105238_10052110 | 3300009551 | Bacteria | 4114 |
| 98 | Ga0105238_10365962 | 3300009551 | Bacteria | 1432 |
| 99 | Ga0105239_10310214 | 3300010375 | Bacteria | 1778 |
| 100 | Ga0105246_10133121 | 3300011119 | Bacteria | 1860 |
| 101 | Ga0157373_10175354 | 3300013100 | Bacteria | 1509 |
| 102 | Ga0157370_10016613 | 3300013104 | Bacteria | 7447 |
| 103 | Ga0157370_10108832 | 3300013104 | Bacteria | 2591 |
| 104 | Ga0157369_10006837 | 3300013105 | Bacteria | 13158 |
| 105 | Ga0157369_10015170 | 3300013105 | Bacteria | 8697 |
| 106 | Ga0157369_10024108 | 3300013105 | Bacteria | 6772 |
| 107 | Ga0157369_10112167 | 3300013105 | Bacteria | 2897 |
| 108 | Ga0163162_10024175 | 3300013306 | Bacteria | 5996 |
| 109 | Ga0157372_10099862 | 3300013307 | Bacteria | 3311 |
| 110 | Ga0157375_10002151 | 3300013308 | Bacteria | 17028 |
| 111 | Ga0157380_10006982 | 3300014326 | Bacteria | 7992 |
| 112 | Ga0157380_10096145 | 3300014326 | Bacteria | 2455 |
| 113 | Ga0157380_10145054 | 3300014326 | Bacteria | 2045 |
| 114 | Ga0182007_10002379 | 3300015262 | Bacteria | 9402 |
| 115 | Ga0182005_1029636 | 3300015265 | Bacteria | 1492 |
| 116 | Ga0213872_10000768 | 3300021361 | Bacteria | 23526 |
| 117 | Ga0213876_10001452 | 3300021384 | Bacteria | 14742 |
| 118 | Ga0213876_10022915 | 3300021384 | Bacteria | 3299 |
| 119 | Ga0213875_10011424 | 3300021388 | Bacteria | 4417 |
| 120 | Ga0213875_10037283 | 3300021388 | Bacteria | 2291 |
| 121 | Ga0213871_10008482 | 3300021441 | Bacteria | 2269 |
| 122 | Ga0213871_10032034 | 3300021441 | Bacteria | 1376 |
| 123 | Ga0228598_1001174 | 3300024227 | Bacteria | 5787 |
| 124 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 125 | Ga0209437_100078 | 3300025233 | Bacteria | 278088 |
| 126 | Ga0209437_100174 | 3300025233 | Bacteria | 138811 |
| 127 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 128 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 129 | Ga0209677_100155 | 3300025253 | Bacteria | 62873 |
| 130 | Ga0209677_100598 | 3300025253 | Bacteria | 19523 |
| 131 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 132 | Ga0209759_1002549 | 3300025256 | Bacteria | 7908 |
| 133 | Ga0209233_1000163 | 3300025261 | Bacteria | 152912 |
| 134 | Ga0209233_1000295 | 3300025261 | Bacteria | 62548 |
| 135 | Ga0209233_1000397 | 3300025261 | Bacteria | 36444 |
| 136 | Ga0209233_1000654 | 3300025261 | Bacteria | 16891 |
| 137 | Ga0209455_1000954 | 3300025272 | Bacteria | 14747 |
| 138 | Ga0209455_1003971 | 3300025272 | Bacteria | 5017 |
| 139 | Ga0209130_1000032 | 3300025284 | Bacteria | 316240 |
| 140 | Ga0209025_1003950 | 3300025294 | Bacteria | 13306 |
| 141 | Ga0209564_1000017 | 3300025295 | Bacteria | 594063 |
| 142 | Ga0207426_1000077 | 3300025302 | Bacteria | 316246 |
| 143 | Ga0209051_1001417 | 3300025303 | Bacteria | 20592 |
| 144 | Ga0209051_1005356 | 3300025303 | Bacteria | 7535 |
| 145 | Ga0209051_1013228 | 3300025303 | Bacteria | 3941 |
| 146 | Ga0207655_1003385 | 3300025728 | Bacteria | 11908 |
| 147 | Ga0207655_1004837 | 3300025728 | Bacteria | 9360 |
| 148 | Ga0207713_1002531 | 3300025735 | Bacteria | 13225 |
| 149 | Ga0207692_10004323 | 3300025898 | Bacteria | 5619 |
| 150 | Ga0207699_10008748 | 3300025906 | Bacteria | 5010 |
| 151 | Ga0207699_10022463 | 3300025906 | Bacteria | 3419 |
| 152 | Ga0207699_10103786 | 3300025906 | Bacteria | 1809 |
| 153 | Ga0207699_10148168 | 3300025906 | Bacteria | 1550 |
| 154 | Ga0207705_10171427 | 3300025909 | Bacteria | 1634 |
| 155 | Ga0207707_10037974 | 3300025912 | Bacteria | 4207 |
| 156 | Ga0207707_10042266 | 3300025912 | Bacteria | 3979 |
| 157 | Ga0207707_10165142 | 3300025912 | Bacteria | 1935 |
| 158 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 159 | Ga0207695_10067367 | 3300025913 | Bacteria | 3673 |
| 160 | Ga0207695_10176771 | 3300025913 | Bacteria | 2057 |
| 161 | Ga0207671_10000556 | 3300025914 | Bacteria | 50250 |
| 162 | Ga0207671_10061221 | 3300025914 | Bacteria | 2793 |
| 163 | Ga0207693_10018049 | 3300025915 | Bacteria | 5623 |
| 164 | Ga0207693_10022995 | 3300025915 | Bacteria | 4950 |
| 165 | Ga0207693_10047684 | 3300025915 | Bacteria | 3366 |
| 166 | Ga0207693_10048585 | 3300025915 | Bacteria | 3332 |
| 167 | Ga0207693_10052746 | 3300025915 | Bacteria | 3190 |
| 168 | Ga0207663_10006154 | 3300025916 | Bacteria | 6112 |
| 169 | Ga0207663_10018000 | 3300025916 | Bacteria | 3947 |
| 170 | Ga0207649_10085651 | 3300025920 | Bacteria | 2051 |
| 171 | Ga0207652_10088133 | 3300025921 | Bacteria | 2722 |
| 172 | Ga0207652_10108202 | 3300025921 | Bacteria | 2463 |
| 173 | Ga0207681_10290684 | 3300025923 | Bacteria | 1290 |
| 174 | Ga0207694_10075214 | 3300025924 | Bacteria | 2644 |
| 175 | Ga0207694_10086265 | 3300025924 | Bacteria | 2472 |
| 176 | Ga0207694_10348417 | 3300025924 | Bacteria | 1226 |
| 177 | Ga0207650_10108645 | 3300025925 | Bacteria | 2144 |
| 178 | Ga0207659_10133852 | 3300025926 | Bacteria | 1917 |
| 179 | Ga0207700_10028157 | 3300025928 | Bacteria | 3946 |
| 180 | Ga0207700_10101308 | 3300025928 | Bacteria | 2297 |
| 181 | Ga0207664_10019954 | 3300025929 | Bacteria | 4962 |
| 182 | Ga0207664_10197589 | 3300025929 | Bacteria | 1734 |
| 183 | Ga0207644_10006361 | 3300025931 | Bacteria | 7690 |
| 184 | Ga0207670_10035160 | 3300025936 | Bacteria | 3246 |
| 185 | Ga0207665_10008791 | 3300025939 | Bacteria | 6641 |
| 186 | Ga0207661_10001176 | 3300025944 | Bacteria | 17500 |
| 187 | Ga0207661_10042710 | 3300025944 | Bacteria | 3575 |
| 188 | Ga0207679_10081020 | 3300025945 | Bacteria | 2481 |
| 189 | Ga0207667_10219314 | 3300025949 | Bacteria | 1949 |
| 190 | Ga0207667_10277669 | 3300025949 | Bacteria | 1712 |
| 191 | Ga0207651_10059304 | 3300025960 | Bacteria | 2650 |
| 192 | Ga0207651_10119073 | 3300025960 | Bacteria | 1999 |
| 193 | Ga0207651_10249098 | 3300025960 | Bacteria | 1452 |
| 194 | Ga0207678_10016418 | 3300026067 | Bacteria | 6500 |
| 195 | Ga0207708_10008896 | 3300026075 | Bacteria | 7432 |
| 196 | Ga0207702_10111127 | 3300026078 | Bacteria | 2437 |
| 197 | Ga0207641_10134404 | 3300026088 | Bacteria | 2225 |
| 198 | Ga0207648_10070370 | 3300026089 | Bacteria | 3050 |
| 199 | Ga0207674_10040652 | 3300026116 | Bacteria | 4816 |
| 200 | Ga0207674_10191715 | 3300026116 | Bacteria | 1994 |
| 201 | Ga0207683_10268259 | 3300026121 | Bacteria | 1559 |
| 202 | Ga0207698_10515897 | 3300026142 | Bacteria | 1165 |
| 203 | Ga0209371_1002800 | 3300027312 | Bacteria | 9283 |
| 204 | Ga0268266_10007178 | 3300028379 | Bacteria | 10094 |
| 205 | Ga0268266_10027444 | 3300028379 | Bacteria | 4841 |
| 206 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 207 | Ga0307515_10078454 | 3300028794 | Bacteria | 4342 |
| 208 | Ga0268256_1002695 | 3300030500 | Bacteria | 8741 |
| 209 | Ga0307511_10097007 | 3300030521 | Bacteria | 1960 |
| 210 | Ga0265339_10019029 | 3300031249 | Bacteria | 4038 |
| 211 | Ga0307513_10003954 | 3300031456 | Bacteria | 19915 |
| 212 | Ga0307508_10173606 | 3300031616 | Bacteria | 1758 |
| 213 | Ga0265314_10022701 | 3300031711 | Bacteria | 4803 |
| 214 | Ga0265342_10009985 | 3300031712 | Bacteria | 6633 |
| 215 | Ga0307413_10005055 | 3300031824 | Bacteria | 5829 |
| 216 | Ga0307410_10038401 | 3300031852 | Bacteria | 3136 |
| 217 | Ga0307406_10024853 | 3300031901 | Bacteria | 3582 |
| 218 | Ga0307406_10219077 | 3300031901 | Bacteria | 1413 |
| 219 | Ga0307407_10014499 | 3300031903 | Bacteria | 3863 |
| 220 | Ga0307412_10180659 | 3300031911 | Bacteria | 1587 |
| 221 | Ga0307416_100019262 | 3300032002 | Bacteria | 4834 |
| 222 | Ga0307414_10177345 | 3300032004 | Bacteria | 1710 |
| 223 | Ga0307411_10011644 | 3300032005 | Bacteria | 4760 |
| 224 | Ga0307507_10083854 | 3300033179 | Bacteria | 2783 |
| 225 | Ga0373934_0046481 | 3300035086 | Bacteria | 1717 |
| 226 | Ga0373923_0038706 | 3300035111 | Bacteria | 1955 |
| 227 | Ga0373923_0165466 | 3300035111 | Bacteria | 1011 |
| 228 | Ga0373936_0011298 | 3300035113 | Bacteria | 3379 |
| 229 | Ga0373936_0011501 | 3300035113 | Bacteria | 3351 |
| 230 | Ga0373953_0052044 | 3300035117 | Bacteria | 1657 |
| 231 | Ga0373956_0074454 | 3300035119 | Bacteria | 1552 |
| 232 | Ga0373946_0008038 | 3300035171 | Bacteria | 3873 |
| 233 | Ga0373924_0023028 | 3300035410 | Bacteria | 2438 |
| 234 | Ga0373935_0203343 | 3300035692 | Bacteria | 1370 |
| 235 | Ga0373927_0224097 | 3300035695 | Bacteria | 1235 |
| 236 | Ga0373947_0043733 | 3300035725 | Bacteria | 2676 |
| 237 | Ga0373937_0022374 | 3300036401 | Bacteria | 5684 |
| 238 | Ga0373937_0040115 | 3300036401 | Bacteria | 4268 |
| 239 | Ga0373937_0072791 | 3300036401 | Bacteria | 3170 |
| 240 | Ga0373925_0024925 | 3300037068 | Bacteria | 4369 |
| 241 | Ga0395900_0165254 | 3300037418 | Bacteria | 2256 |
| 242 | Ga0395898_0105076 | 3300037466 | Bacteria | 2708 |
| 243 | Ga0395898_0185241 | 3300037466 | Bacteria | 1989 |
| 244 | Ga0395898_0238098 | 3300037466 | Bacteria | 1736 |
| 245 | Ga0395898_0378642 | 3300037466 | Bacteria | 1350 |
| 246 | Ga0436364_0162304 | 3300037853 | Bacteria | 33275 |
| 247 | Ga0436364_0541108 | 3300037853 | Bacteria | 4556 |
| 248 | Ga0436364_0919460 | 3300037853 | Bacteria | 3894 |
| 249 | Ga0436364_1070350 | 3300037853 | Bacteria | 2220 |
| 250 | Ga0436364_1353674 | 3300037853 | Bacteria | 1547 |
| 251 | Ga0395901_0048997 | 3300038443 | Bacteria | 4388 |
| 252 | Ga0436365_0017671 | 3300039437 | Bacteria | 2557 |
| 253 | Ga0436365_0879402 | 3300039437 | Bacteria | 3086 |
| 254 | Ga0436365_1095754 | 3300039437 | Bacteria | 43052 |
| 255 | Ga0436360_0757752 | 3300039438 | Bacteria | 1923 |
| 256 | Ga0436360_1272471 | 3300039438 | Bacteria | 3768 |
| 257 | Ga0436360_1360442 | 3300039438 | Bacteria | 6037 |
| 258 | Ga0436361_1007353 | 3300039447 | Bacteria | 3193 |
| 259 | Ga0436363_0222309 | 3300039450 | Bacteria | 2461 |
| 260 | Ga0436363_0737283 | 3300039450 | Bacteria | 1763 |
| 261 | Ga0436363_0895910 | 3300039450 | Bacteria | 2030 |
| 262 | Ga0436363_1667015 | 3300039450 | Bacteria | 2327 |
| 263 | Ga0436362_0460244 | 3300039453 | Bacteria | 2387 |
| 264 | Ga0439464_0005549 | 3300042439 | Bacteria | 3267 |
| 265 | Ga0466969_0011981 | 3300044656 | Bacteria | 4585 |
| 266 | Ga0466972_0031172 | 3300044658 | Bacteria | 2623 |
| 267 | Ga0466972_0090062 | 3300044658 | Bacteria | 1455 |
| 268 | Ga0466966_0044278 | 3300044684 | Bacteria | 2850 |
| 269 | Ga0466961_0139699 | 3300044693 | Bacteria | 1517 |
| 270 | Ga0466963_0047691 | 3300044694 | Bacteria | 2828 |
| 271 | Ga0466971_0040553 | 3300044719 | Bacteria | 2091 |
| 272 | Ga0466968_0014002 | 3300044735 | Bacteria | 3163 |
| 273 | Ga0466970_0005887 | 3300044765 | Bacteria | 6107 |
| 274 | Ga0466957_0093176 | 3300044842 | Bacteria | 1890 |
| 275 | Ga0466959_0088321 | 3300045049 | Bacteria | 2229 |
| 276 | Ga0466959_0115993 | 3300045049 | Bacteria | 1907 |
| 277 | Ga0466959_0128908 | 3300045049 | Bacteria | 1794 |
| 278 | Ga0451576_0019109 | 3300045051 | Bacteria | 7488 |
| 279 | Ga0466967_0075379 | 3300045976 | Bacteria | 3032 |
| 280 | Ga0495627_000423 | 3300046453 | Bacteria | 36816 |
| 281 | Ga0495592_0053457 | 3300046454 | Bacteria | 2996 |
| 282 | Ga0495629_0105228 | 3300046459 | Bacteria | 1968 |
| 283 | Ga0495651_0111992 | 3300046462 | Bacteria | 2017 |
| 284 | Ga0495651_0296345 | 3300046462 | Bacteria | 1086 |
| 285 | Ga0495580_0004348 | 3300046472 | Bacteria | 11900 |
| 286 | Ga0495605_0007922 | 3300046474 | Bacteria | 6017 |
| 287 | Ga0495639_0009703 | 3300046475 | Bacteria | 4131 |
| 288 | Ga0495639_0119834 | 3300046475 | Bacteria | 1255 |
| 289 | Ga0495662_0013829 | 3300046476 | Bacteria | 3928 |
| 290 | Ga0495664_0006091 | 3300046477 | Bacteria | 6657 |
| 291 | Ga0495594_0016990 | 3300046499 | Bacteria | 3840 |
| 292 | Ga0495606_0097780 | 3300046507 | Bacteria | 1793 |
| 293 | Ga0495628_0024176 | 3300046516 | Bacteria | 4975 |
| 294 | Ga0495630_0046966 | 3300046517 | Bacteria | 3228 |
| 295 | Ga0495652_0194426 | 3300046529 | Bacteria | 1545 |
| 296 | Ga0495652_0225534 | 3300046529 | Bacteria | 1405 |
| 297 | Ga0495665_0102049 | 3300046531 | Bacteria | 1505 |
| 298 | Ga0495587_0059255 | 3300046536 | Bacteria | 2248 |
| 299 | Ga0495645_0035897 | 3300046543 | Bacteria | 3614 |
| 300 | Ga0495667_0051566 | 3300046559 | Bacteria | 2714 |
| 301 | Ga0495668_0007763 | 3300046616 | Bacteria | 6806 |
| 302 | Ga0495634_0008098 | 3300046642 | Bacteria | 7838 |
| 303 | Ga0495625_0013004 | 3300046660 | Bacteria | 6714 |
| 304 | Ga0495625_0056106 | 3300046660 | Bacteria | 2806 |
| 305 | Ga0495635_0039786 | 3300046663 | Bacteria | 3252 |
| 306 | Ga0495635_0075072 | 3300046663 | Bacteria | 2316 |
| 307 | Ga0495657_0048384 | 3300046675 | Bacteria | 2869 |
| 308 | Ga0495599_0102050 | 3300046678 | Bacteria | 1788 |
| 309 | Ga0495623_0014468 | 3300046679 | Bacteria | 5106 |
| 310 | Ga0495623_0083488 | 3300046679 | Bacteria | 1973 |
| 311 | Ga0495646_0013256 | 3300046680 | Bacteria | 5239 |
| 312 | Ga0495647_0004757 | 3300046681 | Bacteria | 4431 |
| 313 | Ga0495658_0028738 | 3300046683 | Bacteria | 3004 |
| 314 | Ga0495624_0005173 | 3300046690 | Bacteria | 9428 |
| 315 | Ga0495589_0162703 | 3300046794 | Bacteria | 1063 |
| 316 | Ga0495660_0000877 | 3300046810 | Bacteria | 22235 |
| 317 | Ga0495604_0022267 | 3300047317 | Bacteria | 5059 |
| 318 | Ga0495604_0097283 | 3300047317 | Bacteria | 2171 |
| 319 | Ga0495674_0136332 | 3300047319 | Bacteria | 2065 |
| 320 | Ga0495676_0047432 | 3300047321 | Bacteria | 3474 |
| 321 | Ga0495673_0016628 | 3300047469 | Bacteria | 3757 |
| 322 | Ga0495684_0004151 | 3300047471 | Bacteria | 11313 |
| 323 | Ga0495684_0040306 | 3300047471 | Bacteria | 3581 |
| 324 | Ga0495686_0004028 | 3300047472 | Bacteria | 12284 |
| 325 | Ga0495686_0007807 | 3300047472 | Bacteria | 7959 |
| 326 | Ga0495593_0010939 | 3300047673 | Bacteria | 5226 |
| 327 | Ga0495602_0063231 | 3300048088 | Bacteria | 3208 |
| 328 | Ga0495602_0067942 | 3300048088 | Bacteria | 3063 |
| 329 | Ga0496100_0120033 | 3300048903 | Bacteria | 1838 |
| 330 | Ga0496101_0175316 | 3300048904 | Bacteria | 1649 |
| 331 | Ga0496102_0009659 | 3300048905 | Bacteria | 8299 |
| 332 | Ga0496103_0004829 | 3300048906 | Bacteria | 8142 |
| 333 | Ga0496105_0035311 | 3300048908 | Bacteria | 4114 |
| 334 | Ga0496106_0002146 | 3300048909 | Bacteria | 14733 |
| 335 | Ga0496109_0214013 | 3300048912 | Bacteria | 1812 |
| 336 | Ga0496110_0095742 | 3300048913 | Bacteria | 2659 |
| 337 | Ga0496111_0199785 | 3300048914 | Bacteria | 1486 |
| 338 | Ga0496112_0007297 | 3300048915 | Bacteria | 9801 |
| 339 | Ga0496112_0190965 | 3300048915 | Bacteria | 2010 |
| 340 | Ga0496113_0083614 | 3300048916 | Bacteria | 2449 |
| 341 | Ga0496113_0431116 | 3300048916 | Bacteria | 1059 |
| 342 | Ga0496114_0246721 | 3300048917 | Bacteria | 1571 |
| 343 | Ga0496115_0017858 | 3300048918 | Bacteria | 5434 |
| 344 | Ga0496115_0065002 | 3300048918 | Bacteria | 2946 |
| 345 | Ga0496117_0016845 | 3300048920 | Bacteria | 6138 |
| 346 | Ga0496117_0041667 | 3300048920 | Bacteria | 3361 |
| 347 | Ga0496117_0052520 | 3300048920 | Bacteria | 2870 |
| 348 | Ga0496118_0004894 | 3300048921 | Bacteria | 15573 |
| 349 | Ga0496118_0006640 | 3300048921 | Bacteria | 12631 |
| 350 | Ga0496119_0007476 | 3300048922 | Bacteria | 9825 |
| 351 | Ga0496119_0016957 | 3300048922 | Bacteria | 5509 |
| 352 | Ga0496119_0044548 | 3300048922 | Bacteria | 2792 |
| 353 | Ga0496119_0107850 | 3300048922 | Bacteria | 1551 |
| 354 | Ga0496120_0032802 | 3300048923 | Bacteria | 3127 |
| 355 | Ga0496120_0035608 | 3300048923 | Bacteria | 2971 |
| 356 | Ga0496120_0085406 | 3300048923 | Bacteria | 1699 |
| 357 | Ga0496121_0000146 | 3300048924 | Bacteria | 154459 |
| 358 | Ga0496121_0006205 | 3300048924 | Bacteria | 14981 |
| 359 | Ga0496121_0020045 | 3300048924 | Bacteria | 6647 |
| 360 | Ga0496121_0157879 | 3300048924 | Bacteria | 1662 |
| 361 | Ga0496122_0017690 | 3300048925 | Bacteria | 6641 |
| 362 | Ga0496122_0030899 | 3300048925 | Bacteria | 4474 |
| 363 | Ga0496122_0047820 | 3300048925 | Bacteria | 3297 |
| 364 | Ga0496122_0069355 | 3300048925 | Bacteria | 2525 |
| 365 | Ga0496124_0001236 | 3300048927 | Bacteria | 39269 |
| 366 | Ga0496124_0018901 | 3300048927 | Bacteria | 6434 |
| 367 | Ga0496124_0035661 | 3300048927 | Bacteria | 4350 |
| 368 | Ga0496124_0060724 | 3300048927 | Bacteria | 3170 |
| 369 | Ga0496125_0013383 | 3300048928 | Bacteria | 8068 |
| 370 | Ga0496125_0028332 | 3300048928 | Bacteria | 5062 |
| 371 | Ga0496125_0049449 | 3300048928 | Bacteria | 3494 |
| 372 | Ga0496126_0008637 | 3300048929 | Bacteria | 10953 |
| 373 | Ga0496126_0027701 | 3300048929 | Bacteria | 5408 |
| 374 | Ga0496126_0051454 | 3300048929 | Bacteria | 3749 |
| 375 | Ga0496126_0055680 | 3300048929 | Bacteria | 3576 |
| 376 | Ga0496126_0061033 | 3300048929 | Bacteria | 3388 |
| 377 | Ga0496126_0086626 | 3300048929 | Bacteria | 2760 |
| 378 | Ga0496126_0187426 | 3300048929 | Bacteria | 1754 |
| 379 | Ga0501032_0045469 | 3300049569 | Bacteria | 2969 |
| 380 | Ga0501034_0025675 | 3300049571 | Bacteria | 5999 |
| 381 | Ga0501038_0163731 | 3300049574 | Bacteria | 1806 |
| 382 | Ga0501039_0160657 | 3300049575 | Bacteria | 1766 |
| 383 | Ga0501039_0185769 | 3300049575 | Bacteria | 1635 |
| 384 | Ga0501043_0045550 | 3300049579 | Bacteria | 3450 |
| 385 | Ga0501046_0043115 | 3300049580 | Bacteria | 3593 |
| 386 | Ga0501046_0080917 | 3300049580 | Bacteria | 2509 |
| 387 | Ga0501047_0032527 | 3300049581 | Bacteria | 5035 |
| 388 | Ga0501047_0075852 | 3300049581 | Bacteria | 3235 |
| 389 | Ga0501067_0006020 | 3300049583 | Bacteria | 6722 |
| 390 | Ga0501068_0001433 | 3300049584 | Bacteria | 12653 |
| 391 | Ga0501069_0025014 | 3300049585 | Bacteria | 3260 |
| 392 | Ga0501069_0040418 | 3300049585 | Bacteria | 2578 |
| 393 | Ga0501070_0017083 | 3300049586 | Bacteria | 6090 |
| 394 | Ga0501070_0034524 | 3300049586 | Bacteria | 4228 |
| 395 | Ga0501071_0080791 | 3300049587 | Bacteria | 2378 |
| 396 | Ga0501073_0001736 | 3300049589 | Bacteria | 16195 |
| 397 | Ga0501073_0038051 | 3300049589 | Bacteria | 3414 |
| 398 | Ga0501074_0005978 | 3300049590 | Bacteria | 8780 |
| 399 | Ga0501074_0014830 | 3300049590 | Bacteria | 5666 |
| 400 | Ga0501076_0077423 | 3300049592 | Bacteria | 2668 |
| 401 | Ga0501076_0078447 | 3300049592 | Bacteria | 2650 |
| 402 | Ga0501079_0010640 | 3300049741 | Bacteria | 7002 |
| 403 | Ga0501079_0036089 | 3300049741 | Bacteria | 3807 |
| 404 | Ga0501080_0000921 | 3300049742 | Bacteria | 24022 |
| 405 | Ga0501080_0012855 | 3300049742 | Bacteria | 7680 |
| 406 | Ga0501080_0062784 | 3300049742 | Bacteria | 3457 |
| 407 | Ga0501083_0007148 | 3300049744 | Bacteria | 7924 |
| 408 | Ga0501044_0026430 | 3300049823 | Bacteria | 6142 |
| 409 | Ga0501044_0071296 | 3300049823 | Bacteria | 3533 |
| 410 | nmdc:mga03683_74735_c1 | 3300050489 | Bacteria | 1454 |
| 411 | nmdc:mga00v17_40819_c1 | 3300050491 | Bacteria | 2785 |
| 412 | nmdc:mga0yw44_4280_c1 | 3300050492 | Bacteria | 6511 |
| 413 | nmdc:mga05p37_8009_c1 | 3300050507 | Bacteria | 12473 |
| 414 | nmdc:mga0qj67_147969_c1 | 3300050509 | Bacteria | 1904 |
| 415 | nmdc:mga06r32_19850_c1 | 3300050510 | Bacteria | 6176 |
| 416 | nmdc:mga0n895_9573_c1 | 3300050512 | Bacteria | 8485 |
| 417 | nmdc:mga0rr50_169867_c1 | 3300050513 | Bacteria | 1776 |
| 418 | Ga0495601_0010821 | 3300053077 | Bacteria | 5442 |
| 419 | Ga0495601_0071871 | 3300053077 | Bacteria | 2210 |
| 420 | Ga0500635_0006112 | 3300053080 | Bacteria | 3201 |
| 421 | Ga0500635_0006310 | 3300053080 | Bacteria | 3161 |
| 422 | Ga0500647_0048081 | 3300053091 | Bacteria | 2051 |
| 423 | Ga0500566_0000492 | 3300053094 | Bacteria | 22010 |
| 424 | Ga0500640_002350 | 3300053095 | Bacteria | 6226 |
| 425 | Ga0500572_000497 | 3300053111 | Bacteria | 13512 |
| 426 | Ga0500572_001028 | 3300053111 | Bacteria | 8377 |
| 427 | Ga0500608_013262 | 3300053122 | Bacteria | 3648 |
| 428 | Ga0500614_002677 | 3300053123 | Bacteria | 3939 |
| 429 | Ga0500559_0000640 | 3300053136 | Bacteria | 23656 |
| 430 | Ga0500559_0001778 | 3300053136 | Bacteria | 11833 |
| 431 | Ga0500573_0026483 | 3300053140 | Bacteria | 3332 |
| 432 | Ga0500590_000321 | 3300053148 | Bacteria | 15389 |
| 433 | Ga0500590_034482 | 3300053148 | Bacteria | 2620 |
| 434 | Ga0500603_008527 | 3300053150 | Bacteria | 2277 |
| 435 | Ga0500630_001509 | 3300053159 | Bacteria | 11111 |
| 436 | Ga0500638_068961 | 3300053162 | Bacteria | 1692 |
| 437 | Ga0500638_101165 | 3300053162 | Bacteria | 1344 |
| 438 | Ga0500639_000065 | 3300053163 | Bacteria | 48250 |
| 439 | Ga0500636_0047483 | 3300053177 | Bacteria | 2528 |
| 440 | Ga0500636_0066432 | 3300053177 | Bacteria | 2097 |
| 441 | Ga0500637_0009953 | 3300053178 | Bacteria | 4861 |
| 442 | Ga0500637_0097779 | 3300053178 | Bacteria | 1701 |
| 443 | Ga0500576_004552 | 3300053725 | Bacteria | 5629 |
| 444 | Ga0500596_000776 | 3300053735 | Bacteria | 6294 |
| 445 | Ga0500596_004899 | 3300053735 | Bacteria | 2411 |
| 446 | Ga0501084_0078898 | 3300054114 | Bacteria | 2759 |
| 447 | Ga0501082_0046640 | 3300060353 | Bacteria | 3735 |
| 448 | Ga0466962_0105887 | 3300061719 | Bacteria | 1352 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005457 | Ga0070662_100180190 | Ga0070662_1001801902 | 275 |
| 2 | 3300044656 | Ga0466969_0011981 | Ga0466969_0011981_3657_4565 | 282 |
| 3 | iso_pu_bacteria | 2901300506 | 2901306212 | 286 |
| 4 | iso_pu_bacteria | 2901300506 | 2901311458 | 286 |
| 5 | 3300046794 | Ga0495589_0162703 | Ga0495589_0162703_125_1051 | 298 |
| 6 | 3300035111 | Ga0373923_0165466 | Ga0373923_0165466_13_921 | 301 |
| 7 | 3300054114 | Ga0501084_0078898 | Ga0501084_0078898_1813_2748 | 305 |
| 8 | 3300028794 | Ga0307515_10078454 | Ga0307515_100784542 | 310 |
| 9 | 3300044658 | Ga0466972_0090062 | Ga0466972_0090062_155_1132 | 310 |
| 10 | 3300048916 | Ga0496113_0431116 | Ga0496113_0431116_61_1035 | 310 |
| 11 | 3300009176 | Ga0105242_10044193 | Ga0105242_100441931 | 312 |
| 12 | 3300045976 | Ga0466967_0075379 | Ga0466967_0075379_1829_2863 | 312 |
| 13 | 3300053111 | Ga0500572_000497 | Ga0500572_000497_4175_5209 | 312 |
| 14 | 3300053136 | Ga0500559_0000640 | Ga0500559_0000640_1187_2221 | 312 |
| 15 | 3300053725 | Ga0500576_004552 | Ga0500576_004552_4342_5376 | 312 |
| 16 | 3300053735 | Ga0500596_004899 | Ga0500596_004899_268_1302 | 312 |
| 17 | 3300005347 | Ga0070668_100148861 | Ga0070668_1001488612 | 313 |
| 18 | 3300005356 | Ga0070674_100022453 | Ga0070674_1000224533 | 313 |
| 19 | iso_pu_bacteria | 2818991465 | 2819707594 | 314 |
| 20 | 3300037466 | Ga0395898_0105076 | Ga0395898_0105076_572_1531 | 316 |
| 21 | iso_pu_bacteria | 2599185155 | 2599330368 | 316 |
| 22 | 3300031824 | Ga0307413_10005055 | Ga0307413_100050556 | 317 |
| 23 | 3300031901 | Ga0307406_10024853 | Ga0307406_100248532 | 317 |
| 24 | 3300031903 | Ga0307407_10014499 | Ga0307407_100144992 | 317 |
| 25 | 3300031911 | Ga0307412_10180659 | Ga0307412_101806591 | 317 |
| 26 | 3300032002 | Ga0307416_100019262 | Ga0307416_1000192622 | 317 |
| 27 | 3300032005 | Ga0307411_10011644 | Ga0307411_100116445 | 317 |
| 28 | 3300003792 | Ga0055540_1001550 | Ga0055540_100155011 | 318 |
| 29 | 3300003792 | Ga0055540_1002250 | Ga0055540_10022507 | 318 |
| 30 | 3300005334 | Ga0068869_100182458 | Ga0068869_1001824581 | 318 |
| 31 | 3300005354 | Ga0070675_100145038 | Ga0070675_1001450382 | 318 |
| 32 | 3300005365 | Ga0070688_100066374 | Ga0070688_1000663742 | 318 |
| 33 | 3300005441 | Ga0070700_100008029 | Ga0070700_1000080292 | 318 |
| 34 | 3300005441 | Ga0070700_100313272 | Ga0070700_1003132721 | 318 |
| 35 | 3300005459 | Ga0068867_100082825 | Ga0068867_1000828252 | 318 |
| 36 | 3300005466 | Ga0070685_10189642 | Ga0070685_101896422 | 318 |
| 37 | 3300005548 | Ga0070665_100007190 | Ga0070665_1000071903 | 318 |
| 38 | 3300005617 | Ga0068859_100454491 | Ga0068859_1004544912 | 318 |
| 39 | 3300005719 | Ga0068861_100076591 | Ga0068861_1000765912 | 318 |
| 40 | 3300005841 | Ga0068863_100267383 | Ga0068863_1002673832 | 318 |
| 41 | 3300006038 | Ga0075365_10136396 | Ga0075365_101363962 | 318 |
| 42 | 3300006038 | Ga0075365_10145376 | Ga0075365_101453762 | 318 |
| 43 | 3300006881 | Ga0068865_100050901 | Ga0068865_1000509012 | 318 |
| 44 | 3300006931 | Ga0097620_100454508 | Ga0097620_1004545082 | 318 |
| 45 | 3300009011 | Ga0105251_10024668 | Ga0105251_100246682 | 318 |
| 46 | 3300009036 | Ga0105244_10001196 | Ga0105244_100011966 | 318 |
| 47 | 3300009036 | Ga0105244_10012693 | Ga0105244_100126933 | 318 |
| 48 | 3300009092 | Ga0105250_10002562 | Ga0105250_100025626 | 318 |
| 49 | 3300013306 | Ga0163162_10024175 | Ga0163162_100241751 | 318 |
| 50 | 3300013308 | Ga0157375_10002151 | Ga0157375_100021513 | 318 |
| 51 | 3300014326 | Ga0157380_10006982 | Ga0157380_100069822 | 318 |
| 52 | 3300014326 | Ga0157380_10096145 | Ga0157380_100961451 | 318 |
| 53 | 3300014326 | Ga0157380_10145054 | Ga0157380_101450542 | 318 |
| 54 | 3300021361 | Ga0213872_10000768 | Ga0213872_1000076815 | 318 |
| 55 | 3300025256 | Ga0209759_1002549 | Ga0209759_10025492 | 318 |
| 56 | 3300025303 | Ga0209051_1001417 | Ga0209051_100141712 | 318 |
| 57 | 3300025303 | Ga0209051_1005356 | Ga0209051_10053565 | 318 |
| 58 | 3300025303 | Ga0209051_1013228 | Ga0209051_10132284 | 318 |
| 59 | 3300025728 | Ga0207655_1003385 | Ga0207655_10033855 | 318 |
| 60 | 3300025728 | Ga0207655_1004837 | Ga0207655_10048373 | 318 |
| 61 | 3300025735 | Ga0207713_1002531 | Ga0207713_10025317 | 318 |
| 62 | 3300025909 | Ga0207705_10171427 | Ga0207705_101714272 | 318 |
| 63 | 3300025920 | Ga0207649_10085651 | Ga0207649_100856511 | 318 |
| 64 | 3300025925 | Ga0207650_10108645 | Ga0207650_101086452 | 318 |
| 65 | 3300025926 | Ga0207659_10133852 | Ga0207659_101338522 | 318 |
| 66 | 3300025960 | Ga0207651_10119073 | Ga0207651_101190732 | 318 |
| 67 | 3300025960 | Ga0207651_10249098 | Ga0207651_102490982 | 318 |
| 68 | 3300026075 | Ga0207708_10008896 | Ga0207708_100088965 | 318 |
| 69 | 3300026088 | Ga0207641_10134404 | Ga0207641_101344042 | 318 |
| 70 | 3300026089 | Ga0207648_10070370 | Ga0207648_100703702 | 318 |
| 71 | 3300026116 | Ga0207674_10191715 | Ga0207674_101917152 | 318 |
| 72 | 3300028379 | Ga0268266_10007178 | Ga0268266_100071782 | 318 |
| 73 | 3300031456 | Ga0307513_10003954 | Ga0307513_100039547 | 318 |
| 74 | 3300031852 | Ga0307410_10038401 | Ga0307410_100384012 | 318 |
| 75 | 3300031901 | Ga0307406_10219077 | Ga0307406_102190772 | 318 |
| 76 | 3300032004 | Ga0307414_10177345 | Ga0307414_101773452 | 318 |
| 77 | 3300042439 | Ga0439464_0005549 | Ga0439464_0005549_1433_2455 | 318 |
| 78 | 3300044658 | Ga0466972_0031172 | Ga0466972_0031172_285_1298 | 318 |
| 79 | 3300046453 | Ga0495627_000423 | Ga0495627_000423_31058_32080 | 318 |
| 80 | 3300046474 | Ga0495605_0007922 | Ga0495605_0007922_4613_5635 | 318 |
| 81 | 3300046616 | Ga0495668_0007763 | Ga0495668_0007763_2755_3777 | 318 |
| 82 | 3300046660 | Ga0495625_0013004 | Ga0495625_0013004_4049_5071 | 318 |
| 83 | 3300046810 | Ga0495660_0000877 | Ga0495660_0000877_12160_13182 | 318 |
| 84 | 3300048903 | Ga0496100_0120033 | Ga0496100_0120033_86_1093 | 318 |
| 85 | 3300048908 | Ga0496105_0035311 | Ga0496105_0035311_1483_2490 | 318 |
| 86 | 3300048912 | Ga0496109_0214013 | Ga0496109_0214013_338_1345 | 318 |
| 87 | 3300048913 | Ga0496110_0095742 | Ga0496110_0095742_1511_2518 | 318 |
| 88 | 3300048914 | Ga0496111_0199785 | Ga0496111_0199785_460_1467 | 318 |
| 89 | 3300048927 | Ga0496124_0018901 | Ga0496124_0018901_2165_3187 | 318 |
| 90 | 3300049575 | Ga0501039_0160657 | Ga0501039_0160657_215_1204 | 318 |
| 91 | 3300049584 | Ga0501068_0001433 | Ga0501068_0001433_9536_10525 | 318 |
| 92 | 3300049585 | Ga0501069_0040418 | Ga0501069_0040418_1302_2291 | 318 |
| 93 | 3300049587 | Ga0501071_0080791 | Ga0501071_0080791_1051_2040 | 318 |
| 94 | 3300049589 | Ga0501073_0001736 | Ga0501073_0001736_13111_14100 | 318 |
| 95 | 3300049590 | Ga0501074_0005978 | Ga0501074_0005978_2161_3150 | 318 |
| 96 | 3300049592 | Ga0501076_0078447 | Ga0501076_0078447_227_1216 | 318 |
| 97 | 3300049741 | Ga0501079_0010640 | Ga0501079_0010640_5799_6788 | 318 |
| 98 | 3300049742 | Ga0501080_0000921 | Ga0501080_0000921_9923_10912 | 318 |
| 99 | 3300049744 | Ga0501083_0007148 | Ga0501083_0007148_871_1860 | 318 |
| 100 | 3300053140 | Ga0500573_0026483 | Ga0500573_0026483_1240_2262 | 318 |
| 101 | 3300009093 | Ga0105240_10063330 | Ga0105240_100633302 | 328 |
| 102 | 3300013104 | Ga0157370_10108832 | Ga0157370_101088324 | 328 |
| 103 | 3300013105 | Ga0157369_10015170 | Ga0157369_100151704 | 328 |
| 104 | 3300013307 | Ga0157372_10099862 | Ga0157372_100998624 | 328 |
| 105 | 3300025916 | Ga0207663_10006154 | Ga0207663_100061548 | 328 |
| 106 | 3300035725 | Ga0373947_0043733 | Ga0373947_0043733_412_1407 | 328 |
| 107 | 3300037418 | Ga0395900_0165254 | Ga0395900_0165254_137_1126 | 328 |
| 108 | 3300037466 | Ga0395898_0185241 | Ga0395898_0185241_464_1453 | 328 |
| 109 | 3300038443 | Ga0395901_0048997 | Ga0395901_0048997_157_1146 | 328 |
| 110 | 3300048909 | Ga0496106_0002146 | Ga0496106_0002146_9521_10516 | 328 |
| 111 | 3300048917 | Ga0496114_0246721 | Ga0496114_0246721_118_1107 | 328 |
| 112 | 3300048918 | Ga0496115_0017858 | Ga0496115_0017858_3691_4680 | 328 |
| 113 | 3300048920 | Ga0496117_0041667 | Ga0496117_0041667_542_1537 | 328 |
| 114 | 3300048921 | Ga0496118_0006640 | Ga0496118_0006640_2607_3602 | 328 |
| 115 | 3300048922 | Ga0496119_0044548 | Ga0496119_0044548_1197_2192 | 328 |
| 116 | 3300048924 | Ga0496121_0000146 | Ga0496121_0000146_3522_4517 | 328 |
| 117 | 3300048927 | Ga0496124_0001236 | Ga0496124_0001236_4299_5294 | 328 |
| 118 | 3300048928 | Ga0496125_0028332 | Ga0496125_0028332_77_1072 | 328 |
| 119 | 3300048929 | Ga0496126_0008637 | Ga0496126_0008637_2732_3727 | 328 |
| 120 | 3300053080 | Ga0500635_0006310 | Ga0500635_0006310_1374_2369 | 328 |
| 121 | 3300053162 | Ga0500638_068961 | Ga0500638_068961_245_1240 | 328 |
| 122 | 3300053177 | Ga0500636_0047483 | Ga0500636_0047483_21_1016 | 328 |
| 123 | 3300053178 | Ga0500637_0097779 | Ga0500637_0097779_521_1516 | 328 |
| 124 | 3300009094 | Ga0111539_10019802 | Ga0111539_100198026 | 329 |
| 125 | 3300039438 | Ga0436360_0757752 | Ga0436360_0757752_645_1643 | 329 |
| 126 | 3300039438 | Ga0436360_1360442 | Ga0436360_1360442_1584_2597 | 329 |
| 127 | 3300039450 | Ga0436363_0737283 | Ga0436363_0737283_643_1644 | 329 |
| 128 | 3300047469 | Ga0495673_0016628 | Ga0495673_0016628_1125_2159 | 329 |
| 129 | 3300048904 | Ga0496101_0175316 | Ga0496101_0175316_103_1113 | 329 |
| 130 | 3300048905 | Ga0496102_0009659 | Ga0496102_0009659_4928_5920 | 329 |
| 131 | 3300048906 | Ga0496103_0004829 | Ga0496103_0004829_4789_5781 | 329 |
| 132 | 3300048916 | Ga0496113_0083614 | Ga0496113_0083614_1334_2326 | 329 |
| 133 | 3300048920 | Ga0496117_0016845 | Ga0496117_0016845_2957_3949 | 329 |
| 134 | 3300048921 | Ga0496118_0004894 | Ga0496118_0004894_5004_5996 | 329 |
| 135 | 3300048922 | Ga0496119_0107850 | Ga0496119_0107850_162_1154 | 329 |
| 136 | 3300048923 | Ga0496120_0035608 | Ga0496120_0035608_1813_2805 | 329 |
| 137 | 3300048924 | Ga0496121_0006205 | Ga0496121_0006205_11502_12494 | 329 |
| 138 | 3300048925 | Ga0496122_0030899 | Ga0496122_0030899_1062_2054 | 329 |
| 139 | 3300048927 | Ga0496124_0060724 | Ga0496124_0060724_1055_2047 | 329 |
| 140 | 3300048928 | Ga0496125_0013383 | Ga0496125_0013383_2210_3202 | 329 |
| 141 | 3300048929 | Ga0496126_0055680 | Ga0496126_0055680_1506_2498 | 329 |
| 142 | 3300050507 | nmdc:mga05p37_8009_c1 | nmdc:mga05p37_8009_c1_4127_5143 | 329 |
| 143 | 3300050509 | nmdc:mga0qj67_147969_c1 | nmdc:mga0qj67_147969_c1_720_1736 | 329 |
| 144 | 3300050510 | nmdc:mga06r32_19850_c1 | nmdc:mga06r32_19850_c1_4038_5054 | 329 |
| 145 | iso_pu_bacteria | 643348564 | 643592645 | 332 |
| 146 | iso_pu_bacteria | 643348564 | 643599200 | 332 |
| 147 | iso_pu_bacteria | 2524023209 | 2524461031 | 333 |
| 148 | iso_pu_bacteria | 2524023210 | 2524470778 | 333 |
| 149 | iso_pu_bacteria | 2582581308 | 2585282913 | 333 |
| 150 | iso_pu_bacteria | 2582581315 | 2585322374 | 333 |
| 151 | iso_pu_bacteria | 2582581316 | 2585335065 | 333 |
| 152 | iso_pu_bacteria | 2585427527 | 2585532320 | 333 |
| 153 | iso_pu_bacteria | 2585427530 | 2585557565 | 333 |
| 154 | iso_pu_bacteria | 2615840626 | 2616307525 | 333 |
| 155 | iso_pu_bacteria | 2615840698 | 2616555072 | 333 |
| 156 | iso_pu_bacteria | 2617270742 | 2617384301 | 333 |
| 157 | iso_pu_bacteria | 2643221733 | 2644730704 | 333 |
| 158 | iso_pu_bacteria | 2667528174 | 2671112307 | 333 |
| 159 | iso_pu_bacteria | 2775507266 | 2778176135 | 333 |
| 160 | iso_pu_bacteria | 2818991448 | 2819613536 | 333 |
| 161 | iso_pu_bacteria | 2818991453 | 2819644047 | 333 |
| 162 | iso_pu_bacteria | 2818991467 | 2819718445 | 333 |
| 163 | iso_pu_bacteria | 2838029111 | 2838034676 | 333 |
| 164 | iso_pu_bacteria | 2842298080 | 2842298834 | 333 |
| 165 | iso_pu_bacteria | 2842357229 | 2842359298 | 333 |
| 166 | iso_pu_bacteria | 2842475841 | 2842481431 | 333 |
| 167 | iso_pu_bacteria | 2842482326 | 2842483263 | 333 |
| 168 | iso_pu_bacteria | 2842502639 | 2842508323 | 333 |
| 169 | iso_pu_bacteria | 2842509118 | 2842510865 | 333 |
| 170 | iso_pu_bacteria | 2889306138 | 2889309933 | 333 |
| 171 | iso_pu_bacteria | 2902330777 | 2902330778 | 333 |
| 172 | iso_pu_bacteria | 2902405164 | 2902406482 | 333 |
| 173 | iso_pu_bacteria | 2919408235 | 2919410793 | 333 |
| 174 | iso_pu_bacteria | 2919450847 | 2919451756 | 333 |
| 175 | iso_pu_bacteria | 3005416602 | 3005418357 | 333 |
| 176 | iso_pu_bacteria | 8005314921 | 8005318751 | 333 |
| 177 | iso_pu_bacteria | 8005484373 | 8005486832 | 333 |
| 178 | iso_pu_bacteria | 8005645114 | 8005647287 | 333 |
| 179 | iso_pu_bacteria | 8005682033 | 8005682072 | 333 |
| 180 | iso_pu_bacteria | 8024486573 | 8024492590 | 333 |
| 181 | iso_pu_bacteria | 2513237104 | 2513715146 | 334 |
| 182 | iso_pu_bacteria | 8006926726 | 8006928184 | 334 |
| 183 | 3300005617 | Ga0068859_100168809 | Ga0068859_1001688092 | 335 |
| 184 | 3300005843 | Ga0068860_100000441 | Ga0068860_10000044117 | 335 |
| 185 | 3300006931 | Ga0097620_100168813 | Ga0097620_1001688132 | 335 |
| 186 | 3300028379 | Ga0268266_10027444 | Ga0268266_100274441 | 335 |
| 187 | 3300028381 | Ga0268264_10000042 | Ga0268264_1000004266 | 335 |
| 188 | 3300030521 | Ga0307511_10097007 | Ga0307511_100970072 | 335 |
| 189 | 3300031616 | Ga0307508_10173606 | Ga0307508_101736062 | 335 |
| 190 | 3300033179 | Ga0307507_10083854 | Ga0307507_100838542 | 335 |
| 191 | 3300049569 | Ga0501032_0045469 | Ga0501032_0045469_1697_2725 | 335 |
| 192 | 3300049571 | Ga0501034_0025675 | Ga0501034_0025675_4378_5406 | 335 |
| 193 | 3300049574 | Ga0501038_0163731 | Ga0501038_0163731_430_1458 | 335 |
| 194 | 3300049575 | Ga0501039_0185769 | Ga0501039_0185769_105_1133 | 335 |
| 195 | 3300049579 | Ga0501043_0045550 | Ga0501043_0045550_1980_3008 | 335 |
| 196 | 3300049580 | Ga0501046_0043115 | Ga0501046_0043115_1763_2791 | 335 |
| 197 | 3300049581 | Ga0501047_0075852 | Ga0501047_0075852_1988_3016 | 335 |
| 198 | 3300049583 | Ga0501067_0006020 | Ga0501067_0006020_3633_4661 | 335 |
| 199 | 3300049585 | Ga0501069_0025014 | Ga0501069_0025014_525_1553 | 335 |
| 200 | 3300049586 | Ga0501070_0034524 | Ga0501070_0034524_2851_3879 | 335 |
| 201 | 3300049589 | Ga0501073_0038051 | Ga0501073_0038051_211_1239 | 335 |
| 202 | 3300049590 | Ga0501074_0014830 | Ga0501074_0014830_886_1914 | 335 |
| 203 | 3300049592 | Ga0501076_0077423 | Ga0501076_0077423_1418_2446 | 335 |
| 204 | 3300049741 | Ga0501079_0036089 | Ga0501079_0036089_1971_2999 | 335 |
| 205 | 3300049742 | Ga0501080_0062784 | Ga0501080_0062784_710_1738 | 335 |
| 206 | 3300049823 | Ga0501044_0071296 | Ga0501044_0071296_880_1908 | 335 |
| 207 | 3300060353 | Ga0501082_0046640 | Ga0501082_0046640_863_1891 | 335 |
| 208 | iso_pu_bacteria | 2524023205 | 2524440960 | 335 |
| 209 | iso_pu_bacteria | 2744054633 | 2745082515 | 335 |
| 210 | iso_pu_bacteria | 2876761206 | 2876764446 | 335 |
| 211 | iso_pu_bacteria | 2883291878 | 2883295584 | 335 |
| 212 | 3300005331 | Ga0070670_100067698 | Ga0070670_1000676981 | 336 |
| 213 | 3300005340 | Ga0070689_100238912 | Ga0070689_1002389121 | 336 |
| 214 | 3300005355 | Ga0070671_100001622 | Ga0070671_10000162220 | 336 |
| 215 | 3300005434 | Ga0070709_10114485 | Ga0070709_101144852 | 336 |
| 216 | 3300005436 | Ga0070713_100104925 | Ga0070713_1001049252 | 336 |
| 217 | 3300005439 | Ga0070711_100002094 | Ga0070711_1000020945 | 336 |
| 218 | 3300005548 | Ga0070665_100043721 | Ga0070665_1000437214 | 336 |
| 219 | 3300006028 | Ga0070717_10095167 | Ga0070717_100951672 | 336 |
| 220 | 3300006175 | Ga0070712_100034203 | Ga0070712_1000342031 | 336 |
| 221 | 3300009098 | Ga0105245_10028125 | Ga0105245_100281254 | 336 |
| 222 | 3300009176 | Ga0105242_10338971 | Ga0105242_103389712 | 336 |
| 223 | 3300009177 | Ga0105248_10218262 | Ga0105248_102182622 | 336 |
| 224 | 3300010375 | Ga0105239_10310214 | Ga0105239_103102141 | 336 |
| 225 | 3300011119 | Ga0105246_10133121 | Ga0105246_101331212 | 336 |
| 226 | 3300013105 | Ga0157369_10024108 | Ga0157369_100241084 | 336 |
| 227 | 3300021384 | Ga0213876_10022915 | Ga0213876_100229152 | 336 |
| 228 | 3300024227 | Ga0228598_1001174 | Ga0228598_10011745 | 336 |
| 229 | 3300025906 | Ga0207699_10103786 | Ga0207699_101037862 | 336 |
| 230 | 3300025906 | Ga0207699_10148168 | Ga0207699_101481681 | 336 |
| 231 | 3300025913 | Ga0207695_10176771 | Ga0207695_101767712 | 336 |
| 232 | 3300025915 | Ga0207693_10048585 | Ga0207693_100485854 | 336 |
| 233 | 3300025915 | Ga0207693_10052746 | Ga0207693_100527463 | 336 |
| 234 | 3300025923 | Ga0207681_10290684 | Ga0207681_102906841 | 336 |
| 235 | 3300025924 | Ga0207694_10075214 | Ga0207694_100752141 | 336 |
| 236 | 3300025924 | Ga0207694_10348417 | Ga0207694_103484171 | 336 |
| 237 | 3300025929 | Ga0207664_10197589 | Ga0207664_101975892 | 336 |
| 238 | 3300025931 | Ga0207644_10006361 | Ga0207644_100063617 | 336 |
| 239 | 3300025936 | Ga0207670_10035160 | Ga0207670_100351602 | 336 |
| 240 | 3300025945 | Ga0207679_10081020 | Ga0207679_100810202 | 336 |
| 241 | 3300025949 | Ga0207667_10277669 | Ga0207667_102776693 | 336 |
| 242 | 3300025960 | Ga0207651_10059304 | Ga0207651_100593044 | 336 |
| 243 | 3300026078 | Ga0207702_10111127 | Ga0207702_101111273 | 336 |
| 244 | 3300035117 | Ga0373953_0052044 | Ga0373953_0052044_451_1470 | 336 |
| 245 | 3300035692 | Ga0373935_0203343 | Ga0373935_0203343_188_1207 | 336 |
| 246 | 3300036401 | Ga0373937_0022374 | Ga0373937_0022374_3820_4839 | 336 |
| 247 | 3300037466 | Ga0395898_0378642 | Ga0395898_0378642_313_1332 | 336 |
| 248 | 3300037853 | Ga0436364_0162304 | Ga0436364_0162304_16096_17130 | 336 |
| 249 | 3300037853 | Ga0436364_1353674 | Ga0436364_1353674_113_1147 | 336 |
| 250 | 3300039437 | Ga0436365_0017671 | Ga0436365_0017671_1125_2159 | 336 |
| 251 | 3300039437 | Ga0436365_0879402 | Ga0436365_0879402_1891_2907 | 336 |
| 252 | 3300046516 | Ga0495628_0024176 | Ga0495628_0024176_2945_3964 | 336 |
| 253 | 3300046559 | Ga0495667_0051566 | Ga0495667_0051566_55_1074 | 336 |
| 254 | 3300046663 | Ga0495635_0039786 | Ga0495635_0039786_280_1299 | 336 |
| 255 | 3300046678 | Ga0495599_0102050 | Ga0495599_0102050_412_1431 | 336 |
| 256 | 3300046679 | Ga0495623_0014468 | Ga0495623_0014468_3837_4856 | 336 |
| 257 | 3300047319 | Ga0495674_0136332 | Ga0495674_0136332_1012_2031 | 336 |
| 258 | 3300047471 | Ga0495684_0040306 | Ga0495684_0040306_721_1740 | 336 |
| 259 | 3300047472 | Ga0495686_0004028 | Ga0495686_0004028_5326_6336 | 336 |
| 260 | 3300048088 | Ga0495602_0067942 | Ga0495602_0067942_1506_2525 | 336 |
| 261 | 3300048915 | Ga0496112_0007297 | Ga0496112_0007297_1952_2965 | 336 |
| 262 | 3300048915 | Ga0496112_0190965 | Ga0496112_0190965_271_1284 | 336 |
| 263 | 3300048925 | Ga0496122_0069355 | Ga0496122_0069355_429_1445 | 336 |
| 264 | 3300048929 | Ga0496126_0086626 | Ga0496126_0086626_1510_2526 | 336 |
| 265 | 3300053077 | Ga0495601_0010821 | Ga0495601_0010821_350_1369 | 336 |
| 266 | iso_pu_bacteria | 8055431914 | 8055432631 | 336 |
| 267 | 3300001979 | JGI24740J21852_10019283 | JGI24740J21852_100192832 | 337 |
| 268 | 3300002704 | JGI25155J39150_1000012 | JGI25155J39150_100001236 | 337 |
| 269 | 3300002705 | JGI25156J39149_1000049 | JGI25156J39149_100004957 | 337 |
| 270 | 3300002737 | JGI25162J39368_1000695 | JGI25162J39368_10006956 | 337 |
| 271 | 3300002737 | JGI25162J39368_1001578 | JGI25162J39368_10015789 | 337 |
| 272 | 3300002738 | JGI25154J39366_1000033 | JGI25154J39366_1000033137 | 337 |
| 273 | 3300002741 | JGI25157J39369_1000055 | JGI25157J39369_100005536 | 337 |
| 274 | 3300003214 | JGI25165J46597_1000905 | JGI25165J46597_10009054 | 337 |
| 275 | 3300003214 | JGI25165J46597_1004234 | JGI25165J46597_10042343 | 337 |
| 276 | 3300003354 | JGI25160J50197_1000006 | JGI25160J50197_1000006238 | 337 |
| 277 | 3300003374 | JGI25161J50226_1000004 | JGI25161J50226_1000004238 | 337 |
| 278 | 3300003752 | Ga0055539_1003688 | Ga0055539_10036881 | 337 |
| 279 | 3300004625 | Ga0055543_1000002 | Ga0055543_100000297 | 337 |
| 280 | 3300005262 | Ga0065165_1000217 | Ga0065165_100021724 | 337 |
| 281 | 3300005329 | Ga0070683_100007448 | Ga0070683_1000074481 | 337 |
| 282 | 3300005337 | Ga0070682_100019723 | Ga0070682_1000197231 | 337 |
| 283 | 3300005434 | Ga0070709_10010635 | Ga0070709_100106356 | 337 |
| 284 | 3300005434 | Ga0070709_10013745 | Ga0070709_100137454 | 337 |
| 285 | 3300005434 | Ga0070709_10035384 | Ga0070709_100353845 | 337 |
| 286 | 3300005435 | Ga0070714_100022122 | Ga0070714_1000221223 | 337 |
| 287 | 3300005435 | Ga0070714_100195952 | Ga0070714_1001959521 | 337 |
| 288 | 3300005435 | Ga0070714_100398197 | Ga0070714_1003981971 | 337 |
| 289 | 3300005436 | Ga0070713_100023616 | Ga0070713_1000236163 | 337 |
| 290 | 3300005437 | Ga0070710_10005571 | Ga0070710_100055715 | 337 |
| 291 | 3300005439 | Ga0070711_100009431 | Ga0070711_1000094316 | 337 |
| 292 | 3300005439 | Ga0070711_100022701 | Ga0070711_1000227012 | 337 |
| 293 | 3300005455 | Ga0070663_100016214 | Ga0070663_1000162145 | 337 |
| 294 | 3300005458 | Ga0070681_10037795 | Ga0070681_100377952 | 337 |
| 295 | 3300005458 | Ga0070681_10054570 | Ga0070681_100545702 | 337 |
| 296 | 3300005458 | Ga0070681_10055134 | Ga0070681_100551341 | 337 |
| 297 | 3300005471 | Ga0070698_100067751 | Ga0070698_1000677513 | 337 |
| 298 | 3300005530 | Ga0070679_100055225 | Ga0070679_1000552254 | 337 |
| 299 | 3300005530 | Ga0070679_100126962 | Ga0070679_1001269623 | 337 |
| 300 | 3300005535 | Ga0070684_100001944 | Ga0070684_1000019447 | 337 |
| 301 | 3300005563 | Ga0068855_100544243 | Ga0068855_1005442432 | 337 |
| 302 | 3300005577 | Ga0068857_100034266 | Ga0068857_1000342664 | 337 |
| 303 | 3300005985 | Ga0081539_10106110 | Ga0081539_101061102 | 337 |
| 304 | 3300006028 | Ga0070717_10210529 | Ga0070717_102105291 | 337 |
| 305 | 3300006038 | Ga0075365_10008336 | Ga0075365_100083363 | 337 |
| 306 | 3300006051 | Ga0075364_10011646 | Ga0075364_100116462 | 337 |
| 307 | 3300006175 | Ga0070712_100014922 | Ga0070712_1000149222 | 337 |
| 308 | 3300006175 | Ga0070712_100025960 | Ga0070712_1000259605 | 337 |
| 309 | 3300006175 | Ga0070712_100129902 | Ga0070712_1001299022 | 337 |
| 310 | 3300006177 | Ga0075362_10031783 | Ga0075362_100317832 | 337 |
| 311 | 3300006195 | Ga0075366_10208031 | Ga0075366_102080311 | 337 |
| 312 | 3300006844 | Ga0075428_100054241 | Ga0075428_1000542413 | 337 |
| 313 | 3300006846 | Ga0075430_100133130 | Ga0075430_1001331301 | 337 |
| 314 | 3300006847 | Ga0075431_100024748 | Ga0075431_1000247482 | 337 |
| 315 | 3300006871 | Ga0075434_100014581 | Ga0075434_1000145817 | 337 |
| 316 | 3300006880 | Ga0075429_100016272 | Ga0075429_1000162726 | 337 |
| 317 | 3300009093 | Ga0105240_10000019 | Ga0105240_1000001937 | 337 |
| 318 | 3300009147 | Ga0114129_10030052 | Ga0114129_100300526 | 337 |
| 319 | 3300009174 | Ga0105241_10136447 | Ga0105241_101364471 | 337 |
| 320 | 3300009545 | Ga0105237_10005613 | Ga0105237_100056134 | 337 |
| 321 | 3300009551 | Ga0105238_10052110 | Ga0105238_100521104 | 337 |
| 322 | 3300009551 | Ga0105238_10365962 | Ga0105238_103659621 | 337 |
| 323 | 3300013100 | Ga0157373_10175354 | Ga0157373_101753542 | 337 |
| 324 | 3300013104 | Ga0157370_10016613 | Ga0157370_100166133 | 337 |
| 325 | 3300013105 | Ga0157369_10006837 | Ga0157369_100068372 | 337 |
| 326 | 3300013105 | Ga0157369_10112167 | Ga0157369_101121672 | 337 |
| 327 | 3300015262 | Ga0182007_10002379 | Ga0182007_100023796 | 337 |
| 328 | 3300015265 | Ga0182005_1029636 | Ga0182005_10296362 | 337 |
| 329 | 3300021384 | Ga0213876_10001452 | Ga0213876_100014529 | 337 |
| 330 | 3300021388 | Ga0213875_10011424 | Ga0213875_100114242 | 337 |
| 331 | 3300021388 | Ga0213875_10037283 | Ga0213875_100372832 | 337 |
| 332 | 3300021441 | Ga0213871_10008482 | Ga0213871_100084822 | 337 |
| 333 | 3300021441 | Ga0213871_10032034 | Ga0213871_100320341 | 337 |
| 334 | 3300025206 | Ga0209435_100005 | Ga0209435_10000536 | 337 |
| 335 | 3300025233 | Ga0209437_100078 | Ga0209437_10007860 | 337 |
| 336 | 3300025233 | Ga0209437_100174 | Ga0209437_100174126 | 337 |
| 337 | 3300025246 | Ga0209646_1000011 | Ga0209646_100001136 | 337 |
| 338 | 3300025250 | Ga0209026_1000008 | Ga0209026_100000836 | 337 |
| 339 | 3300025253 | Ga0209677_100155 | Ga0209677_10015558 | 337 |
| 340 | 3300025253 | Ga0209677_100598 | Ga0209677_1005989 | 337 |
| 341 | 3300025256 | Ga0209759_1000004 | Ga0209759_100000436 | 337 |
| 342 | 3300025261 | Ga0209233_1000163 | Ga0209233_100016360 | 337 |
| 343 | 3300025261 | Ga0209233_1000295 | Ga0209233_100029512 | 337 |
| 344 | 3300025261 | Ga0209233_1000397 | Ga0209233_100039719 | 337 |
| 345 | 3300025261 | Ga0209233_1000654 | Ga0209233_100065417 | 337 |
| 346 | 3300025272 | Ga0209455_1000954 | Ga0209455_10009544 | 337 |
| 347 | 3300025272 | Ga0209455_1003971 | Ga0209455_10039712 | 337 |
| 348 | 3300025284 | Ga0209130_1000032 | Ga0209130_1000032229 | 337 |
| 349 | 3300025294 | Ga0209025_1003950 | Ga0209025_10039505 | 337 |
| 350 | 3300025295 | Ga0209564_1000017 | Ga0209564_1000017356 | 337 |
| 351 | 3300025302 | Ga0207426_1000077 | Ga0207426_1000077229 | 337 |
| 352 | 3300025898 | Ga0207692_10004323 | Ga0207692_100043232 | 337 |
| 353 | 3300025906 | Ga0207699_10008748 | Ga0207699_100087482 | 337 |
| 354 | 3300025906 | Ga0207699_10022463 | Ga0207699_100224634 | 337 |
| 355 | 3300025912 | Ga0207707_10037974 | Ga0207707_100379742 | 337 |
| 356 | 3300025912 | Ga0207707_10042266 | Ga0207707_100422661 | 337 |
| 357 | 3300025912 | Ga0207707_10165142 | Ga0207707_101651421 | 337 |
| 358 | 3300025913 | Ga0207695_10000049 | Ga0207695_1000004938 | 337 |
| 359 | 3300025913 | Ga0207695_10067367 | Ga0207695_100673672 | 337 |
| 360 | 3300025914 | Ga0207671_10000556 | Ga0207671_1000055614 | 337 |
| 361 | 3300025914 | Ga0207671_10061221 | Ga0207671_100612212 | 337 |
| 362 | 3300025915 | Ga0207693_10018049 | Ga0207693_100180492 | 337 |
| 363 | 3300025915 | Ga0207693_10022995 | Ga0207693_100229955 | 337 |
| 364 | 3300025915 | Ga0207693_10047684 | Ga0207693_100476843 | 337 |
| 365 | 3300025916 | Ga0207663_10018000 | Ga0207663_100180002 | 337 |
| 366 | 3300025921 | Ga0207652_10088133 | Ga0207652_100881331 | 337 |
| 367 | 3300025921 | Ga0207652_10108202 | Ga0207652_101082023 | 337 |
| 368 | 3300025924 | Ga0207694_10086265 | Ga0207694_100862652 | 337 |
| 369 | 3300025928 | Ga0207700_10028157 | Ga0207700_100281574 | 337 |
| 370 | 3300025928 | Ga0207700_10101308 | Ga0207700_101013083 | 337 |
| 371 | 3300025929 | Ga0207664_10019954 | Ga0207664_100199542 | 337 |
| 372 | 3300025939 | Ga0207665_10008791 | Ga0207665_100087913 | 337 |
| 373 | 3300025944 | Ga0207661_10001176 | Ga0207661_1000117618 | 337 |
| 374 | 3300025944 | Ga0207661_10042710 | Ga0207661_100427101 | 337 |
| 375 | 3300025949 | Ga0207667_10219314 | Ga0207667_102193142 | 337 |
| 376 | 3300026067 | Ga0207678_10016418 | Ga0207678_100164184 | 337 |
| 377 | 3300026116 | Ga0207674_10040652 | Ga0207674_100406524 | 337 |
| 378 | 3300026121 | Ga0207683_10268259 | Ga0207683_102682592 | 337 |
| 379 | 3300026142 | Ga0207698_10515897 | Ga0207698_105158971 | 337 |
| 380 | 3300027312 | Ga0209371_1002800 | Ga0209371_10028007 | 337 |
| 381 | 3300030500 | Ga0268256_1002695 | Ga0268256_10026954 | 337 |
| 382 | 3300031249 | Ga0265339_10019029 | Ga0265339_100190292 | 337 |
| 383 | 3300031711 | Ga0265314_10022701 | Ga0265314_100227012 | 337 |
| 384 | 3300031712 | Ga0265342_10009985 | Ga0265342_100099851 | 337 |
| 385 | 3300035086 | Ga0373934_0046481 | Ga0373934_0046481_668_1690 | 337 |
| 386 | 3300035111 | Ga0373923_0038706 | Ga0373923_0038706_579_1601 | 337 |
| 387 | 3300035113 | Ga0373936_0011298 | Ga0373936_0011298_1962_2984 | 337 |
| 388 | 3300035113 | Ga0373936_0011501 | Ga0373936_0011501_1018_2046 | 337 |
| 389 | 3300035119 | Ga0373956_0074454 | Ga0373956_0074454_479_1501 | 337 |
| 390 | 3300035171 | Ga0373946_0008038 | Ga0373946_0008038_2028_3050 | 337 |
| 391 | 3300035410 | Ga0373924_0023028 | Ga0373924_0023028_726_1748 | 337 |
| 392 | 3300035695 | Ga0373927_0224097 | Ga0373927_0224097_150_1172 | 337 |
| 393 | 3300036401 | Ga0373937_0040115 | Ga0373937_0040115_1565_2587 | 337 |
| 394 | 3300036401 | Ga0373937_0072791 | Ga0373937_0072791_1092_2114 | 337 |
| 395 | 3300037068 | Ga0373925_0024925 | Ga0373925_0024925_1145_2167 | 337 |
| 396 | 3300037466 | Ga0395898_0238098 | Ga0395898_0238098_480_1508 | 337 |
| 397 | 3300037853 | Ga0436364_0541108 | Ga0436364_0541108_1156_2187 | 337 |
| 398 | 3300037853 | Ga0436364_0919460 | Ga0436364_0919460_1333_2373 | 337 |
| 399 | 3300037853 | Ga0436364_1070350 | Ga0436364_1070350_144_1184 | 337 |
| 400 | 3300039437 | Ga0436365_1095754 | Ga0436365_1095754_27949_28980 | 337 |
| 401 | 3300039438 | Ga0436360_1272471 | Ga0436360_1272471_509_1546 | 337 |
| 402 | 3300039447 | Ga0436361_1007353 | Ga0436361_1007353_68_1108 | 337 |
| 403 | 3300039450 | Ga0436363_0222309 | Ga0436363_0222309_1385_2425 | 337 |
| 404 | 3300039450 | Ga0436363_0895910 | Ga0436363_0895910_956_1975 | 337 |
| 405 | 3300039450 | Ga0436363_1667015 | Ga0436363_1667015_528_1559 | 337 |
| 406 | 3300039453 | Ga0436362_0460244 | Ga0436362_0460244_499_1530 | 337 |
| 407 | 3300044684 | Ga0466966_0044278 | Ga0466966_0044278_1722_2744 | 337 |
| 408 | 3300044693 | Ga0466961_0139699 | Ga0466961_0139699_175_1197 | 337 |
| 409 | 3300044694 | Ga0466963_0047691 | Ga0466963_0047691_480_1496 | 337 |
| 410 | 3300044719 | Ga0466971_0040553 | Ga0466971_0040553_154_1176 | 337 |
| 411 | 3300044735 | Ga0466968_0014002 | Ga0466968_0014002_702_1727 | 337 |
| 412 | 3300044765 | Ga0466970_0005887 | Ga0466970_0005887_3174_4190 | 337 |
| 413 | 3300044842 | Ga0466957_0093176 | Ga0466957_0093176_271_1305 | 337 |
| 414 | 3300045049 | Ga0466959_0088321 | Ga0466959_0088321_690_1730 | 337 |
| 415 | 3300045049 | Ga0466959_0115993 | Ga0466959_0115993_368_1438 | 337 |
| 416 | 3300045049 | Ga0466959_0128908 | Ga0466959_0128908_423_1445 | 337 |
| 417 | 3300045051 | Ga0451576_0019109 | Ga0451576_0019109_2603_3634 | 337 |
| 418 | 3300046454 | Ga0495592_0053457 | Ga0495592_0053457_645_1667 | 337 |
| 419 | 3300046459 | Ga0495629_0105228 | Ga0495629_0105228_313_1335 | 337 |
| 420 | 3300046462 | Ga0495651_0111992 | Ga0495651_0111992_281_1300 | 337 |
| 421 | 3300046462 | Ga0495651_0296345 | Ga0495651_0296345_54_1076 | 337 |
| 422 | 3300046472 | Ga0495580_0004348 | Ga0495580_0004348_5454_6476 | 337 |
| 423 | 3300046475 | Ga0495639_0009703 | Ga0495639_0009703_1369_2391 | 337 |
| 424 | 3300046475 | Ga0495639_0119834 | Ga0495639_0119834_74_1090 | 337 |
| 425 | 3300046476 | Ga0495662_0013829 | Ga0495662_0013829_1293_2312 | 337 |
| 426 | 3300046477 | Ga0495664_0006091 | Ga0495664_0006091_5456_6478 | 337 |
| 427 | 3300046499 | Ga0495594_0016990 | Ga0495594_0016990_1445_2467 | 337 |
| 428 | 3300046507 | Ga0495606_0097780 | Ga0495606_0097780_219_1235 | 337 |
| 429 | 3300046517 | Ga0495630_0046966 | Ga0495630_0046966_852_1874 | 337 |
| 430 | 3300046529 | Ga0495652_0194426 | Ga0495652_0194426_58_1080 | 337 |
| 431 | 3300046529 | Ga0495652_0225534 | Ga0495652_0225534_361_1377 | 337 |
| 432 | 3300046531 | Ga0495665_0102049 | Ga0495665_0102049_416_1438 | 337 |
| 433 | 3300046536 | Ga0495587_0059255 | Ga0495587_0059255_101_1120 | 337 |
| 434 | 3300046543 | Ga0495645_0035897 | Ga0495645_0035897_591_1613 | 337 |
| 435 | 3300046642 | Ga0495634_0008098 | Ga0495634_0008098_1860_2882 | 337 |
| 436 | 3300046660 | Ga0495625_0056106 | Ga0495625_0056106_1439_2455 | 337 |
| 437 | 3300046663 | Ga0495635_0075072 | Ga0495635_0075072_443_1465 | 337 |
| 438 | 3300046675 | Ga0495657_0048384 | Ga0495657_0048384_366_1382 | 337 |
| 439 | 3300046679 | Ga0495623_0083488 | Ga0495623_0083488_852_1874 | 337 |
| 440 | 3300046680 | Ga0495646_0013256 | Ga0495646_0013256_1097_2119 | 337 |
| 441 | 3300046681 | Ga0495647_0004757 | Ga0495647_0004757_2460_3482 | 337 |
| 442 | 3300046683 | Ga0495658_0028738 | Ga0495658_0028738_1335_2354 | 337 |
| 443 | 3300046690 | Ga0495624_0005173 | Ga0495624_0005173_7148_8170 | 337 |
| 444 | 3300047317 | Ga0495604_0022267 | Ga0495604_0022267_3293_4312 | 337 |
| 445 | 3300047317 | Ga0495604_0097283 | Ga0495604_0097283_46_1068 | 337 |
| 446 | 3300047321 | Ga0495676_0047432 | Ga0495676_0047432_1249_2271 | 337 |
| 447 | 3300047471 | Ga0495684_0004151 | Ga0495684_0004151_937_1959 | 337 |
| 448 | 3300047472 | Ga0495686_0007807 | Ga0495686_0007807_5604_6620 | 337 |
| 449 | 3300047673 | Ga0495593_0010939 | Ga0495593_0010939_570_1592 | 337 |
| 450 | 3300048088 | Ga0495602_0063231 | Ga0495602_0063231_1704_2723 | 337 |
| 451 | 3300048918 | Ga0496115_0065002 | Ga0496115_0065002_632_1654 | 337 |
| 452 | 3300048920 | Ga0496117_0052520 | Ga0496117_0052520_17_1048 | 337 |
| 453 | 3300048922 | Ga0496119_0007476 | Ga0496119_0007476_855_1886 | 337 |
| 454 | 3300048922 | Ga0496119_0016957 | Ga0496119_0016957_2481_3494 | 337 |
| 455 | 3300048923 | Ga0496120_0032802 | Ga0496120_0032802_531_1547 | 337 |
| 456 | 3300048923 | Ga0496120_0085406 | Ga0496120_0085406_332_1363 | 337 |
| 457 | 3300048924 | Ga0496121_0020045 | Ga0496121_0020045_2449_3465 | 337 |
| 458 | 3300048924 | Ga0496121_0157879 | Ga0496121_0157879_315_1346 | 337 |
| 459 | 3300048925 | Ga0496122_0017690 | Ga0496122_0017690_1993_3006 | 337 |
| 460 | 3300048925 | Ga0496122_0047820 | Ga0496122_0047820_1808_2842 | 337 |
| 461 | 3300048927 | Ga0496124_0035661 | Ga0496124_0035661_1909_2922 | 337 |
| 462 | 3300048928 | Ga0496125_0049449 | Ga0496125_0049449_2421_3452 | 337 |
| 463 | 3300048929 | Ga0496126_0027701 | Ga0496126_0027701_2016_3035 | 337 |
| 464 | 3300048929 | Ga0496126_0051454 | Ga0496126_0051454_814_1836 | 337 |
| 465 | 3300048929 | Ga0496126_0061033 | Ga0496126_0061033_979_2001 | 337 |
| 466 | 3300048929 | Ga0496126_0187426 | Ga0496126_0187426_436_1461 | 337 |
| 467 | 3300049580 | Ga0501046_0080917 | Ga0501046_0080917_548_1570 | 337 |
| 468 | 3300049581 | Ga0501047_0032527 | Ga0501047_0032527_1156_2178 | 337 |
| 469 | 3300049586 | Ga0501070_0017083 | Ga0501070_0017083_1389_2411 | 337 |
| 470 | 3300049742 | Ga0501080_0012855 | Ga0501080_0012855_4349_5371 | 337 |
| 471 | 3300049823 | Ga0501044_0026430 | Ga0501044_0026430_896_1918 | 337 |
| 472 | 3300050489 | nmdc:mga03683_74735_c1 | nmdc:mga03683_74735_c1_363_1394 | 337 |
| 473 | 3300050491 | nmdc:mga00v17_40819_c1 | nmdc:mga00v17_40819_c1_1253_2284 | 337 |
| 474 | 3300050492 | nmdc:mga0yw44_4280_c1 | nmdc:mga0yw44_4280_c1_3899_4930 | 337 |
| 475 | 3300050512 | nmdc:mga0n895_9573_c1 | nmdc:mga0n895_9573_c1_1227_2258 | 337 |
| 476 | 3300050513 | nmdc:mga0rr50_169867_c1 | nmdc:mga0rr50_169867_c1_686_1717 | 337 |
| 477 | 3300053077 | Ga0495601_0071871 | Ga0495601_0071871_231_1253 | 337 |
| 478 | 3300053080 | Ga0500635_0006112 | Ga0500635_0006112_937_1971 | 337 |
| 479 | 3300053091 | Ga0500647_0048081 | Ga0500647_0048081_229_1314 | 337 |
| 480 | 3300053094 | Ga0500566_0000492 | Ga0500566_0000492_3947_4975 | 337 |
| 481 | 3300053095 | Ga0500640_002350 | Ga0500640_002350_3946_4974 | 337 |
| 482 | 3300053111 | Ga0500572_001028 | Ga0500572_001028_3957_4985 | 337 |
| 483 | 3300053122 | Ga0500608_013262 | Ga0500608_013262_325_1353 | 337 |
| 484 | 3300053123 | Ga0500614_002677 | Ga0500614_002677_2542_3570 | 337 |
| 485 | 3300053136 | Ga0500559_0001778 | Ga0500559_0001778_30_1058 | 337 |
| 486 | 3300053148 | Ga0500590_000321 | Ga0500590_000321_8824_9840 | 337 |
| 487 | 3300053148 | Ga0500590_034482 | Ga0500590_034482_1449_2477 | 337 |
| 488 | 3300053150 | Ga0500603_008527 | Ga0500603_008527_687_1709 | 337 |
| 489 | 3300053159 | Ga0500630_001509 | Ga0500630_001509_2082_3110 | 337 |
| 490 | 3300053162 | Ga0500638_101165 | Ga0500638_101165_17_1033 | 337 |
| 491 | 3300053163 | Ga0500639_000065 | Ga0500639_000065_43757_44785 | 337 |
| 492 | 3300053177 | Ga0500636_0066432 | Ga0500636_0066432_911_1927 | 337 |
| 493 | 3300053178 | Ga0500637_0009953 | Ga0500637_0009953_1985_3019 | 337 |
| 494 | 3300053735 | Ga0500596_000776 | Ga0500596_000776_30_1058 | 337 |
| 495 | 3300061719 | Ga0466962_0105887 | Ga0466962_0105887_70_1092 | 337 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ps6-assembly1.cif.gz_A | crystal structure of e.coli pdxa | 0.8715 | 2 | 336 |
| 6xmy-assembly1.cif.gz_A | crystal structure of 4-hydroxythreonine-4-phosphate dehydrogenase from legionella pneumophila in complex with nad | 0.8652 | 1 | 336 |
| 1r8k-assembly1.cif.gz_B | pdxa protein; nad-dependent dehydrogenase/carboxylase; subunit of pyridoxine phosphate biosynthetic protein pdxj-pdxa [salmonella typhimurium] | 0.8618 | 3 | 336 |
| 1ps6-assembly1.cif.gz_A | crystal structure of e.coli pdxa | 0.8564 | 2 | 336 |
| 6xmy-assembly1.cif.gz_A | crystal structure of 4-hydroxythreonine-4-phosphate dehydrogenase from legionella pneumophila in complex with nad | 0.853 | 1 | 336 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1r8kA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8702 | 1 | 334 | 3.40.718.10 |
| 1r8kA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8573 | 1 | 334 | 3.40.718.10 |
| 2hi1B00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8188 | 2 | 333 | 3.40.718.10 |
| 2hi1B00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8141 | 2 | 333 | 3.40.718.10 |
| 4jqpB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.7822 | 1 | 334 | 3.40.718.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q3V819-F1-model_v4 | Pyridoxal phosphate biosynthetic protein variant | 0.9283 | 166 | 276 |
GO:0016491
GO:0046872 GO:0051287 |
| AF-A0A436MXH2-F1-model_v4 | deleted | 0.9275 | 9 | 188 |
|
| AF-A0A800AG34-F1-model_v4 | 4-hydroxythreonine-4-phosphate dehydrogenase PdxA | 0.9246 | 101 | 335 |
GO:0016491
GO:0046872 GO:0051287 |
| AF-A0A349VIK0-F1-model_v4 | 4-hydroxythreonine-4-phosphate dehydrogenase PdxA | 0.924 | 9 | 195 |
GO:0016491
GO:0046872 GO:0051287 |
| AF-A0A358AG47-F1-model_v4 | 4-hydroxythreonine-4-phosphate dehydrogenase PdxA | 0.9158 | 87 | 336 |
GO:0016491
GO:0046872 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar