F454648
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 494 | 315 | 486 | 213 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221603|2644030392 |
| Length | 231 |
| Sequence | CRRPPANLKSGYRVKLYSYFRSSASYRVRIALNLKGLAYETLPVHLLKNGGEQLTPEYRKLNPDGLVPVFVDELADNSVALTQSLAIIEYLDETHPQPPLLPQSPLGKAFVRSIALSIACDIHPINNLRVLRYLVRDLKVSEDDKNAWYRHWCEQGLAAIEQTLSTDKRVGRFCYGDAPTLADCCLVPQIANAQRLNSDLSKMPTVMRIHDACMALDAFVNASPAKQPDAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 2 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 3 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 4 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 5 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 6 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 7 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 115 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 118 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 210 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 211 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 212 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 253 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 254 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 255 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 256 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 257 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 258 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 272 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 274 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 284 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 286 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 287 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 288 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 289 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 290 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 291 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 299 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 300 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 301 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 302 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 304 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 305 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.76 |
| Metatranscriptomes | 1.62 |
| Isolates | 1.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.35 |
| Nodule | 0 |
| Rhizoplane | 5.67 |
| Rhizosphere | 76.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000268 | 3300002737 | Bacteria | 50187 |
| 2 | JGI25150J39212_1008313 | 3300002774 | Bacteria | 2039 |
| 3 | JGI25165J46597_1000270 | 3300003214 | Bacteria | 66952 |
| 4 | rootH1_10189855 | 3300003323 | Bacteria | 1936 |
| 5 | Ga0055538_1000105 | 3300003751 | Bacteria | 66952 |
| 6 | Ga0055539_1000153 | 3300003752 | Bacteria | 66948 |
| 7 | Ga0055533_1000155 | 3300003756 | Bacteria | 66952 |
| 8 | Ga0055525_1000208 | 3300003759 | Bacteria | 66952 |
| 9 | Ga0055529_1001100 | 3300003763 | Bacteria | 12129 |
| 10 | Ga0055541_1000102 | 3300003841 | Bacteria | 66952 |
| 11 | Ga0065704_10079012 | 3300005289 | Bacteria | 4281 |
| 12 | Ga0065712_10145043 | 3300005290 | Bacteria | 1416 |
| 13 | Ga0070658_10001694 | 3300005327 | Bacteria | 18612 |
| 14 | Ga0070658_10247842 | 3300005327 | Bacteria | 1511 |
| 15 | Ga0070670_100076600 | 3300005331 | Bacteria | 2874 |
| 16 | Ga0070670_101199274 | 3300005331 | Bacteria | 694 |
| 17 | Ga0070666_10419944 | 3300005335 | Bacteria | 963 |
| 18 | Ga0070680_100178168 | 3300005336 | Bacteria | 1790 |
| 19 | Ga0070680_100443206 | 3300005336 | Bacteria | 1109 |
| 20 | Ga0070682_100071718 | 3300005337 | Bacteria | 2218 |
| 21 | Ga0068868_100208319 | 3300005338 | Bacteria | 1633 |
| 22 | Ga0068868_100278029 | 3300005338 | Bacteria | 1416 |
| 23 | Ga0070689_100053438 | 3300005340 | Bacteria | 3126 |
| 24 | Ga0070689_100143623 | 3300005340 | Bacteria | 1921 |
| 25 | Ga0070661_100266265 | 3300005344 | Bacteria | 1326 |
| 26 | Ga0070668_100008874 | 3300005347 | Bacteria | 7465 |
| 27 | Ga0070668_100031641 | 3300005347 | Bacteria | 4026 |
| 28 | Ga0070668_100191571 | 3300005347 | Bacteria | 1675 |
| 29 | Ga0070668_100238396 | 3300005347 | Bacteria | 1506 |
| 30 | Ga0070668_100587731 | 3300005347 | Bacteria | 973 |
| 31 | Ga0070669_100008504 | 3300005353 | Bacteria | 7326 |
| 32 | Ga0070669_100213043 | 3300005353 | Bacteria | 1525 |
| 33 | Ga0070669_100829778 | 3300005353 | Bacteria | 787 |
| 34 | Ga0070675_100217554 | 3300005354 | Bacteria | 1662 |
| 35 | Ga0070675_101080061 | 3300005354 | Bacteria | 738 |
| 36 | Ga0070671_100006371 | 3300005355 | Bacteria | 9424 |
| 37 | Ga0070671_100904867 | 3300005355 | Bacteria | 771 |
| 38 | Ga0070674_100267465 | 3300005356 | Bacteria | 1350 |
| 39 | Ga0070667_100207037 | 3300005367 | Bacteria | 1742 |
| 40 | Ga0070667_101222812 | 3300005367 | Bacteria | 703 |
| 41 | Ga0070709_10123502 | 3300005434 | Bacteria | 1758 |
| 42 | Ga0070709_10316702 | 3300005434 | Bacteria | 1144 |
| 43 | Ga0070714_100022875 | 3300005435 | Bacteria | 5128 |
| 44 | Ga0070714_100130753 | 3300005435 | Bacteria | 2243 |
| 45 | Ga0070714_100244405 | 3300005435 | Bacteria | 1657 |
| 46 | Ga0070713_100028787 | 3300005436 | Bacteria | 4390 |
| 47 | Ga0070713_100318664 | 3300005436 | Bacteria | 1435 |
| 48 | Ga0070713_100361150 | 3300005436 | Bacteria | 1349 |
| 49 | Ga0070701_10006946 | 3300005438 | Bacteria | 4800 |
| 50 | Ga0070701_10488840 | 3300005438 | Bacteria | 797 |
| 51 | Ga0070711_100141232 | 3300005439 | Bacteria | 1806 |
| 52 | Ga0070708_100028943 | 3300005445 | Bacteria | 4772 |
| 53 | Ga0070663_100460565 | 3300005455 | Bacteria | 1050 |
| 54 | Ga0070681_10012832 | 3300005458 | Bacteria | 8318 |
| 55 | Ga0070681_10047196 | 3300005458 | Bacteria | 4305 |
| 56 | Ga0068867_100910651 | 3300005459 | Bacteria | 792 |
| 57 | Ga0070706_100060660 | 3300005467 | Bacteria | 3491 |
| 58 | Ga0070707_100082657 | 3300005468 | Bacteria | 3102 |
| 59 | Ga0070698_100023134 | 3300005471 | Bacteria | 6497 |
| 60 | Ga0070698_100178662 | 3300005471 | Bacteria | 2061 |
| 61 | Ga0070699_100080526 | 3300005518 | Bacteria | 2838 |
| 62 | Ga0070679_100008089 | 3300005530 | Bacteria | 9883 |
| 63 | Ga0070679_100097318 | 3300005530 | Bacteria | 2930 |
| 64 | Ga0070697_100407121 | 3300005536 | Bacteria | 1181 |
| 65 | Ga0070697_100498422 | 3300005536 | Bacteria | 1065 |
| 66 | Ga0068853_100180489 | 3300005539 | Bacteria | 1914 |
| 67 | Ga0068853_100259317 | 3300005539 | Bacteria | 1597 |
| 68 | Ga0070695_100312074 | 3300005545 | Bacteria | 1166 |
| 69 | Ga0070695_100600416 | 3300005545 | Bacteria | 864 |
| 70 | Ga0070696_100086338 | 3300005546 | Bacteria | 2228 |
| 71 | Ga0070696_100478584 | 3300005546 | Bacteria | 987 |
| 72 | Ga0070665_100000070 | 3300005548 | Bacteria | 200681 |
| 73 | Ga0070665_101298681 | 3300005548 | Bacteria | 738 |
| 74 | Ga0070704_100124972 | 3300005549 | Bacteria | 1983 |
| 75 | Ga0068855_100023989 | 3300005563 | Bacteria | 7303 |
| 76 | Ga0068855_100043509 | 3300005563 | Bacteria | 5319 |
| 77 | Ga0068855_100335585 | 3300005563 | Bacteria | 1668 |
| 78 | Ga0068855_100479896 | 3300005563 | Bacteria | 1353 |
| 79 | Ga0068855_100600859 | 3300005563 | Bacteria | 1186 |
| 80 | Ga0070664_100034119 | 3300005564 | Bacteria | 4268 |
| 81 | Ga0068857_100128437 | 3300005577 | Bacteria | 2285 |
| 82 | Ga0068854_100153628 | 3300005578 | Bacteria | 1777 |
| 83 | Ga0068854_100427728 | 3300005578 | Bacteria | 1101 |
| 84 | Ga0068856_100003325 | 3300005614 | Bacteria | 16338 |
| 85 | Ga0068856_100037745 | 3300005614 | Bacteria | 4740 |
| 86 | Ga0068856_100406864 | 3300005614 | Bacteria | 1380 |
| 87 | Ga0070702_100612163 | 3300005615 | Bacteria | 818 |
| 88 | Ga0068852_100009489 | 3300005616 | Bacteria | 7230 |
| 89 | Ga0068852_100083374 | 3300005616 | Bacteria | 2842 |
| 90 | Ga0068852_100411847 | 3300005616 | Bacteria | 1332 |
| 91 | Ga0068859_100019938 | 3300005617 | Bacteria | 6732 |
| 92 | Ga0068864_100913063 | 3300005618 | Bacteria | 868 |
| 93 | Ga0068863_100001094 | 3300005841 | Bacteria | 27056 |
| 94 | Ga0068858_100012022 | 3300005842 | Bacteria | 8160 |
| 95 | Ga0068858_100179398 | 3300005842 | Bacteria | 1999 |
| 96 | Ga0068858_100308978 | 3300005842 | Bacteria | 1509 |
| 97 | Ga0068860_100301011 | 3300005843 | Bacteria | 1571 |
| 98 | Ga0068862_100037249 | 3300005844 | Bacteria | 4122 |
| 99 | Ga0068862_100198021 | 3300005844 | Bacteria | 1810 |
| 100 | Ga0081539_10013256 | 3300005985 | Bacteria | 6228 |
| 101 | Ga0070717_10353393 | 3300006028 | Bacteria | 1314 |
| 102 | Ga0075365_10009056 | 3300006038 | Bacteria | 5694 |
| 103 | Ga0075365_10779899 | 3300006038 | Bacteria | 675 |
| 104 | Ga0075368_10000094 | 3300006042 | Bacteria | 22408 |
| 105 | Ga0075368_10002592 | 3300006042 | Bacteria | 5927 |
| 106 | Ga0075363_100004236 | 3300006048 | Bacteria | 6235 |
| 107 | Ga0075363_100016345 | 3300006048 | Bacteria | 3665 |
| 108 | Ga0075364_10080069 | 3300006051 | Bacteria | 2159 |
| 109 | Ga0075364_10081219 | 3300006051 | Bacteria | 2143 |
| 110 | Ga0070716_100061063 | 3300006173 | Bacteria | 2180 |
| 111 | Ga0070712_100003321 | 3300006175 | Bacteria | 9891 |
| 112 | Ga0075362_10000681 | 3300006177 | Bacteria | 10019 |
| 113 | Ga0075367_10005224 | 3300006178 | Bacteria | 6418 |
| 114 | Ga0075369_10001385 | 3300006186 | Bacteria | 8272 |
| 115 | Ga0075369_10002009 | 3300006186 | Bacteria | 7164 |
| 116 | Ga0075366_10034353 | 3300006195 | Bacteria | 2986 |
| 117 | Ga0097621_100020317 | 3300006237 | Bacteria | 5116 |
| 118 | Ga0097621_100024181 | 3300006237 | Bacteria | 4740 |
| 119 | Ga0097621_100327090 | 3300006237 | Bacteria | 1359 |
| 120 | Ga0097621_100733023 | 3300006237 | Bacteria | 912 |
| 121 | Ga0075370_10007345 | 3300006353 | Bacteria | 5607 |
| 122 | Ga0075370_10362900 | 3300006353 | Bacteria | 866 |
| 123 | Ga0068871_100277689 | 3300006358 | Bacteria | 1465 |
| 124 | Ga0075434_100078301 | 3300006871 | Bacteria | 3301 |
| 125 | Ga0075436_100032173 | 3300006914 | Bacteria | 3614 |
| 126 | Ga0075436_100065027 | 3300006914 | Bacteria | 2521 |
| 127 | Ga0097620_100019938 | 3300006931 | Bacteria | 6732 |
| 128 | Ga0075435_100072442 | 3300007076 | Bacteria | 2815 |
| 129 | Ga0075435_100104637 | 3300007076 | Bacteria | 2348 |
| 130 | Ga0099795_10041242 | 3300007788 | Bacteria | 1643 |
| 131 | Ga0105251_10005097 | 3300009011 | Bacteria | 8696 |
| 132 | Ga0105240_10007874 | 3300009093 | Bacteria | 15370 |
| 133 | Ga0105240_10011007 | 3300009093 | Bacteria | 12664 |
| 134 | Ga0105240_10617149 | 3300009093 | Bacteria | 1192 |
| 135 | Ga0105245_10034031 | 3300009098 | Bacteria | 4517 |
| 136 | Ga0105245_10794913 | 3300009098 | Bacteria | 984 |
| 137 | Ga0105247_10031708 | 3300009101 | Bacteria | 3209 |
| 138 | Ga0114129_10541051 | 3300009147 | Bacteria | 1516 |
| 139 | Ga0114129_11215434 | 3300009147 | Bacteria | 938 |
| 140 | Ga0105243_10268404 | 3300009148 | Bacteria | 1531 |
| 141 | Ga0105243_10301428 | 3300009148 | Bacteria | 1452 |
| 142 | Ga0105243_10989364 | 3300009148 | Bacteria | 843 |
| 143 | Ga0105241_10030970 | 3300009174 | Bacteria | 4001 |
| 144 | Ga0105241_10089214 | 3300009174 | Bacteria | 2429 |
| 145 | Ga0105242_10049730 | 3300009176 | Bacteria | 3412 |
| 146 | Ga0105242_11239346 | 3300009176 | Bacteria | 767 |
| 147 | Ga0105248_10277769 | 3300009177 | Bacteria | 1886 |
| 148 | Ga0105237_10017969 | 3300009545 | Bacteria | 7327 |
| 149 | Ga0105238_10010811 | 3300009551 | Bacteria | 9171 |
| 150 | Ga0157326_1002540 | 3300012513 | Bacteria | 1947 |
| 151 | Ga0157373_10077649 | 3300013100 | Bacteria | 2343 |
| 152 | Ga0157370_10112381 | 3300013104 | Bacteria | 2546 |
| 153 | Ga0157369_10391577 | 3300013105 | Bacteria | 1442 |
| 154 | Ga0157374_10054473 | 3300013296 | Bacteria | 3731 |
| 155 | Ga0157378_10046831 | 3300013297 | Bacteria | 3843 |
| 156 | Ga0157378_10936094 | 3300013297 | Bacteria | 898 |
| 157 | Ga0157372_10036821 | 3300013307 | Bacteria | 5395 |
| 158 | Ga0157372_10045441 | 3300013307 | Bacteria | 4872 |
| 159 | Ga0157372_10063295 | 3300013307 | Bacteria | 4147 |
| 160 | Ga0157372_10259244 | 3300013307 | Bacteria | 2019 |
| 161 | Ga0157375_10329615 | 3300013308 | Bacteria | 1691 |
| 162 | Ga0157375_11311185 | 3300013308 | Bacteria | 851 |
| 163 | Ga0163163_10902288 | 3300014325 | Bacteria | 947 |
| 164 | Ga0157380_10167222 | 3300014326 | Bacteria | 1917 |
| 165 | Ga0157380_10717138 | 3300014326 | Bacteria | 1007 |
| 166 | Ga0182008_10025832 | 3300014497 | Bacteria | 2981 |
| 167 | Ga0182008_10059363 | 3300014497 | Bacteria | 1887 |
| 168 | Ga0182008_10086857 | 3300014497 | Bacteria | 1540 |
| 169 | Ga0157379_10052935 | 3300014968 | Bacteria | 3626 |
| 170 | Ga0157376_10812690 | 3300014969 | Bacteria | 948 |
| 171 | Ga0182006_1021149 | 3300015261 | Bacteria | 2717 |
| 172 | Ga0182007_10001140 | 3300015262 | Bacteria | 14392 |
| 173 | Ga0182007_10009543 | 3300015262 | Bacteria | 3908 |
| 174 | Ga0182005_1002993 | 3300015265 | Bacteria | 5843 |
| 175 | Ga0213872_10041602 | 3300021361 | Bacteria | 2097 |
| 176 | Ga0213872_10052258 | 3300021361 | Bacteria | 1854 |
| 177 | Ga0213874_10045859 | 3300021377 | Bacteria | 1324 |
| 178 | Ga0213874_10061997 | 3300021377 | Bacteria | 1173 |
| 179 | Ga0213874_10069911 | 3300021377 | Bacteria | 1117 |
| 180 | Ga0213875_10184059 | 3300021388 | Bacteria | 981 |
| 181 | Ga0213871_10031457 | 3300021441 | Bacteria | 1386 |
| 182 | Ga0209760_106452 | 3300025207 | Bacteria | 929 |
| 183 | Ga0209784_100027 | 3300025224 | Bacteria | 363933 |
| 184 | Ga0209566_100027 | 3300025225 | Bacteria | 363933 |
| 185 | Ga0209674_100044 | 3300025226 | Bacteria | 363933 |
| 186 | Ga0209563_100048 | 3300025230 | Bacteria | 363933 |
| 187 | Ga0207427_101706 | 3300025231 | Bacteria | 7284 |
| 188 | Ga0209437_100055 | 3300025233 | Bacteria | 363933 |
| 189 | Ga0209026_1001428 | 3300025250 | Bacteria | 10589 |
| 190 | Ga0209677_100028 | 3300025253 | Bacteria | 363933 |
| 191 | Ga0209233_1000070 | 3300025261 | Bacteria | 363933 |
| 192 | Ga0209565_1013585 | 3300025263 | Bacteria | 1902 |
| 193 | Ga0209675_1031116 | 3300025291 | Bacteria | 1264 |
| 194 | Ga0209564_1000823 | 3300025295 | Bacteria | 42196 |
| 195 | Ga0207713_1003159 | 3300025735 | Bacteria | 11410 |
| 196 | Ga0207692_10118289 | 3300025898 | Bacteria | 1480 |
| 197 | Ga0207699_10035819 | 3300025906 | Bacteria | 2826 |
| 198 | Ga0207645_10105765 | 3300025907 | Bacteria | 1819 |
| 199 | Ga0207643_10125507 | 3300025908 | Bacteria | 1523 |
| 200 | Ga0207654_10096125 | 3300025911 | Bacteria | 1816 |
| 201 | Ga0207707_10013313 | 3300025912 | Bacteria | 7169 |
| 202 | Ga0207707_10068931 | 3300025912 | Bacteria | 3082 |
| 203 | Ga0207695_10038279 | 3300025913 | Bacteria | 5165 |
| 204 | Ga0207695_10249864 | 3300025913 | Bacteria | 1673 |
| 205 | Ga0207695_10406332 | 3300025913 | Bacteria | 1246 |
| 206 | Ga0207671_10151632 | 3300025914 | Bacteria | 1791 |
| 207 | Ga0207693_10012704 | 3300025915 | Bacteria | 6801 |
| 208 | Ga0207660_10045308 | 3300025917 | Bacteria | 3098 |
| 209 | Ga0207660_10140932 | 3300025917 | Bacteria | 1843 |
| 210 | Ga0207649_10241863 | 3300025920 | Bacteria | 1296 |
| 211 | Ga0207652_10009141 | 3300025921 | Bacteria | 7976 |
| 212 | Ga0207652_10138820 | 3300025921 | Bacteria | 2172 |
| 213 | Ga0207681_10002806 | 3300025923 | Bacteria | 11026 |
| 214 | Ga0207694_10105824 | 3300025924 | Bacteria | 2234 |
| 215 | Ga0207650_11025173 | 3300025925 | Bacteria | 702 |
| 216 | Ga0207659_10181367 | 3300025926 | Bacteria | 1668 |
| 217 | Ga0207687_10528340 | 3300025927 | Bacteria | 988 |
| 218 | Ga0207664_10249530 | 3300025929 | Bacteria | 1548 |
| 219 | Ga0207664_10279159 | 3300025929 | Bacteria | 1465 |
| 220 | Ga0207644_10004490 | 3300025931 | Bacteria | 9062 |
| 221 | Ga0207644_10483851 | 3300025931 | Bacteria | 1020 |
| 222 | Ga0207706_10187321 | 3300025933 | Bacteria | 1817 |
| 223 | Ga0207686_10028897 | 3300025934 | Bacteria | 3264 |
| 224 | Ga0207686_10560101 | 3300025934 | Bacteria | 895 |
| 225 | Ga0207709_10546771 | 3300025935 | Bacteria | 910 |
| 226 | Ga0207709_10672917 | 3300025935 | Bacteria | 826 |
| 227 | Ga0207670_10025761 | 3300025936 | Bacteria | 3697 |
| 228 | Ga0207670_10083821 | 3300025936 | Bacteria | 2237 |
| 229 | Ga0207670_10278151 | 3300025936 | Bacteria | 1303 |
| 230 | Ga0207669_10954808 | 3300025937 | Bacteria | 719 |
| 231 | Ga0207691_10004244 | 3300025940 | Bacteria | 13917 |
| 232 | Ga0207711_10003996 | 3300025941 | Bacteria | 12662 |
| 233 | Ga0207711_10209090 | 3300025941 | Bacteria | 1782 |
| 234 | Ga0207679_10172122 | 3300025945 | Bacteria | 1784 |
| 235 | Ga0207679_11022809 | 3300025945 | Bacteria | 757 |
| 236 | Ga0207667_10011558 | 3300025949 | Bacteria | 10253 |
| 237 | Ga0207667_10112261 | 3300025949 | Bacteria | 2811 |
| 238 | Ga0207667_10119726 | 3300025949 | Bacteria | 2713 |
| 239 | Ga0207668_10130826 | 3300025972 | Bacteria | 1916 |
| 240 | Ga0207668_10138914 | 3300025972 | Bacteria | 1865 |
| 241 | Ga0207668_10150501 | 3300025972 | Bacteria | 1801 |
| 242 | Ga0207658_10009594 | 3300025986 | Bacteria | 6567 |
| 243 | Ga0207658_11096636 | 3300025986 | Bacteria | 727 |
| 244 | Ga0207677_10411539 | 3300026023 | Bacteria | 1149 |
| 245 | Ga0207703_10008303 | 3300026035 | Bacteria | 8202 |
| 246 | Ga0207703_10018509 | 3300026035 | Bacteria | 5439 |
| 247 | Ga0207703_10309430 | 3300026035 | Bacteria | 1444 |
| 248 | Ga0207639_10164006 | 3300026041 | Bacteria | 1875 |
| 249 | Ga0207639_10798830 | 3300026041 | Bacteria | 879 |
| 250 | Ga0207708_10816131 | 3300026075 | Bacteria | 804 |
| 251 | Ga0207702_10002576 | 3300026078 | Bacteria | 17051 |
| 252 | Ga0207702_10218777 | 3300026078 | Bacteria | 1774 |
| 253 | Ga0207641_10422948 | 3300026088 | Bacteria | 1283 |
| 254 | Ga0207648_10259121 | 3300026089 | Bacteria | 1551 |
| 255 | Ga0207648_10707447 | 3300026089 | Bacteria | 934 |
| 256 | Ga0207676_10365834 | 3300026095 | Bacteria | 1338 |
| 257 | Ga0207676_10528770 | 3300026095 | Bacteria | 1124 |
| 258 | Ga0207674_10100791 | 3300026116 | Bacteria | 2869 |
| 259 | Ga0207675_100816367 | 3300026118 | Bacteria | 946 |
| 260 | Ga0207675_100956880 | 3300026118 | Bacteria | 874 |
| 261 | Ga0207683_10168519 | 3300026121 | Bacteria | 1982 |
| 262 | Ga0207698_10125963 | 3300026142 | Bacteria | 2178 |
| 263 | Ga0207698_10272849 | 3300026142 | Bacteria | 1560 |
| 264 | Ga0209813_10000202 | 3300027866 | Bacteria | 18474 |
| 265 | Ga0268266_10000202 | 3300028379 | Bacteria | 104100 |
| 266 | Ga0268265_10015138 | 3300028380 | Bacteria | 5271 |
| 267 | Ga0268265_10145283 | 3300028380 | Bacteria | 1992 |
| 268 | Ga0268264_10012701 | 3300028381 | Bacteria | 6931 |
| 269 | Ga0265328_10000118 | 3300031239 | Bacteria | 37735 |
| 270 | Ga0265328_10008424 | 3300031239 | Bacteria | 4251 |
| 271 | Ga0265328_10023944 | 3300031239 | Bacteria | 2311 |
| 272 | Ga0265331_10000005 | 3300031250 | Bacteria | 465192 |
| 273 | Ga0307408_100069009 | 3300031548 | Bacteria | 2605 |
| 274 | Ga0307413_10177026 | 3300031824 | Bacteria | 1516 |
| 275 | Ga0307410_10100515 | 3300031852 | Bacteria | 2072 |
| 276 | Ga0307406_10118280 | 3300031901 | Bacteria | 1837 |
| 277 | Ga0307406_10421100 | 3300031901 | Bacteria | 1064 |
| 278 | Ga0307412_10000182 | 3300031911 | Bacteria | 44103 |
| 279 | Ga0307412_10230733 | 3300031911 | Bacteria | 1425 |
| 280 | Ga0307409_100009836 | 3300031995 | Bacteria | 5901 |
| 281 | Ga0307409_100165703 | 3300031995 | Bacteria | 1939 |
| 282 | Ga0307409_100398917 | 3300031995 | Bacteria | 1313 |
| 283 | Ga0307416_100012620 | 3300032002 | Bacteria | 5703 |
| 284 | Ga0307416_100076222 | 3300032002 | Bacteria | 2810 |
| 285 | Ga0307416_100097022 | 3300032002 | Bacteria | 2551 |
| 286 | Ga0307416_100270039 | 3300032002 | Bacteria | 1669 |
| 287 | Ga0307414_10000100 | 3300032004 | Bacteria | 63343 |
| 288 | Ga0307414_10191622 | 3300032004 | Bacteria | 1655 |
| 289 | Ga0307414_10522967 | 3300032004 | Bacteria | 1053 |
| 290 | Ga0307414_10967496 | 3300032004 | Bacteria | 783 |
| 291 | Ga0307411_10257054 | 3300032005 | Bacteria | 1377 |
| 292 | Ga0307415_100023780 | 3300032126 | Bacteria | 3812 |
| 293 | Ga0373953_0085245 | 3300035117 | Bacteria | 1318 |
| 294 | Ga0373956_0028309 | 3300035119 | Bacteria | 2438 |
| 295 | Ga0373955_0275003 | 3300035172 | Bacteria | 1012 |
| 296 | Ga0373924_0096947 | 3300035410 | Bacteria | 1266 |
| 297 | Ga0373931_0041808 | 3300035691 | Bacteria | 2409 |
| 298 | Ga0373935_0608364 | 3300035692 | Bacteria | 800 |
| 299 | Ga0373927_0011165 | 3300035695 | Bacteria | 5982 |
| 300 | Ga0373933_0336499 | 3300035724 | Bacteria | 979 |
| 301 | Ga0373947_0213261 | 3300035725 | Bacteria | 1267 |
| 302 | Ga0373937_0221418 | 3300036401 | Bacteria | 1781 |
| 303 | Ga0373937_0275211 | 3300036401 | Bacteria | 1589 |
| 304 | Ga0373937_0445458 | 3300036401 | Bacteria | 1230 |
| 305 | Ga0373937_0580552 | 3300036401 | Bacteria | 1064 |
| 306 | Ga0395899_0038076 | 3300037312 | Bacteria | 3603 |
| 307 | Ga0395900_0039635 | 3300037418 | Bacteria | 4854 |
| 308 | Ga0395900_0176543 | 3300037418 | Bacteria | 2172 |
| 309 | Ga0395898_0259463 | 3300037466 | Bacteria | 1657 |
| 310 | Ga0395905_0012162 | 3300037471 | Bacteria | 8289 |
| 311 | Ga0436364_0030853 | 3300037853 | Bacteria | 6474 |
| 312 | Ga0395901_0004958 | 3300038443 | Bacteria | 13431 |
| 313 | Ga0395901_0203922 | 3300038443 | Bacteria | 2072 |
| 314 | Ga0436365_0040252 | 3300039437 | Bacteria | 5550 |
| 315 | Ga0436365_1538167 | 3300039437 | Bacteria | 4918 |
| 316 | Ga0436361_0390380 | 3300039447 | Bacteria | 5301 |
| 317 | Ga0436363_1259682 | 3300039450 | Bacteria | 996 |
| 318 | Ga0436363_1296752 | 3300039450 | Bacteria | 3027 |
| 319 | Ga0451853_1698836 | 3300041512 | Bacteria | 855 |
| 320 | Ga0450923_026073 | 3300042125 | Unclassified | 1169 |
| 321 | Ga0451577_0144831 | 3300042876 | Bacteria | 2136 |
| 322 | Ga0466963_0106468 | 3300044694 | Bacteria | 1923 |
| 323 | Ga0451576_0264257 | 3300045051 | Bacteria | 1799 |
| 324 | Ga0451576_0660500 | 3300045051 | Bacteria | 1099 |
| 325 | Ga0495592_0135391 | 3300046454 | Bacteria | 1719 |
| 326 | Ga0495592_0189667 | 3300046454 | Bacteria | 1394 |
| 327 | Ga0495603_0095202 | 3300046455 | Bacteria | 1740 |
| 328 | Ga0495651_0003016 | 3300046462 | Bacteria | 13002 |
| 329 | Ga0495651_0065823 | 3300046462 | Bacteria | 2767 |
| 330 | Ga0495651_0104831 | 3300046462 | Bacteria | 2098 |
| 331 | Ga0495653_0007466 | 3300046463 | Bacteria | 8940 |
| 332 | Ga0495580_0178819 | 3300046472 | Bacteria | 1465 |
| 333 | Ga0495664_0235327 | 3300046477 | Bacteria | 1108 |
| 334 | Ga0495608_0002589 | 3300046511 | Bacteria | 12994 |
| 335 | Ga0495608_0004160 | 3300046511 | Bacteria | 10374 |
| 336 | Ga0495618_0015107 | 3300046514 | Bacteria | 4710 |
| 337 | Ga0495628_0003134 | 3300046516 | Bacteria | 14837 |
| 338 | Ga0495628_0090090 | 3300046516 | Bacteria | 2374 |
| 339 | Ga0495628_0122150 | 3300046516 | Bacteria | 1997 |
| 340 | Ga0495628_0272599 | 3300046516 | Bacteria | 1258 |
| 341 | Ga0495642_0071142 | 3300046528 | Bacteria | 1455 |
| 342 | Ga0495652_0005368 | 3300046529 | Bacteria | 12081 |
| 343 | Ga0495652_0011385 | 3300046529 | Bacteria | 8044 |
| 344 | Ga0495652_0080422 | 3300046529 | Bacteria | 2691 |
| 345 | Ga0495587_0026999 | 3300046536 | Bacteria | 3497 |
| 346 | Ga0495621_0034821 | 3300046539 | Bacteria | 1741 |
| 347 | Ga0495621_0181222 | 3300046539 | Bacteria | 841 |
| 348 | Ga0495645_0002548 | 3300046543 | Bacteria | 12365 |
| 349 | Ga0495645_0006452 | 3300046543 | Bacteria | 8138 |
| 350 | Ga0495645_0059663 | 3300046543 | Bacteria | 2766 |
| 351 | Ga0495667_0096381 | 3300046559 | Bacteria | 1915 |
| 352 | Ga0495635_0026819 | 3300046663 | Bacteria | 4008 |
| 353 | Ga0495635_0166861 | 3300046663 | Bacteria | 1498 |
| 354 | Ga0495657_0015573 | 3300046675 | Bacteria | 5559 |
| 355 | Ga0495657_0034098 | 3300046675 | Bacteria | 3538 |
| 356 | Ga0495599_0002549 | 3300046678 | Bacteria | 10615 |
| 357 | Ga0495599_0039850 | 3300046678 | Bacteria | 2951 |
| 358 | Ga0495623_0001599 | 3300046679 | Bacteria | 15265 |
| 359 | Ga0495623_0050081 | 3300046679 | Bacteria | 2646 |
| 360 | Ga0495623_0054356 | 3300046679 | Bacteria | 2526 |
| 361 | Ga0495646_0002324 | 3300046680 | Bacteria | 11644 |
| 362 | Ga0495658_0032746 | 3300046683 | Bacteria | 2841 |
| 363 | Ga0495613_0412529 | 3300046689 | Bacteria | 920 |
| 364 | Ga0495600_0008340 | 3300046809 | Bacteria | 6361 |
| 365 | Ga0495600_0046686 | 3300046809 | Bacteria | 2825 |
| 366 | Ga0495604_0006395 | 3300047317 | Bacteria | 9347 |
| 367 | Ga0495602_0029613 | 3300048088 | Bacteria | 5209 |
| 368 | Ga0495602_0058135 | 3300048088 | Bacteria | 3387 |
| 369 | Ga0496101_0233543 | 3300048904 | Unclassified | 1430 |
| 370 | Ga0496102_0078484 | 3300048905 | Bacteria | 3039 |
| 371 | Ga0496103_0090983 | 3300048906 | Bacteria | 1925 |
| 372 | Ga0496103_0094585 | 3300048906 | Bacteria | 1888 |
| 373 | Ga0496104_0000132 | 3300048907 | Bacteria | 69205 |
| 374 | Ga0496104_0002291 | 3300048907 | Bacteria | 16513 |
| 375 | Ga0496104_0073285 | 3300048907 | Bacteria | 3257 |
| 376 | Ga0496104_0082220 | 3300048907 | Bacteria | 3071 |
| 377 | Ga0496104_0565115 | 3300048907 | Bacteria | 1048 |
| 378 | Ga0496105_0053521 | 3300048908 | Bacteria | 3333 |
| 379 | Ga0496105_0338356 | 3300048908 | Bacteria | 1204 |
| 380 | Ga0496108_0045274 | 3300048911 | Bacteria | 3675 |
| 381 | Ga0496108_0052653 | 3300048911 | Bacteria | 3412 |
| 382 | Ga0496109_0045366 | 3300048912 | Bacteria | 3988 |
| 383 | Ga0496110_0002182 | 3300048913 | Bacteria | 14610 |
| 384 | Ga0496110_0070108 | 3300048913 | Bacteria | 3105 |
| 385 | Ga0496110_0174813 | 3300048913 | Bacteria | 1949 |
| 386 | Ga0496110_0453017 | 3300048913 | Unclassified | 1169 |
| 387 | Ga0496111_0042358 | 3300048914 | Bacteria | 3269 |
| 388 | Ga0496111_0558604 | 3300048914 | Bacteria | 840 |
| 389 | Ga0496112_0020327 | 3300048915 | Bacteria | 6291 |
| 390 | Ga0496112_0070157 | 3300048915 | Bacteria | 3463 |
| 391 | Ga0496113_0001546 | 3300048916 | Bacteria | 12905 |
| 392 | Ga0496113_0117500 | 3300048916 | Bacteria | 2076 |
| 393 | Ga0496114_0285690 | 3300048917 | Bacteria | 1455 |
| 394 | Ga0496114_0452253 | 3300048917 | Bacteria | 1137 |
| 395 | Ga0496115_0036935 | 3300048918 | Bacteria | 3869 |
| 396 | Ga0496115_0221739 | 3300048918 | Unclassified | 1560 |
| 397 | Ga0496116_0037787 | 3300048919 | Bacteria | 3362 |
| 398 | Ga0496117_0064725 | 3300048920 | Bacteria | 2490 |
| 399 | Ga0496119_0056687 | 3300048922 | Bacteria | 2373 |
| 400 | Ga0496119_0069144 | 3300048922 | Bacteria | 2076 |
| 401 | Ga0496122_0098399 | 3300048925 | Bacteria | 1965 |
| 402 | Ga0496123_0173299 | 3300048926 | Bacteria | 1135 |
| 403 | Ga0496124_0083672 | 3300048927 | Bacteria | 2617 |
| 404 | Ga0496124_0198973 | 3300048927 | Bacteria | 1525 |
| 405 | Ga0496125_0023227 | 3300048928 | Bacteria | 5729 |
| 406 | Ga0496125_0127034 | 3300048928 | Bacteria | 1804 |
| 407 | Ga0496126_0024315 | 3300048929 | Bacteria | 5850 |
| 408 | Ga0496126_0522614 | 3300048929 | Bacteria | 945 |
| 409 | Ga0501031_0203125 | 3300049568 | Bacteria | 1293 |
| 410 | Ga0501034_0011544 | 3300049571 | Bacteria | 9150 |
| 411 | Ga0501034_0028364 | 3300049571 | Bacteria | 5696 |
| 412 | Ga0501034_0097935 | 3300049571 | Bacteria | 2929 |
| 413 | Ga0501037_0173349 | 3300049573 | Bacteria | 1533 |
| 414 | Ga0501041_0132662 | 3300049577 | Bacteria | 1552 |
| 415 | Ga0501041_0306867 | 3300049577 | Bacteria | 1000 |
| 416 | Ga0501047_0508585 | 3300049581 | Bacteria | 1031 |
| 417 | Ga0501048_0211645 | 3300049582 | Bacteria | 1375 |
| 418 | Ga0501070_0474767 | 3300049586 | Bacteria | 1006 |
| 419 | Ga0501070_0556081 | 3300049586 | Bacteria | 918 |
| 420 | Ga0501070_0586823 | 3300049586 | Bacteria | 889 |
| 421 | Ga0501072_0618864 | 3300049588 | Bacteria | 853 |
| 422 | Ga0501073_0019290 | 3300049589 | Bacteria | 4925 |
| 423 | Ga0501076_0045140 | 3300049592 | Bacteria | 3478 |
| 424 | Ga0501077_0168547 | 3300049593 | Bacteria | 1391 |
| 425 | Ga0501198_017973 | 3300049649 | Bacteria | 1103 |
| 426 | Ga0501223_000309 | 3300049663 | Bacteria | 12162 |
| 427 | Ga0501224_000027 | 3300049664 | Bacteria | 53610 |
| 428 | Ga0501233_000078 | 3300049668 | Bacteria | 12773 |
| 429 | Ga0501235_002290 | 3300049669 | Bacteria | 4118 |
| 430 | Ga0501225_0000288 | 3300049705 | Bacteria | 15765 |
| 431 | Ga0501079_0030626 | 3300049741 | Bacteria | 4135 |
| 432 | Ga0501080_0000772 | 3300049742 | Bacteria | 26012 |
| 433 | Ga0501080_0357871 | 3300049742 | Bacteria | 1317 |
| 434 | Ga0501083_0002315 | 3300049744 | Bacteria | 13013 |
| 435 | Ga0501035_0143882 | 3300049822 | Bacteria | 2072 |
| 436 | Ga0501044_0386069 | 3300049823 | Bacteria | 1315 |
| 437 | Ga0501045_0102136 | 3300049824 | Bacteria | 2123 |
| 438 | Ga0501045_0519428 | 3300049824 | Bacteria | 884 |
| 439 | Ga0501226_000116 | 3300049853 | Bacteria | 17688 |
| 440 | nmdc:mga03683_170_c1 | 3300050489 | Bacteria | 21777 |
| 441 | nmdc:mga03683_190111_c1 | 3300050489 | Bacteria | 939 |
| 442 | nmdc:mga03n38_50662_c1 | 3300050490 | Bacteria | 1852 |
| 443 | nmdc:mga00v17_19828_c1 | 3300050491 | Bacteria | 2253 |
| 444 | nmdc:mga00v17_295899_c1 | 3300050491 | Bacteria | 1051 |
| 445 | nmdc:mga00v17_612647_c1 | 3300050491 | Bacteria | 702 |
| 446 | nmdc:mga0yw44_356940_c1 | 3300050492 | Bacteria | 985 |
| 447 | nmdc:mga0yw44_429724_c1 | 3300050492 | Bacteria | 894 |
| 448 | nmdc:mga0k408_145101_c1 | 3300050493 | Bacteria | 1413 |
| 449 | nmdc:mga0k408_147623_c1 | 3300050493 | Bacteria | 1400 |
| 450 | nmdc:mga0k408_33870_c1 | 3300050493 | Bacteria | 2923 |
| 451 | nmdc:mga0k408_35248_c1 | 3300050493 | Bacteria | 2869 |
| 452 | nmdc:mga06z11_102_c1 | 3300050494 | Bacteria | 36010 |
| 453 | nmdc:mga04h51_15143_c1 | 3300050495 | Bacteria | 2218 |
| 454 | nmdc:mga07m45_7_c1 | 3300050496 | Bacteria | 223540 |
| 455 | nmdc:mga0n895_79350_c1 | 3300050512 | Bacteria | 3269 |
| 456 | nmdc:mga08x19_182296_c1 | 3300050514 | Bacteria | 1434 |
| 457 | nmdc:mga08x19_46588_c1 | 3300050514 | Bacteria | 2773 |
| 458 | nmdc:mga08x19_57998_c1 | 3300050514 | Bacteria | 2504 |
| 459 | nmdc:mga0sz30_607_c1 | 3300050516 | Bacteria | 13285 |
| 460 | Ga0495601_0015379 | 3300053077 | Bacteria | 4625 |
| 461 | Ga0495601_0017953 | 3300053077 | Bacteria | 4301 |
| 462 | Ga0495601_0275005 | 3300053077 | Bacteria | 1098 |
| 463 | Ga0495601_0317375 | 3300053077 | Bacteria | 1015 |
| 464 | Ga0495595_0148203 | 3300053084 | Bacteria | 1154 |
| 465 | Ga0495619_0269263 | 3300053085 | Bacteria | 1180 |
| 466 | Ga0495619_0298822 | 3300053085 | Bacteria | 1115 |
| 467 | Ga0500562_013413 | 3300053108 | Bacteria | 2093 |
| 468 | Ga0500562_062371 | 3300053108 | Bacteria | 1002 |
| 469 | Ga0500572_162871 | 3300053111 | Bacteria | 730 |
| 470 | Ga0500595_005084 | 3300053119 | Bacteria | 5779 |
| 471 | Ga0500607_000831 | 3300053121 | Bacteria | 29726 |
| 472 | Ga0500658_0126297 | 3300053134 | Bacteria | 1137 |
| 473 | Ga0500573_0168357 | 3300053140 | Bacteria | 1187 |
| 474 | Ga0500619_006548 | 3300053154 | Bacteria | 2690 |
| 475 | Ga0501084_0145961 | 3300054114 | Bacteria | 1993 |
| 476 | Ga0587084_006131 | 3300059477 | Bacteria | 1447 |
| 477 | Ga0587094_005308 | 3300059513 | Bacteria | 1499 |
| 478 | Ga0587115_008824 | 3300059626 | Bacteria | 1223 |
| 479 | Ga0587076_002888 | 3300059645 | Bacteria | 1983 |
| 480 | Ga0587079_018791 | 3300059647 | Bacteria | 1216 |
| 481 | Ga0587102_001164 | 3300059649 | Bacteria | 1766 |
| 482 | Ga0587071_012671 | 3300060344 | Bacteria | 1442 |
| 483 | Ga0587111_0005720 | 3300060346 | Bacteria | 1935 |
| 484 | Ga0501082_0127999 | 3300060353 | Bacteria | 2203 |
| 485 | Ga0501082_0384403 | 3300060353 | Bacteria | 1225 |
| 486 | Ga0501082_0399418 | 3300060353 | Bacteria | 1200 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048928 | Ga0496125_0127034 | Ga0496125_0127034_420_980 | 182 |
| 2 | 3300039450 | Ga0436363_1259682 | Ga0436363_1259682_424_975 | 183 |
| 3 | 3300005347 | Ga0070668_100191571 | Ga0070668_1001915713 | 185 |
| 4 | 3300005548 | Ga0070665_101298681 | Ga0070665_1012986811 | 185 |
| 5 | 3300006042 | Ga0075368_10002592 | Ga0075368_100025926 | 185 |
| 6 | 3300006048 | Ga0075363_100016345 | Ga0075363_1000163453 | 185 |
| 7 | 3300014326 | Ga0157380_10167222 | Ga0157380_101672223 | 185 |
| 8 | 3300025972 | Ga0207668_10150501 | Ga0207668_101505013 | 185 |
| 9 | 3300035692 | Ga0373935_0608364 | Ga0373935_0608364_180_779 | 189 |
| 10 | 3300025925 | Ga0207650_11025173 | Ga0207650_110251731 | 191 |
| 11 | 3300044694 | Ga0466963_0106468 | Ga0466963_0106468_73_663 | 195 |
| 12 | 3300026095 | Ga0207676_10528770 | Ga0207676_105287702 | 196 |
| 13 | 3300046514 | Ga0495618_0015107 | Ga0495618_0015107_22_615 | 197 |
| 14 | 3300049586 | Ga0501070_0556081 | Ga0501070_0556081_305_904 | 199 |
| 15 | 3300005354 | Ga0070675_101080061 | Ga0070675_1010800611 | 203 |
| 16 | 3300005438 | Ga0070701_10488840 | Ga0070701_104888401 | 203 |
| 17 | 3300025931 | Ga0207644_10483851 | Ga0207644_104838512 | 203 |
| 18 | 3300026089 | Ga0207648_10259121 | Ga0207648_102591212 | 203 |
| 19 | 3300049823 | Ga0501044_0386069 | Ga0501044_0386069_25_639 | 204 |
| 20 | 3300053134 | Ga0500658_0126297 | Ga0500658_0126297_389_1003 | 204 |
| 21 | iso_pu_bacteria | 2896184354 | 2896186979 | 205 |
| 22 | 3300026089 | Ga0207648_10707447 | Ga0207648_107074471 | 206 |
| 23 | 3300048915 | Ga0496112_0070157 | Ga0496112_0070157_1182_1811 | 208 |
| 24 | iso_pu_bacteria | 2511231221 | 2512037357 | 208 |
| 25 | iso_pu_bacteria | 2597490356 | 2599101010 | 208 |
| 26 | iso_pu_bacteria | 8054002106 | 8054005642 | 208 |
| 27 | 3300005289 | Ga0065704_10079012 | Ga0065704_100790125 | 209 |
| 28 | 3300005331 | Ga0070670_101199274 | Ga0070670_1011992741 | 209 |
| 29 | 3300005347 | Ga0070668_100008874 | Ga0070668_1000088745 | 209 |
| 30 | 3300005353 | Ga0070669_100008504 | Ga0070669_1000085043 | 209 |
| 31 | 3300005355 | Ga0070671_100006371 | Ga0070671_1000063713 | 209 |
| 32 | 3300005367 | Ga0070667_100207037 | Ga0070667_1002070371 | 209 |
| 33 | 3300005548 | Ga0070665_100000070 | Ga0070665_10000007073 | 209 |
| 34 | 3300005841 | Ga0068863_100001094 | Ga0068863_10000109410 | 209 |
| 35 | 3300005842 | Ga0068858_100308978 | Ga0068858_1003089781 | 209 |
| 36 | 3300005844 | Ga0068862_100037249 | Ga0068862_1000372494 | 209 |
| 37 | 3300005985 | Ga0081539_10013256 | Ga0081539_100132565 | 209 |
| 38 | 3300006038 | Ga0075365_10009056 | Ga0075365_100090564 | 209 |
| 39 | 3300006042 | Ga0075368_10000094 | Ga0075368_1000009421 | 209 |
| 40 | 3300006048 | Ga0075363_100004236 | Ga0075363_1000042364 | 209 |
| 41 | 3300006051 | Ga0075364_10080069 | Ga0075364_100800692 | 209 |
| 42 | 3300006177 | Ga0075362_10000681 | Ga0075362_100006813 | 209 |
| 43 | 3300006178 | Ga0075367_10005224 | Ga0075367_100052245 | 209 |
| 44 | 3300006186 | Ga0075369_10001385 | Ga0075369_100013853 | 209 |
| 45 | 3300006195 | Ga0075366_10034353 | Ga0075366_100343533 | 209 |
| 46 | 3300006353 | Ga0075370_10007345 | Ga0075370_100073453 | 209 |
| 47 | 3300009011 | Ga0105251_10005097 | Ga0105251_100050975 | 209 |
| 48 | 3300009101 | Ga0105247_10031708 | Ga0105247_100317083 | 209 |
| 49 | 3300014326 | Ga0157380_10717138 | Ga0157380_107171382 | 209 |
| 50 | 3300025735 | Ga0207713_1003159 | Ga0207713_10031594 | 209 |
| 51 | 3300025923 | Ga0207681_10002806 | Ga0207681_100028068 | 209 |
| 52 | 3300025931 | Ga0207644_10004490 | Ga0207644_100044906 | 209 |
| 53 | 3300025941 | Ga0207711_10003996 | Ga0207711_100039965 | 209 |
| 54 | 3300025972 | Ga0207668_10138914 | Ga0207668_101389141 | 209 |
| 55 | 3300025986 | Ga0207658_10009594 | Ga0207658_100095946 | 209 |
| 56 | 3300026035 | Ga0207703_10018509 | Ga0207703_100185093 | 209 |
| 57 | 3300027866 | Ga0209813_10000202 | Ga0209813_100002023 | 209 |
| 58 | 3300028379 | Ga0268266_10000202 | Ga0268266_1000020248 | 209 |
| 59 | 3300028380 | Ga0268265_10015138 | Ga0268265_100151387 | 209 |
| 60 | 3300028381 | Ga0268264_10012701 | Ga0268264_100127017 | 209 |
| 61 | 3300031548 | Ga0307408_100069009 | Ga0307408_1000690093 | 209 |
| 62 | 3300031911 | Ga0307412_10000182 | Ga0307412_1000018213 | 209 |
| 63 | 3300031911 | Ga0307412_10230733 | Ga0307412_102307332 | 209 |
| 64 | 3300032002 | Ga0307416_100097022 | Ga0307416_1000970224 | 209 |
| 65 | 3300032004 | Ga0307414_10000100 | Ga0307414_1000010014 | 209 |
| 66 | 3300032004 | Ga0307414_10967496 | Ga0307414_109674961 | 209 |
| 67 | 3300042125 | Ga0450923_026073 | Ga0450923_026073_159_794 | 209 |
| 68 | 3300048904 | Ga0496101_0233543 | Ga0496101_0233543_296_928 | 209 |
| 69 | 3300048906 | Ga0496103_0090983 | Ga0496103_0090983_441_1082 | 209 |
| 70 | 3300048907 | Ga0496104_0002291 | Ga0496104_0002291_15435_16067 | 209 |
| 71 | 3300048907 | Ga0496104_0073285 | Ga0496104_0073285_628_1260 | 209 |
| 72 | 3300048913 | Ga0496110_0453017 | Ga0496110_0453017_102_734 | 209 |
| 73 | 3300048914 | Ga0496111_0042358 | Ga0496111_0042358_390_1022 | 209 |
| 74 | 3300048915 | Ga0496112_0020327 | Ga0496112_0020327_5113_5745 | 209 |
| 75 | 3300048916 | Ga0496113_0117500 | Ga0496113_0117500_1066_1698 | 209 |
| 76 | 3300048917 | Ga0496114_0452253 | Ga0496114_0452253_478_1110 | 209 |
| 77 | 3300048918 | Ga0496115_0036935 | Ga0496115_0036935_451_1083 | 209 |
| 78 | 3300048918 | Ga0496115_0221739 | Ga0496115_0221739_564_1196 | 209 |
| 79 | 3300048919 | Ga0496116_0037787 | Ga0496116_0037787_1445_2086 | 209 |
| 80 | 3300048920 | Ga0496117_0064725 | Ga0496117_0064725_1191_1832 | 209 |
| 81 | 3300048922 | Ga0496119_0056687 | Ga0496119_0056687_1348_1989 | 209 |
| 82 | 3300048922 | Ga0496119_0069144 | Ga0496119_0069144_1028_1660 | 209 |
| 83 | 3300048925 | Ga0496122_0098399 | Ga0496122_0098399_1197_1838 | 209 |
| 84 | 3300048926 | Ga0496123_0173299 | Ga0496123_0173299_23_664 | 209 |
| 85 | 3300048927 | Ga0496124_0083672 | Ga0496124_0083672_1610_2251 | 209 |
| 86 | 3300048927 | Ga0496124_0198973 | Ga0496124_0198973_367_1008 | 209 |
| 87 | 3300048928 | Ga0496125_0023227 | Ga0496125_0023227_825_1466 | 209 |
| 88 | 3300048929 | Ga0496126_0024315 | Ga0496126_0024315_4654_5295 | 209 |
| 89 | 3300048929 | Ga0496126_0522614 | Ga0496126_0522614_67_708 | 209 |
| 90 | 3300049571 | Ga0501034_0097935 | Ga0501034_0097935_1363_2025 | 209 |
| 91 | 3300049581 | Ga0501047_0508585 | Ga0501047_0508585_32_682 | 209 |
| 92 | 3300049649 | Ga0501198_017973 | Ga0501198_017973_390_1034 | 209 |
| 93 | 3300049663 | Ga0501223_000309 | Ga0501223_000309_9532_10176 | 209 |
| 94 | 3300049664 | Ga0501224_000027 | Ga0501224_000027_9532_10176 | 209 |
| 95 | 3300049668 | Ga0501233_000078 | Ga0501233_000078_3713_4357 | 209 |
| 96 | 3300049669 | Ga0501235_002290 | Ga0501235_002290_1073_1717 | 209 |
| 97 | 3300049705 | Ga0501225_0000288 | Ga0501225_0000288_5590_6234 | 209 |
| 98 | 3300049853 | Ga0501226_000116 | Ga0501226_000116_9532_10176 | 209 |
| 99 | 3300050489 | nmdc:mga03683_170_c1 | nmdc:mga03683_170_c1_809_1456 | 209 |
| 100 | 3300050490 | nmdc:mga03n38_50662_c1 | nmdc:mga03n38_50662_c1_42_689 | 209 |
| 101 | 3300050491 | nmdc:mga00v17_19828_c1 | nmdc:mga00v17_19828_c1_14_661 | 209 |
| 102 | 3300050491 | nmdc:mga00v17_612647_c1 | nmdc:mga00v17_612647_c1_42_689 | 209 |
| 103 | 3300050492 | nmdc:mga0yw44_356940_c1 | nmdc:mga0yw44_356940_c1_15_662 | 209 |
| 104 | 3300050493 | nmdc:mga0k408_145101_c1 | nmdc:mga0k408_145101_c1_555_1202 | 209 |
| 105 | 3300050494 | nmdc:mga06z11_102_c1 | nmdc:mga06z11_102_c1_4268_4915 | 209 |
| 106 | 3300050495 | nmdc:mga04h51_15143_c1 | nmdc:mga04h51_15143_c1_795_1442 | 209 |
| 107 | 3300050496 | nmdc:mga07m45_7_c1 | nmdc:mga07m45_7_c1_144395_145042 | 209 |
| 108 | 3300050516 | nmdc:mga0sz30_607_c1 | nmdc:mga0sz30_607_c1_11430_12077 | 209 |
| 109 | 3300053108 | Ga0500562_062371 | Ga0500562_062371_77_721 | 209 |
| 110 | 3300053121 | Ga0500607_000831 | Ga0500607_000831_10040_10714 | 209 |
| 111 | 3300005438 | Ga0070701_10006946 | Ga0070701_100069464 | 210 |
| 112 | 3300005439 | Ga0070711_100141232 | Ga0070711_1001412322 | 210 |
| 113 | 3300005471 | Ga0070698_100178662 | Ga0070698_1001786623 | 210 |
| 114 | 3300005549 | Ga0070704_100124972 | Ga0070704_1001249722 | 210 |
| 115 | 3300005563 | Ga0068855_100023989 | Ga0068855_1000239893 | 210 |
| 116 | 3300005617 | Ga0068859_100019938 | Ga0068859_1000199384 | 210 |
| 117 | 3300005618 | Ga0068864_100913063 | Ga0068864_1009130631 | 210 |
| 118 | 3300005842 | Ga0068858_100179398 | Ga0068858_1001793982 | 210 |
| 119 | 3300005844 | Ga0068862_100198021 | Ga0068862_1001980212 | 210 |
| 120 | 3300006237 | Ga0097621_100733023 | Ga0097621_1007330231 | 210 |
| 121 | 3300006931 | Ga0097620_100019938 | Ga0097620_1000199389 | 210 |
| 122 | 3300009093 | Ga0105240_10617149 | Ga0105240_106171492 | 210 |
| 123 | 3300009148 | Ga0105243_10989364 | Ga0105243_109893642 | 210 |
| 124 | 3300013307 | Ga0157372_10036821 | Ga0157372_100368217 | 210 |
| 125 | 3300025913 | Ga0207695_10406332 | Ga0207695_104063322 | 210 |
| 126 | 3300025935 | Ga0207709_10546771 | Ga0207709_105467712 | 210 |
| 127 | 3300025936 | Ga0207670_10083821 | Ga0207670_100838212 | 210 |
| 128 | 3300026035 | Ga0207703_10008303 | Ga0207703_100083032 | 210 |
| 129 | 3300026118 | Ga0207675_100816367 | Ga0207675_1008163672 | 210 |
| 130 | 3300028380 | Ga0268265_10145283 | Ga0268265_101452832 | 210 |
| 131 | 3300031901 | Ga0307406_10421100 | Ga0307406_104211002 | 210 |
| 132 | 3300032002 | Ga0307416_100076222 | Ga0307416_1000762224 | 210 |
| 133 | 3300035725 | Ga0373947_0213261 | Ga0373947_0213261_563_1195 | 210 |
| 134 | 3300042876 | Ga0451577_0144831 | Ga0451577_0144831_1107_1739 | 210 |
| 135 | iso_pu_bacteria | 2848858292 | 2848864221 | 210 |
| 136 | 3300005290 | Ga0065712_10145043 | Ga0065712_101450432 | 211 |
| 137 | 3300005327 | Ga0070658_10001694 | Ga0070658_1000169410 | 211 |
| 138 | 3300005327 | Ga0070658_10247842 | Ga0070658_102478422 | 211 |
| 139 | 3300005338 | Ga0068868_100208319 | Ga0068868_1002083192 | 211 |
| 140 | 3300005338 | Ga0068868_100278029 | Ga0068868_1002780292 | 211 |
| 141 | 3300005340 | Ga0070689_100053438 | Ga0070689_1000534385 | 211 |
| 142 | 3300005354 | Ga0070675_100217554 | Ga0070675_1002175541 | 211 |
| 143 | 3300005367 | Ga0070667_101222812 | Ga0070667_1012228121 | 211 |
| 144 | 3300005435 | Ga0070714_100130753 | Ga0070714_1001307532 | 211 |
| 145 | 3300005536 | Ga0070697_100407121 | Ga0070697_1004071212 | 211 |
| 146 | 3300005539 | Ga0068853_100180489 | Ga0068853_1001804892 | 211 |
| 147 | 3300005563 | Ga0068855_100043509 | Ga0068855_1000435097 | 211 |
| 148 | 3300005578 | Ga0068854_100153628 | Ga0068854_1001536282 | 211 |
| 149 | 3300005614 | Ga0068856_100037745 | Ga0068856_1000377454 | 211 |
| 150 | 3300005615 | Ga0070702_100612163 | Ga0070702_1006121632 | 211 |
| 151 | 3300005616 | Ga0068852_100009489 | Ga0068852_1000094891 | 211 |
| 152 | 3300005616 | Ga0068852_100083374 | Ga0068852_1000833743 | 211 |
| 153 | 3300005616 | Ga0068852_100411847 | Ga0068852_1004118472 | 211 |
| 154 | 3300005842 | Ga0068858_100012022 | Ga0068858_1000120223 | 211 |
| 155 | 3300006038 | Ga0075365_10779899 | Ga0075365_107798991 | 211 |
| 156 | 3300006237 | Ga0097621_100020317 | Ga0097621_1000203175 | 211 |
| 157 | 3300006237 | Ga0097621_100024181 | Ga0097621_1000241818 | 211 |
| 158 | 3300006237 | Ga0097621_100327090 | Ga0097621_1003270902 | 211 |
| 159 | 3300006353 | Ga0075370_10362900 | Ga0075370_103629001 | 211 |
| 160 | 3300007076 | Ga0075435_100104637 | Ga0075435_1001046374 | 211 |
| 161 | 3300009093 | Ga0105240_10007874 | Ga0105240_1000787415 | 211 |
| 162 | 3300009098 | Ga0105245_10034031 | Ga0105245_100340315 | 211 |
| 163 | 3300009147 | Ga0114129_11215434 | Ga0114129_112154342 | 211 |
| 164 | 3300009148 | Ga0105243_10268404 | Ga0105243_102684043 | 211 |
| 165 | 3300009174 | Ga0105241_10030970 | Ga0105241_100309702 | 211 |
| 166 | 3300009176 | Ga0105242_10049730 | Ga0105242_100497305 | 211 |
| 167 | 3300009177 | Ga0105248_10277769 | Ga0105248_102777693 | 211 |
| 168 | 3300009551 | Ga0105238_10010811 | Ga0105238_1001081112 | 211 |
| 169 | 3300013296 | Ga0157374_10054473 | Ga0157374_100544732 | 211 |
| 170 | 3300013297 | Ga0157378_10046831 | Ga0157378_100468312 | 211 |
| 171 | 3300013307 | Ga0157372_10045441 | Ga0157372_100454413 | 211 |
| 172 | 3300013308 | Ga0157375_10329615 | Ga0157375_103296153 | 211 |
| 173 | 3300013308 | Ga0157375_11311185 | Ga0157375_113111852 | 211 |
| 174 | 3300014325 | Ga0163163_10902288 | Ga0163163_109022881 | 211 |
| 175 | 3300014968 | Ga0157379_10052935 | Ga0157379_100529352 | 211 |
| 176 | 3300014969 | Ga0157376_10812690 | Ga0157376_108126901 | 211 |
| 177 | 3300025908 | Ga0207643_10125507 | Ga0207643_101255072 | 211 |
| 178 | 3300025913 | Ga0207695_10038279 | Ga0207695_100382793 | 211 |
| 179 | 3300025924 | Ga0207694_10105824 | Ga0207694_101058241 | 211 |
| 180 | 3300025926 | Ga0207659_10181367 | Ga0207659_101813673 | 211 |
| 181 | 3300025927 | Ga0207687_10528340 | Ga0207687_105283402 | 211 |
| 182 | 3300025929 | Ga0207664_10279159 | Ga0207664_102791592 | 211 |
| 183 | 3300025934 | Ga0207686_10028897 | Ga0207686_100288974 | 211 |
| 184 | 3300025934 | Ga0207686_10560101 | Ga0207686_105601011 | 211 |
| 185 | 3300025936 | Ga0207670_10025761 | Ga0207670_100257613 | 211 |
| 186 | 3300025936 | Ga0207670_10278151 | Ga0207670_102781512 | 211 |
| 187 | 3300025937 | Ga0207669_10954808 | Ga0207669_109548081 | 211 |
| 188 | 3300025940 | Ga0207691_10004244 | Ga0207691_100042449 | 211 |
| 189 | 3300025941 | Ga0207711_10209090 | Ga0207711_102090902 | 211 |
| 190 | 3300025949 | Ga0207667_10011558 | Ga0207667_100115586 | 211 |
| 191 | 3300025986 | Ga0207658_11096636 | Ga0207658_110966361 | 211 |
| 192 | 3300026023 | Ga0207677_10411539 | Ga0207677_104115392 | 211 |
| 193 | 3300026035 | Ga0207703_10309430 | Ga0207703_103094302 | 211 |
| 194 | 3300026075 | Ga0207708_10816131 | Ga0207708_108161311 | 211 |
| 195 | 3300026095 | Ga0207676_10365834 | Ga0207676_103658342 | 211 |
| 196 | 3300026118 | Ga0207675_100956880 | Ga0207675_1009568801 | 211 |
| 197 | 3300026121 | Ga0207683_10168519 | Ga0207683_101685193 | 211 |
| 198 | 3300026142 | Ga0207698_10125963 | Ga0207698_101259633 | 211 |
| 199 | 3300026142 | Ga0207698_10272849 | Ga0207698_102728492 | 211 |
| 200 | 3300031239 | Ga0265328_10000118 | Ga0265328_1000011818 | 211 |
| 201 | 3300031239 | Ga0265328_10008424 | Ga0265328_100084242 | 211 |
| 202 | 3300031239 | Ga0265328_10023944 | Ga0265328_100239442 | 211 |
| 203 | 3300031250 | Ga0265331_10000005 | Ga0265331_10000005244 | 211 |
| 204 | 3300032002 | Ga0307416_100270039 | Ga0307416_1002700392 | 211 |
| 205 | 3300035117 | Ga0373953_0085245 | Ga0373953_0085245_246_881 | 211 |
| 206 | 3300035119 | Ga0373956_0028309 | Ga0373956_0028309_1133_1768 | 211 |
| 207 | 3300035172 | Ga0373955_0275003 | Ga0373955_0275003_316_951 | 211 |
| 208 | 3300035410 | Ga0373924_0096947 | Ga0373924_0096947_200_835 | 211 |
| 209 | 3300035724 | Ga0373933_0336499 | Ga0373933_0336499_198_833 | 211 |
| 210 | 3300036401 | Ga0373937_0221418 | Ga0373937_0221418_813_1448 | 211 |
| 211 | 3300039437 | Ga0436365_1538167 | Ga0436365_1538167_1600_2235 | 211 |
| 212 | 3300041512 | Ga0451853_1698836 | Ga0451853_1698836_184_819 | 211 |
| 213 | 3300046454 | Ga0495592_0189667 | Ga0495592_0189667_322_957 | 211 |
| 214 | 3300046462 | Ga0495651_0065823 | Ga0495651_0065823_525_1160 | 211 |
| 215 | 3300046477 | Ga0495664_0235327 | Ga0495664_0235327_36_671 | 211 |
| 216 | 3300046516 | Ga0495628_0122150 | Ga0495628_0122150_545_1180 | 211 |
| 217 | 3300046536 | Ga0495587_0026999 | Ga0495587_0026999_1410_2045 | 211 |
| 218 | 3300046543 | Ga0495645_0002548 | Ga0495645_0002548_5053_5688 | 211 |
| 219 | 3300046559 | Ga0495667_0096381 | Ga0495667_0096381_1052_1687 | 211 |
| 220 | 3300046675 | Ga0495657_0034098 | Ga0495657_0034098_2549_3184 | 211 |
| 221 | 3300046678 | Ga0495599_0039850 | Ga0495599_0039850_1357_1992 | 211 |
| 222 | 3300046679 | Ga0495623_0054356 | Ga0495623_0054356_675_1310 | 211 |
| 223 | 3300046689 | Ga0495613_0412529 | Ga0495613_0412529_233_868 | 211 |
| 224 | 3300046809 | Ga0495600_0046686 | Ga0495600_0046686_1891_2526 | 211 |
| 225 | 3300048913 | Ga0496110_0070108 | Ga0496110_0070108_1833_2468 | 211 |
| 226 | 3300049577 | Ga0501041_0306867 | Ga0501041_0306867_121_759 | 211 |
| 227 | 3300049582 | Ga0501048_0211645 | Ga0501048_0211645_95_733 | 211 |
| 228 | 3300049592 | Ga0501076_0045140 | Ga0501076_0045140_1543_2181 | 211 |
| 229 | 3300049593 | Ga0501077_0168547 | Ga0501077_0168547_129_767 | 211 |
| 230 | 3300049741 | Ga0501079_0030626 | Ga0501079_0030626_3338_3976 | 211 |
| 231 | 3300049824 | Ga0501045_0102136 | Ga0501045_0102136_523_1161 | 211 |
| 232 | 3300050491 | nmdc:mga00v17_295899_c1 | nmdc:mga00v17_295899_c1_395_1030 | 211 |
| 233 | 3300050492 | nmdc:mga0yw44_429724_c1 | nmdc:mga0yw44_429724_c1_242_877 | 211 |
| 234 | 3300050493 | nmdc:mga0k408_147623_c1 | nmdc:mga0k408_147623_c1_735_1370 | 211 |
| 235 | 3300050493 | nmdc:mga0k408_35248_c1 | nmdc:mga0k408_35248_c1_1281_1922 | 211 |
| 236 | 3300050514 | nmdc:mga08x19_57998_c1 | nmdc:mga08x19_57998_c1_76_711 | 211 |
| 237 | 3300053077 | Ga0495601_0015379 | Ga0495601_0015379_396_1031 | 211 |
| 238 | 3300053085 | Ga0495619_0298822 | Ga0495619_0298822_47_682 | 211 |
| 239 | iso_pu_bacteria | 2939631187 | 2939634008 | 211 |
| 240 | 3300003763 | Ga0055529_1001100 | Ga0055529_100110010 | 212 |
| 241 | 3300005331 | Ga0070670_100076600 | Ga0070670_1000766002 | 212 |
| 242 | 3300005335 | Ga0070666_10419944 | Ga0070666_104199441 | 212 |
| 243 | 3300005347 | Ga0070668_100238396 | Ga0070668_1002383962 | 212 |
| 244 | 3300005434 | Ga0070709_10123502 | Ga0070709_101235022 | 212 |
| 245 | 3300005435 | Ga0070714_100244405 | Ga0070714_1002444052 | 212 |
| 246 | 3300005436 | Ga0070713_100028787 | Ga0070713_1000287873 | 212 |
| 247 | 3300005436 | Ga0070713_100318664 | Ga0070713_1003186642 | 212 |
| 248 | 3300005436 | Ga0070713_100361150 | Ga0070713_1003611501 | 212 |
| 249 | 3300005539 | Ga0068853_100259317 | Ga0068853_1002593172 | 212 |
| 250 | 3300005545 | Ga0070695_100312074 | Ga0070695_1003120741 | 212 |
| 251 | 3300005546 | Ga0070696_100086338 | Ga0070696_1000863383 | 212 |
| 252 | 3300005563 | Ga0068855_100335585 | Ga0068855_1003355852 | 212 |
| 253 | 3300005578 | Ga0068854_100427728 | Ga0068854_1004277282 | 212 |
| 254 | 3300005614 | Ga0068856_100406864 | Ga0068856_1004068642 | 212 |
| 255 | 3300005843 | Ga0068860_100301011 | Ga0068860_1003010111 | 212 |
| 256 | 3300006028 | Ga0070717_10353393 | Ga0070717_103533932 | 212 |
| 257 | 3300006051 | Ga0075364_10081219 | Ga0075364_100812192 | 212 |
| 258 | 3300006186 | Ga0075369_10002009 | Ga0075369_100020099 | 212 |
| 259 | 3300006914 | Ga0075436_100065027 | Ga0075436_1000650272 | 212 |
| 260 | 3300007788 | Ga0099795_10041242 | Ga0099795_100412422 | 212 |
| 261 | 3300009093 | Ga0105240_10011007 | Ga0105240_1001100712 | 212 |
| 262 | 3300009148 | Ga0105243_10301428 | Ga0105243_103014282 | 212 |
| 263 | 3300009176 | Ga0105242_11239346 | Ga0105242_112393461 | 212 |
| 264 | 3300009545 | Ga0105237_10017969 | Ga0105237_100179693 | 212 |
| 265 | 3300014497 | Ga0182008_10025832 | Ga0182008_100258322 | 212 |
| 266 | 3300025898 | Ga0207692_10118289 | Ga0207692_101182891 | 212 |
| 267 | 3300025906 | Ga0207699_10035819 | Ga0207699_100358192 | 212 |
| 268 | 3300025907 | Ga0207645_10105765 | Ga0207645_101057652 | 212 |
| 269 | 3300025913 | Ga0207695_10249864 | Ga0207695_102498642 | 212 |
| 270 | 3300025914 | Ga0207671_10151632 | Ga0207671_101516322 | 212 |
| 271 | 3300025933 | Ga0207706_10187321 | Ga0207706_101873213 | 212 |
| 272 | 3300025935 | Ga0207709_10672917 | Ga0207709_106729171 | 212 |
| 273 | 3300025945 | Ga0207679_11022809 | Ga0207679_110228091 | 212 |
| 274 | 3300026041 | Ga0207639_10798830 | Ga0207639_107988301 | 212 |
| 275 | 3300026078 | Ga0207702_10218777 | Ga0207702_102187772 | 212 |
| 276 | 3300032004 | Ga0307414_10191622 | Ga0307414_101916222 | 212 |
| 277 | 3300035691 | Ga0373931_0041808 | Ga0373931_0041808_1746_2387 | 212 |
| 278 | 3300035695 | Ga0373927_0011165 | Ga0373927_0011165_2222_2860 | 212 |
| 279 | 3300045051 | Ga0451576_0264257 | Ga0451576_0264257_510_1148 | 212 |
| 280 | 3300045051 | Ga0451576_0660500 | Ga0451576_0660500_243_881 | 212 |
| 281 | 3300046455 | Ga0495603_0095202 | Ga0495603_0095202_948_1589 | 212 |
| 282 | 3300046472 | Ga0495580_0178819 | Ga0495580_0178819_498_1136 | 212 |
| 283 | 3300046539 | Ga0495621_0181222 | Ga0495621_0181222_174_812 | 212 |
| 284 | 3300048907 | Ga0496104_0000132 | Ga0496104_0000132_13661_14302 | 212 |
| 285 | 3300048907 | Ga0496104_0082220 | Ga0496104_0082220_1473_2114 | 212 |
| 286 | 3300048908 | Ga0496105_0053521 | Ga0496105_0053521_2647_3288 | 212 |
| 287 | 3300048908 | Ga0496105_0338356 | Ga0496105_0338356_329_970 | 212 |
| 288 | 3300048911 | Ga0496108_0045274 | Ga0496108_0045274_2954_3595 | 212 |
| 289 | 3300048912 | Ga0496109_0045366 | Ga0496109_0045366_1276_1917 | 212 |
| 290 | 3300048913 | Ga0496110_0002182 | Ga0496110_0002182_9514_10155 | 212 |
| 291 | 3300048913 | Ga0496110_0174813 | Ga0496110_0174813_1294_1935 | 212 |
| 292 | 3300048914 | Ga0496111_0558604 | Ga0496111_0558604_88_729 | 212 |
| 293 | 3300048916 | Ga0496113_0001546 | Ga0496113_0001546_1165_1806 | 212 |
| 294 | 3300050489 | nmdc:mga03683_190111_c1 | nmdc:mga03683_190111_c1_211_852 | 212 |
| 295 | 3300050493 | nmdc:mga0k408_33870_c1 | nmdc:mga0k408_33870_c1_67_705 | 212 |
| 296 | 3300050514 | nmdc:mga08x19_182296_c1 | nmdc:mga08x19_182296_c1_514_1152 | 212 |
| 297 | 3300053108 | Ga0500562_013413 | Ga0500562_013413_478_1140 | 212 |
| 298 | 3300002774 | JGI25150J39212_1008313 | JGI25150J39212_10083131 | 213 |
| 299 | 3300005336 | Ga0070680_100178168 | Ga0070680_1001781681 | 213 |
| 300 | 3300005336 | Ga0070680_100443206 | Ga0070680_1004432061 | 213 |
| 301 | 3300005340 | Ga0070689_100143623 | Ga0070689_1001436232 | 213 |
| 302 | 3300005344 | Ga0070661_100266265 | Ga0070661_1002662652 | 213 |
| 303 | 3300005347 | Ga0070668_100031641 | Ga0070668_1000316413 | 213 |
| 304 | 3300005347 | Ga0070668_100587731 | Ga0070668_1005877311 | 213 |
| 305 | 3300005353 | Ga0070669_100213043 | Ga0070669_1002130432 | 213 |
| 306 | 3300005353 | Ga0070669_100829778 | Ga0070669_1008297781 | 213 |
| 307 | 3300005355 | Ga0070671_100904867 | Ga0070671_1009048671 | 213 |
| 308 | 3300005434 | Ga0070709_10316702 | Ga0070709_103167021 | 213 |
| 309 | 3300005435 | Ga0070714_100022875 | Ga0070714_1000228757 | 213 |
| 310 | 3300005445 | Ga0070708_100028943 | Ga0070708_1000289437 | 213 |
| 311 | 3300005455 | Ga0070663_100460565 | Ga0070663_1004605652 | 213 |
| 312 | 3300005458 | Ga0070681_10012832 | Ga0070681_100128323 | 213 |
| 313 | 3300005458 | Ga0070681_10047196 | Ga0070681_100471964 | 213 |
| 314 | 3300005459 | Ga0068867_100910651 | Ga0068867_1009106511 | 213 |
| 315 | 3300005467 | Ga0070706_100060660 | Ga0070706_1000606604 | 213 |
| 316 | 3300005468 | Ga0070707_100082657 | Ga0070707_1000826571 | 213 |
| 317 | 3300005471 | Ga0070698_100023134 | Ga0070698_1000231348 | 213 |
| 318 | 3300005518 | Ga0070699_100080526 | Ga0070699_1000805264 | 213 |
| 319 | 3300005530 | Ga0070679_100008089 | Ga0070679_1000080899 | 213 |
| 320 | 3300005530 | Ga0070679_100097318 | Ga0070679_1000973183 | 213 |
| 321 | 3300005536 | Ga0070697_100498422 | Ga0070697_1004984221 | 213 |
| 322 | 3300005545 | Ga0070695_100600416 | Ga0070695_1006004161 | 213 |
| 323 | 3300005546 | Ga0070696_100478584 | Ga0070696_1004785842 | 213 |
| 324 | 3300005563 | Ga0068855_100479896 | Ga0068855_1004798961 | 213 |
| 325 | 3300005563 | Ga0068855_100600859 | Ga0068855_1006008592 | 213 |
| 326 | 3300005564 | Ga0070664_100034119 | Ga0070664_1000341194 | 213 |
| 327 | 3300005577 | Ga0068857_100128437 | Ga0068857_1001284372 | 213 |
| 328 | 3300005614 | Ga0068856_100003325 | Ga0068856_1000033253 | 213 |
| 329 | 3300006173 | Ga0070716_100061063 | Ga0070716_1000610632 | 213 |
| 330 | 3300006871 | Ga0075434_100078301 | Ga0075434_1000783013 | 213 |
| 331 | 3300006914 | Ga0075436_100032173 | Ga0075436_1000321732 | 213 |
| 332 | 3300007076 | Ga0075435_100072442 | Ga0075435_1000724422 | 213 |
| 333 | 3300009098 | Ga0105245_10794913 | Ga0105245_107949131 | 213 |
| 334 | 3300009147 | Ga0114129_10541051 | Ga0114129_105410512 | 213 |
| 335 | 3300009174 | Ga0105241_10089214 | Ga0105241_100892142 | 213 |
| 336 | 3300012513 | Ga0157326_1002540 | Ga0157326_10025402 | 213 |
| 337 | 3300013100 | Ga0157373_10077649 | Ga0157373_100776493 | 213 |
| 338 | 3300013104 | Ga0157370_10112381 | Ga0157370_101123813 | 213 |
| 339 | 3300013105 | Ga0157369_10391577 | Ga0157369_103915772 | 213 |
| 340 | 3300013297 | Ga0157378_10936094 | Ga0157378_109360942 | 213 |
| 341 | 3300013307 | Ga0157372_10063295 | Ga0157372_100632952 | 213 |
| 342 | 3300013307 | Ga0157372_10259244 | Ga0157372_102592442 | 213 |
| 343 | 3300021377 | Ga0213874_10045859 | Ga0213874_100458591 | 213 |
| 344 | 3300021377 | Ga0213874_10061997 | Ga0213874_100619971 | 213 |
| 345 | 3300021388 | Ga0213875_10184059 | Ga0213875_101840592 | 213 |
| 346 | 3300021441 | Ga0213871_10031457 | Ga0213871_100314571 | 213 |
| 347 | 3300025263 | Ga0209565_1013585 | Ga0209565_10135851 | 213 |
| 348 | 3300025291 | Ga0209675_1031116 | Ga0209675_10311162 | 213 |
| 349 | 3300025295 | Ga0209564_1000823 | Ga0209564_100082312 | 213 |
| 350 | 3300025911 | Ga0207654_10096125 | Ga0207654_100961252 | 213 |
| 351 | 3300025912 | Ga0207707_10013313 | Ga0207707_100133133 | 213 |
| 352 | 3300025912 | Ga0207707_10068931 | Ga0207707_100689313 | 213 |
| 353 | 3300025917 | Ga0207660_10045308 | Ga0207660_100453083 | 213 |
| 354 | 3300025917 | Ga0207660_10140932 | Ga0207660_101409323 | 213 |
| 355 | 3300025920 | Ga0207649_10241863 | Ga0207649_102418632 | 213 |
| 356 | 3300025921 | Ga0207652_10009141 | Ga0207652_100091414 | 213 |
| 357 | 3300025921 | Ga0207652_10138820 | Ga0207652_101388203 | 213 |
| 358 | 3300025929 | Ga0207664_10249530 | Ga0207664_102495302 | 213 |
| 359 | 3300025945 | Ga0207679_10172122 | Ga0207679_101721222 | 213 |
| 360 | 3300025949 | Ga0207667_10112261 | Ga0207667_101122613 | 213 |
| 361 | 3300025949 | Ga0207667_10119726 | Ga0207667_101197263 | 213 |
| 362 | 3300025972 | Ga0207668_10130826 | Ga0207668_101308262 | 213 |
| 363 | 3300026041 | Ga0207639_10164006 | Ga0207639_101640062 | 213 |
| 364 | 3300026078 | Ga0207702_10002576 | Ga0207702_1000257616 | 213 |
| 365 | 3300026088 | Ga0207641_10422948 | Ga0207641_104229482 | 213 |
| 366 | 3300026116 | Ga0207674_10100791 | Ga0207674_101007913 | 213 |
| 367 | 3300031824 | Ga0307413_10177026 | Ga0307413_101770262 | 213 |
| 368 | 3300031852 | Ga0307410_10100515 | Ga0307410_101005152 | 213 |
| 369 | 3300031901 | Ga0307406_10118280 | Ga0307406_101182802 | 213 |
| 370 | 3300031995 | Ga0307409_100009836 | Ga0307409_1000098364 | 213 |
| 371 | 3300031995 | Ga0307409_100165703 | Ga0307409_1001657032 | 213 |
| 372 | 3300031995 | Ga0307409_100398917 | Ga0307409_1003989172 | 213 |
| 373 | 3300032002 | Ga0307416_100012620 | Ga0307416_1000126203 | 213 |
| 374 | 3300032004 | Ga0307414_10522967 | Ga0307414_105229672 | 213 |
| 375 | 3300032005 | Ga0307411_10257054 | Ga0307411_102570542 | 213 |
| 376 | 3300032126 | Ga0307415_100023780 | Ga0307415_1000237804 | 213 |
| 377 | 3300036401 | Ga0373937_0275211 | Ga0373937_0275211_502_1143 | 213 |
| 378 | 3300036401 | Ga0373937_0580552 | Ga0373937_0580552_223_864 | 213 |
| 379 | 3300037853 | Ga0436364_0030853 | Ga0436364_0030853_4049_4690 | 213 |
| 380 | 3300039437 | Ga0436365_0040252 | Ga0436365_0040252_1418_2059 | 213 |
| 381 | 3300046543 | Ga0495645_0059663 | Ga0495645_0059663_841_1482 | 213 |
| 382 | 3300049568 | Ga0501031_0203125 | Ga0501031_0203125_133_783 | 213 |
| 383 | 3300049571 | Ga0501034_0011544 | Ga0501034_0011544_8011_8661 | 213 |
| 384 | 3300049571 | Ga0501034_0028364 | Ga0501034_0028364_3067_3708 | 213 |
| 385 | 3300049573 | Ga0501037_0173349 | Ga0501037_0173349_645_1295 | 213 |
| 386 | 3300049577 | Ga0501041_0132662 | Ga0501041_0132662_783_1424 | 213 |
| 387 | 3300049586 | Ga0501070_0474767 | Ga0501070_0474767_336_977 | 213 |
| 388 | 3300049586 | Ga0501070_0586823 | Ga0501070_0586823_82_723 | 213 |
| 389 | 3300049588 | Ga0501072_0618864 | Ga0501072_0618864_22_663 | 213 |
| 390 | 3300049589 | Ga0501073_0019290 | Ga0501073_0019290_129_770 | 213 |
| 391 | 3300049742 | Ga0501080_0000772 | Ga0501080_0000772_13120_13761 | 213 |
| 392 | 3300049742 | Ga0501080_0357871 | Ga0501080_0357871_607_1248 | 213 |
| 393 | 3300049744 | Ga0501083_0002315 | Ga0501083_0002315_11747_12388 | 213 |
| 394 | 3300049822 | Ga0501035_0143882 | Ga0501035_0143882_271_912 | 213 |
| 395 | 3300049824 | Ga0501045_0519428 | Ga0501045_0519428_142_783 | 213 |
| 396 | 3300050512 | nmdc:mga0n895_79350_c1 | nmdc:mga0n895_79350_c1_1528_2172 | 213 |
| 397 | 3300050514 | nmdc:mga08x19_46588_c1 | nmdc:mga08x19_46588_c1_356_1000 | 213 |
| 398 | 3300053077 | Ga0495601_0317375 | Ga0495601_0317375_258_899 | 213 |
| 399 | 3300053084 | Ga0495595_0148203 | Ga0495595_0148203_49_690 | 213 |
| 400 | 3300054114 | Ga0501084_0145961 | Ga0501084_0145961_1178_1819 | 213 |
| 401 | 3300060353 | Ga0501082_0127999 | Ga0501082_0127999_129_770 | 213 |
| 402 | 3300060353 | Ga0501082_0384403 | Ga0501082_0384403_93_734 | 213 |
| 403 | 3300060353 | Ga0501082_0399418 | Ga0501082_0399418_501_1142 | 213 |
| 404 | 3300003323 | rootH1_10189855 | rootH1_101898552 | 214 |
| 405 | 3300005337 | Ga0070682_100071718 | Ga0070682_1000717182 | 214 |
| 406 | 3300005356 | Ga0070674_100267465 | Ga0070674_1002674651 | 214 |
| 407 | 3300006175 | Ga0070712_100003321 | Ga0070712_1000033215 | 214 |
| 408 | 3300006358 | Ga0068871_100277689 | Ga0068871_1002776891 | 214 |
| 409 | 3300021377 | Ga0213874_10069911 | Ga0213874_100699112 | 214 |
| 410 | 3300025915 | Ga0207693_10012704 | Ga0207693_100127042 | 214 |
| 411 | 3300036401 | Ga0373937_0445458 | Ga0373937_0445458_392_1036 | 214 |
| 412 | 3300039450 | Ga0436363_1296752 | Ga0436363_1296752_1266_1922 | 214 |
| 413 | 3300046663 | Ga0495635_0166861 | Ga0495635_0166861_310_954 | 214 |
| 414 | 3300053085 | Ga0495619_0269263 | Ga0495619_0269263_232_876 | 214 |
| 415 | 3300021361 | Ga0213872_10041602 | Ga0213872_100416021 | 216 |
| 416 | iso_pu_bacteria | 2818991436 | 2819544396 | 216 |
| 417 | 3300037312 | Ga0395899_0038076 | Ga0395899_0038076_2703_3359 | 218 |
| 418 | 3300037418 | Ga0395900_0039635 | Ga0395900_0039635_4112_4771 | 218 |
| 419 | 3300037418 | Ga0395900_0176543 | Ga0395900_0176543_1365_2021 | 218 |
| 420 | 3300037466 | Ga0395898_0259463 | Ga0395898_0259463_90_746 | 218 |
| 421 | 3300037471 | Ga0395905_0012162 | Ga0395905_0012162_7591_8250 | 218 |
| 422 | 3300038443 | Ga0395901_0004958 | Ga0395901_0004958_9891_10547 | 218 |
| 423 | 3300038443 | Ga0395901_0203922 | Ga0395901_0203922_77_733 | 218 |
| 424 | 3300059477 | Ga0587084_006131 | Ga0587084_006131_522_1181 | 218 |
| 425 | 3300059513 | Ga0587094_005308 | Ga0587094_005308_717_1376 | 218 |
| 426 | 3300059626 | Ga0587115_008824 | Ga0587115_008824_30_689 | 218 |
| 427 | 3300059645 | Ga0587076_002888 | Ga0587076_002888_533_1192 | 218 |
| 428 | 3300059647 | Ga0587079_018791 | Ga0587079_018791_287_946 | 218 |
| 429 | 3300059649 | Ga0587102_001164 | Ga0587102_001164_1071_1730 | 218 |
| 430 | 3300060344 | Ga0587071_012671 | Ga0587071_012671_715_1374 | 218 |
| 431 | 3300060346 | Ga0587111_0005720 | Ga0587111_0005720_732_1391 | 218 |
| 432 | iso_pu_bacteria | 2643221603 | 2644030392 | 218 |
| 433 | 3300021361 | Ga0213872_10052258 | Ga0213872_100522583 | 219 |
| 434 | 3300025250 | Ga0209026_1001428 | Ga0209026_10014289 | 219 |
| 435 | 3300039447 | Ga0436361_0390380 | Ga0436361_0390380_1813_2472 | 219 |
| 436 | 3300046528 | Ga0495642_0071142 | Ga0495642_0071142_238_903 | 219 |
| 437 | 3300046539 | Ga0495621_0034821 | Ga0495621_0034821_963_1628 | 219 |
| 438 | 3300048905 | Ga0496102_0078484 | Ga0496102_0078484_768_1433 | 219 |
| 439 | 3300048906 | Ga0496103_0094585 | Ga0496103_0094585_378_1043 | 219 |
| 440 | 3300048907 | Ga0496104_0565115 | Ga0496104_0565115_167_832 | 219 |
| 441 | 3300048911 | Ga0496108_0052653 | Ga0496108_0052653_2487_3152 | 219 |
| 442 | 3300048917 | Ga0496114_0285690 | Ga0496114_0285690_637_1302 | 219 |
| 443 | 3300002737 | JGI25162J39368_1000268 | JGI25162J39368_100026834 | 220 |
| 444 | 3300003214 | JGI25165J46597_1000270 | JGI25165J46597_100027024 | 220 |
| 445 | 3300003751 | Ga0055538_1000105 | Ga0055538_100010524 | 220 |
| 446 | 3300003752 | Ga0055539_1000153 | Ga0055539_100015324 | 220 |
| 447 | 3300003756 | Ga0055533_1000155 | Ga0055533_100015524 | 220 |
| 448 | 3300003759 | Ga0055525_1000208 | Ga0055525_100020833 | 220 |
| 449 | 3300003841 | Ga0055541_1000102 | Ga0055541_100010224 | 220 |
| 450 | 3300014497 | Ga0182008_10059363 | Ga0182008_100593632 | 220 |
| 451 | 3300014497 | Ga0182008_10086857 | Ga0182008_100868572 | 220 |
| 452 | 3300015261 | Ga0182006_1021149 | Ga0182006_10211492 | 220 |
| 453 | 3300015262 | Ga0182007_10001140 | Ga0182007_1000114012 | 220 |
| 454 | 3300015262 | Ga0182007_10009543 | Ga0182007_100095432 | 220 |
| 455 | 3300015265 | Ga0182005_1002993 | Ga0182005_10029932 | 220 |
| 456 | 3300025207 | Ga0209760_106452 | Ga0209760_1064522 | 220 |
| 457 | 3300025224 | Ga0209784_100027 | Ga0209784_100027327 | 220 |
| 458 | 3300025225 | Ga0209566_100027 | Ga0209566_100027327 | 220 |
| 459 | 3300025226 | Ga0209674_100044 | Ga0209674_100044327 | 220 |
| 460 | 3300025230 | Ga0209563_100048 | Ga0209563_100048327 | 220 |
| 461 | 3300025231 | Ga0207427_101706 | Ga0207427_1017065 | 220 |
| 462 | 3300025233 | Ga0209437_100055 | Ga0209437_100055327 | 220 |
| 463 | 3300025253 | Ga0209677_100028 | Ga0209677_100028327 | 220 |
| 464 | 3300025261 | Ga0209233_1000070 | Ga0209233_1000070327 | 220 |
| 465 | 3300046454 | Ga0495592_0135391 | Ga0495592_0135391_704_1366 | 220 |
| 466 | 3300046462 | Ga0495651_0003016 | Ga0495651_0003016_1447_2109 | 220 |
| 467 | 3300046462 | Ga0495651_0104831 | Ga0495651_0104831_765_1427 | 220 |
| 468 | 3300046463 | Ga0495653_0007466 | Ga0495653_0007466_1871_2533 | 220 |
| 469 | 3300046511 | Ga0495608_0002589 | Ga0495608_0002589_7957_8619 | 220 |
| 470 | 3300046511 | Ga0495608_0004160 | Ga0495608_0004160_469_1131 | 220 |
| 471 | 3300046516 | Ga0495628_0003134 | Ga0495628_0003134_12625_13287 | 220 |
| 472 | 3300046516 | Ga0495628_0090090 | Ga0495628_0090090_367_1029 | 220 |
| 473 | 3300046516 | Ga0495628_0272599 | Ga0495628_0272599_80_742 | 220 |
| 474 | 3300046529 | Ga0495652_0005368 | Ga0495652_0005368_10549_11211 | 220 |
| 475 | 3300046529 | Ga0495652_0011385 | Ga0495652_0011385_2905_3567 | 220 |
| 476 | 3300046529 | Ga0495652_0080422 | Ga0495652_0080422_182_844 | 220 |
| 477 | 3300046543 | Ga0495645_0006452 | Ga0495645_0006452_2539_3201 | 220 |
| 478 | 3300046663 | Ga0495635_0026819 | Ga0495635_0026819_393_1055 | 220 |
| 479 | 3300046675 | Ga0495657_0015573 | Ga0495657_0015573_3672_4334 | 220 |
| 480 | 3300046678 | Ga0495599_0002549 | Ga0495599_0002549_7151_7813 | 220 |
| 481 | 3300046679 | Ga0495623_0001599 | Ga0495623_0001599_11061_11723 | 220 |
| 482 | 3300046679 | Ga0495623_0050081 | Ga0495623_0050081_932_1594 | 220 |
| 483 | 3300046680 | Ga0495646_0002324 | Ga0495646_0002324_5674_6336 | 220 |
| 484 | 3300046683 | Ga0495658_0032746 | Ga0495658_0032746_309_971 | 220 |
| 485 | 3300046809 | Ga0495600_0008340 | Ga0495600_0008340_3861_4523 | 220 |
| 486 | 3300047317 | Ga0495604_0006395 | Ga0495604_0006395_2870_3532 | 220 |
| 487 | 3300048088 | Ga0495602_0029613 | Ga0495602_0029613_121_783 | 220 |
| 488 | 3300048088 | Ga0495602_0058135 | Ga0495602_0058135_982_1644 | 220 |
| 489 | 3300053077 | Ga0495601_0017953 | Ga0495601_0017953_504_1166 | 220 |
| 490 | 3300053077 | Ga0495601_0275005 | Ga0495601_0275005_398_1060 | 220 |
| 491 | 3300053111 | Ga0500572_162871 | Ga0500572_162871_14_676 | 220 |
| 492 | 3300053119 | Ga0500595_005084 | Ga0500595_005084_135_797 | 220 |
| 493 | 3300053140 | Ga0500573_0168357 | Ga0500573_0168357_157_819 | 220 |
| 494 | 3300053154 | Ga0500619_006548 | Ga0500619_006548_557_1219 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jl4-assembly1.cif.gz_B | holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class | 0.9766 | 1 | 219 |
| 2cz2-assembly1.cif.gz_A-2 | crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal) | 0.9758 | 2 | 220 |
| 2jl4-assembly1.cif.gz_B | holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class | 0.9721 | 1 | 219 |
| 8e8p-assembly1.cif.gz_B | gstz1a | 0.9697 | 2 | 220 |
| 4pxo-assembly1.cif.gz_B | crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) | 0.9697 | 1 | 220 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VHD2_18_96_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9899 | 4 | 84 | 3.40.30.10 |
| 2cz2A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9765 | 4 | 84 | 3.40.30.10 |
| 2v6kB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9731 | 90 | 219 | 1.20.1050.10 |
| af_B8A514_42_123_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9708 | 2 | 81 | 3.40.30.10 |
| 2v6kB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9658 | 90 | 219 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0M9I1N3-F1-model_v4 | deleted | 0.9947 | 1 | 219 |
|
| AF-A0A4R6F2N1-F1-model_v4 | Maleylacetoacetate isomerase | 0.9946 | 2 | 219 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A0Q4H1E7-F1-model_v4 | Maleylacetoacetate isomerase | 0.9938 | 1 | 219 |
GO:0004364
GO:0005737 GO:0006559 GO:0006749 GO:0016034 |
| AF-A0A6J5FNF1-F1-model_v4 | deleted | 0.9936 | 1 | 219 |
|
| AF-A2VVB5-F1-model_v4 | deleted | 0.9933 | 2 | 219 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar