F454648

General Info

Members Datasets Scaffolds Average Seq Length
494 315 486 213

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221603|2644030392
Length 231
Sequence CRRPPANLKSGYRVKLYSYFRSSASYRVRIALNLKGLAYETLPVHLLKNGGEQLTPEYRKLNPDGLVPVFVDELADNSVALTQSLAIIEYLDETHPQPPLLPQSPLGKAFVRSIALSIACDIHPINNLRVLRYLVRDLKVSEDDKNAWYRHWCEQGLAAIEQTLSTDKRVGRFCYGDAPTLADCCLVPQIANAQRLNSDLSKMPTVMRIHDACMALDAFVNASPAKQPDAE

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
3 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
4 2818991436 Collimonas arenae 515 Isolate Unclassified
5 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
6 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
7 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
118 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
126 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
270 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
271 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
272 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
273 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
274 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
275 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
276 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
284 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
285 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
299 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
300 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
301 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
302 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
303 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
304 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 1.62
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.35
Nodule 0
Rhizoplane 5.67
Rhizosphere 76.11
Stem 0
Stem Tuber 0
Unclassified 5.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000268 3300002737 Bacteria 50187
2 JGI25150J39212_1008313 3300002774 Bacteria 2039
3 JGI25165J46597_1000270 3300003214 Bacteria 66952
4 rootH1_10189855 3300003323 Bacteria 1936
5 Ga0055538_1000105 3300003751 Bacteria 66952
6 Ga0055539_1000153 3300003752 Bacteria 66948
7 Ga0055533_1000155 3300003756 Bacteria 66952
8 Ga0055525_1000208 3300003759 Bacteria 66952
9 Ga0055529_1001100 3300003763 Bacteria 12129
10 Ga0055541_1000102 3300003841 Bacteria 66952
11 Ga0065704_10079012 3300005289 Bacteria 4281
12 Ga0065712_10145043 3300005290 Bacteria 1416
13 Ga0070658_10001694 3300005327 Bacteria 18612
14 Ga0070658_10247842 3300005327 Bacteria 1511
15 Ga0070670_100076600 3300005331 Bacteria 2874
16 Ga0070670_101199274 3300005331 Bacteria 694
17 Ga0070666_10419944 3300005335 Bacteria 963
18 Ga0070680_100178168 3300005336 Bacteria 1790
19 Ga0070680_100443206 3300005336 Bacteria 1109
20 Ga0070682_100071718 3300005337 Bacteria 2218
21 Ga0068868_100208319 3300005338 Bacteria 1633
22 Ga0068868_100278029 3300005338 Bacteria 1416
23 Ga0070689_100053438 3300005340 Bacteria 3126
24 Ga0070689_100143623 3300005340 Bacteria 1921
25 Ga0070661_100266265 3300005344 Bacteria 1326
26 Ga0070668_100008874 3300005347 Bacteria 7465
27 Ga0070668_100031641 3300005347 Bacteria 4026
28 Ga0070668_100191571 3300005347 Bacteria 1675
29 Ga0070668_100238396 3300005347 Bacteria 1506
30 Ga0070668_100587731 3300005347 Bacteria 973
31 Ga0070669_100008504 3300005353 Bacteria 7326
32 Ga0070669_100213043 3300005353 Bacteria 1525
33 Ga0070669_100829778 3300005353 Bacteria 787
34 Ga0070675_100217554 3300005354 Bacteria 1662
35 Ga0070675_101080061 3300005354 Bacteria 738
36 Ga0070671_100006371 3300005355 Bacteria 9424
37 Ga0070671_100904867 3300005355 Bacteria 771
38 Ga0070674_100267465 3300005356 Bacteria 1350
39 Ga0070667_100207037 3300005367 Bacteria 1742
40 Ga0070667_101222812 3300005367 Bacteria 703
41 Ga0070709_10123502 3300005434 Bacteria 1758
42 Ga0070709_10316702 3300005434 Bacteria 1144
43 Ga0070714_100022875 3300005435 Bacteria 5128
44 Ga0070714_100130753 3300005435 Bacteria 2243
45 Ga0070714_100244405 3300005435 Bacteria 1657
46 Ga0070713_100028787 3300005436 Bacteria 4390
47 Ga0070713_100318664 3300005436 Bacteria 1435
48 Ga0070713_100361150 3300005436 Bacteria 1349
49 Ga0070701_10006946 3300005438 Bacteria 4800
50 Ga0070701_10488840 3300005438 Bacteria 797
51 Ga0070711_100141232 3300005439 Bacteria 1806
52 Ga0070708_100028943 3300005445 Bacteria 4772
53 Ga0070663_100460565 3300005455 Bacteria 1050
54 Ga0070681_10012832 3300005458 Bacteria 8318
55 Ga0070681_10047196 3300005458 Bacteria 4305
56 Ga0068867_100910651 3300005459 Bacteria 792
57 Ga0070706_100060660 3300005467 Bacteria 3491
58 Ga0070707_100082657 3300005468 Bacteria 3102
59 Ga0070698_100023134 3300005471 Bacteria 6497
60 Ga0070698_100178662 3300005471 Bacteria 2061
61 Ga0070699_100080526 3300005518 Bacteria 2838
62 Ga0070679_100008089 3300005530 Bacteria 9883
63 Ga0070679_100097318 3300005530 Bacteria 2930
64 Ga0070697_100407121 3300005536 Bacteria 1181
65 Ga0070697_100498422 3300005536 Bacteria 1065
66 Ga0068853_100180489 3300005539 Bacteria 1914
67 Ga0068853_100259317 3300005539 Bacteria 1597
68 Ga0070695_100312074 3300005545 Bacteria 1166
69 Ga0070695_100600416 3300005545 Bacteria 864
70 Ga0070696_100086338 3300005546 Bacteria 2228
71 Ga0070696_100478584 3300005546 Bacteria 987
72 Ga0070665_100000070 3300005548 Bacteria 200681
73 Ga0070665_101298681 3300005548 Bacteria 738
74 Ga0070704_100124972 3300005549 Bacteria 1983
75 Ga0068855_100023989 3300005563 Bacteria 7303
76 Ga0068855_100043509 3300005563 Bacteria 5319
77 Ga0068855_100335585 3300005563 Bacteria 1668
78 Ga0068855_100479896 3300005563 Bacteria 1353
79 Ga0068855_100600859 3300005563 Bacteria 1186
80 Ga0070664_100034119 3300005564 Bacteria 4268
81 Ga0068857_100128437 3300005577 Bacteria 2285
82 Ga0068854_100153628 3300005578 Bacteria 1777
83 Ga0068854_100427728 3300005578 Bacteria 1101
84 Ga0068856_100003325 3300005614 Bacteria 16338
85 Ga0068856_100037745 3300005614 Bacteria 4740
86 Ga0068856_100406864 3300005614 Bacteria 1380
87 Ga0070702_100612163 3300005615 Bacteria 818
88 Ga0068852_100009489 3300005616 Bacteria 7230
89 Ga0068852_100083374 3300005616 Bacteria 2842
90 Ga0068852_100411847 3300005616 Bacteria 1332
91 Ga0068859_100019938 3300005617 Bacteria 6732
92 Ga0068864_100913063 3300005618 Bacteria 868
93 Ga0068863_100001094 3300005841 Bacteria 27056
94 Ga0068858_100012022 3300005842 Bacteria 8160
95 Ga0068858_100179398 3300005842 Bacteria 1999
96 Ga0068858_100308978 3300005842 Bacteria 1509
97 Ga0068860_100301011 3300005843 Bacteria 1571
98 Ga0068862_100037249 3300005844 Bacteria 4122
99 Ga0068862_100198021 3300005844 Bacteria 1810
100 Ga0081539_10013256 3300005985 Bacteria 6228
101 Ga0070717_10353393 3300006028 Bacteria 1314
102 Ga0075365_10009056 3300006038 Bacteria 5694
103 Ga0075365_10779899 3300006038 Bacteria 675
104 Ga0075368_10000094 3300006042 Bacteria 22408
105 Ga0075368_10002592 3300006042 Bacteria 5927
106 Ga0075363_100004236 3300006048 Bacteria 6235
107 Ga0075363_100016345 3300006048 Bacteria 3665
108 Ga0075364_10080069 3300006051 Bacteria 2159
109 Ga0075364_10081219 3300006051 Bacteria 2143
110 Ga0070716_100061063 3300006173 Bacteria 2180
111 Ga0070712_100003321 3300006175 Bacteria 9891
112 Ga0075362_10000681 3300006177 Bacteria 10019
113 Ga0075367_10005224 3300006178 Bacteria 6418
114 Ga0075369_10001385 3300006186 Bacteria 8272
115 Ga0075369_10002009 3300006186 Bacteria 7164
116 Ga0075366_10034353 3300006195 Bacteria 2986
117 Ga0097621_100020317 3300006237 Bacteria 5116
118 Ga0097621_100024181 3300006237 Bacteria 4740
119 Ga0097621_100327090 3300006237 Bacteria 1359
120 Ga0097621_100733023 3300006237 Bacteria 912
121 Ga0075370_10007345 3300006353 Bacteria 5607
122 Ga0075370_10362900 3300006353 Bacteria 866
123 Ga0068871_100277689 3300006358 Bacteria 1465
124 Ga0075434_100078301 3300006871 Bacteria 3301
125 Ga0075436_100032173 3300006914 Bacteria 3614
126 Ga0075436_100065027 3300006914 Bacteria 2521
127 Ga0097620_100019938 3300006931 Bacteria 6732
128 Ga0075435_100072442 3300007076 Bacteria 2815
129 Ga0075435_100104637 3300007076 Bacteria 2348
130 Ga0099795_10041242 3300007788 Bacteria 1643
131 Ga0105251_10005097 3300009011 Bacteria 8696
132 Ga0105240_10007874 3300009093 Bacteria 15370
133 Ga0105240_10011007 3300009093 Bacteria 12664
134 Ga0105240_10617149 3300009093 Bacteria 1192
135 Ga0105245_10034031 3300009098 Bacteria 4517
136 Ga0105245_10794913 3300009098 Bacteria 984
137 Ga0105247_10031708 3300009101 Bacteria 3209
138 Ga0114129_10541051 3300009147 Bacteria 1516
139 Ga0114129_11215434 3300009147 Bacteria 938
140 Ga0105243_10268404 3300009148 Bacteria 1531
141 Ga0105243_10301428 3300009148 Bacteria 1452
142 Ga0105243_10989364 3300009148 Bacteria 843
143 Ga0105241_10030970 3300009174 Bacteria 4001
144 Ga0105241_10089214 3300009174 Bacteria 2429
145 Ga0105242_10049730 3300009176 Bacteria 3412
146 Ga0105242_11239346 3300009176 Bacteria 767
147 Ga0105248_10277769 3300009177 Bacteria 1886
148 Ga0105237_10017969 3300009545 Bacteria 7327
149 Ga0105238_10010811 3300009551 Bacteria 9171
150 Ga0157326_1002540 3300012513 Bacteria 1947
151 Ga0157373_10077649 3300013100 Bacteria 2343
152 Ga0157370_10112381 3300013104 Bacteria 2546
153 Ga0157369_10391577 3300013105 Bacteria 1442
154 Ga0157374_10054473 3300013296 Bacteria 3731
155 Ga0157378_10046831 3300013297 Bacteria 3843
156 Ga0157378_10936094 3300013297 Bacteria 898
157 Ga0157372_10036821 3300013307 Bacteria 5395
158 Ga0157372_10045441 3300013307 Bacteria 4872
159 Ga0157372_10063295 3300013307 Bacteria 4147
160 Ga0157372_10259244 3300013307 Bacteria 2019
161 Ga0157375_10329615 3300013308 Bacteria 1691
162 Ga0157375_11311185 3300013308 Bacteria 851
163 Ga0163163_10902288 3300014325 Bacteria 947
164 Ga0157380_10167222 3300014326 Bacteria 1917
165 Ga0157380_10717138 3300014326 Bacteria 1007
166 Ga0182008_10025832 3300014497 Bacteria 2981
167 Ga0182008_10059363 3300014497 Bacteria 1887
168 Ga0182008_10086857 3300014497 Bacteria 1540
169 Ga0157379_10052935 3300014968 Bacteria 3626
170 Ga0157376_10812690 3300014969 Bacteria 948
171 Ga0182006_1021149 3300015261 Bacteria 2717
172 Ga0182007_10001140 3300015262 Bacteria 14392
173 Ga0182007_10009543 3300015262 Bacteria 3908
174 Ga0182005_1002993 3300015265 Bacteria 5843
175 Ga0213872_10041602 3300021361 Bacteria 2097
176 Ga0213872_10052258 3300021361 Bacteria 1854
177 Ga0213874_10045859 3300021377 Bacteria 1324
178 Ga0213874_10061997 3300021377 Bacteria 1173
179 Ga0213874_10069911 3300021377 Bacteria 1117
180 Ga0213875_10184059 3300021388 Bacteria 981
181 Ga0213871_10031457 3300021441 Bacteria 1386
182 Ga0209760_106452 3300025207 Bacteria 929
183 Ga0209784_100027 3300025224 Bacteria 363933
184 Ga0209566_100027 3300025225 Bacteria 363933
185 Ga0209674_100044 3300025226 Bacteria 363933
186 Ga0209563_100048 3300025230 Bacteria 363933
187 Ga0207427_101706 3300025231 Bacteria 7284
188 Ga0209437_100055 3300025233 Bacteria 363933
189 Ga0209026_1001428 3300025250 Bacteria 10589
190 Ga0209677_100028 3300025253 Bacteria 363933
191 Ga0209233_1000070 3300025261 Bacteria 363933
192 Ga0209565_1013585 3300025263 Bacteria 1902
193 Ga0209675_1031116 3300025291 Bacteria 1264
194 Ga0209564_1000823 3300025295 Bacteria 42196
195 Ga0207713_1003159 3300025735 Bacteria 11410
196 Ga0207692_10118289 3300025898 Bacteria 1480
197 Ga0207699_10035819 3300025906 Bacteria 2826
198 Ga0207645_10105765 3300025907 Bacteria 1819
199 Ga0207643_10125507 3300025908 Bacteria 1523
200 Ga0207654_10096125 3300025911 Bacteria 1816
201 Ga0207707_10013313 3300025912 Bacteria 7169
202 Ga0207707_10068931 3300025912 Bacteria 3082
203 Ga0207695_10038279 3300025913 Bacteria 5165
204 Ga0207695_10249864 3300025913 Bacteria 1673
205 Ga0207695_10406332 3300025913 Bacteria 1246
206 Ga0207671_10151632 3300025914 Bacteria 1791
207 Ga0207693_10012704 3300025915 Bacteria 6801
208 Ga0207660_10045308 3300025917 Bacteria 3098
209 Ga0207660_10140932 3300025917 Bacteria 1843
210 Ga0207649_10241863 3300025920 Bacteria 1296
211 Ga0207652_10009141 3300025921 Bacteria 7976
212 Ga0207652_10138820 3300025921 Bacteria 2172
213 Ga0207681_10002806 3300025923 Bacteria 11026
214 Ga0207694_10105824 3300025924 Bacteria 2234
215 Ga0207650_11025173 3300025925 Bacteria 702
216 Ga0207659_10181367 3300025926 Bacteria 1668
217 Ga0207687_10528340 3300025927 Bacteria 988
218 Ga0207664_10249530 3300025929 Bacteria 1548
219 Ga0207664_10279159 3300025929 Bacteria 1465
220 Ga0207644_10004490 3300025931 Bacteria 9062
221 Ga0207644_10483851 3300025931 Bacteria 1020
222 Ga0207706_10187321 3300025933 Bacteria 1817
223 Ga0207686_10028897 3300025934 Bacteria 3264
224 Ga0207686_10560101 3300025934 Bacteria 895
225 Ga0207709_10546771 3300025935 Bacteria 910
226 Ga0207709_10672917 3300025935 Bacteria 826
227 Ga0207670_10025761 3300025936 Bacteria 3697
228 Ga0207670_10083821 3300025936 Bacteria 2237
229 Ga0207670_10278151 3300025936 Bacteria 1303
230 Ga0207669_10954808 3300025937 Bacteria 719
231 Ga0207691_10004244 3300025940 Bacteria 13917
232 Ga0207711_10003996 3300025941 Bacteria 12662
233 Ga0207711_10209090 3300025941 Bacteria 1782
234 Ga0207679_10172122 3300025945 Bacteria 1784
235 Ga0207679_11022809 3300025945 Bacteria 757
236 Ga0207667_10011558 3300025949 Bacteria 10253
237 Ga0207667_10112261 3300025949 Bacteria 2811
238 Ga0207667_10119726 3300025949 Bacteria 2713
239 Ga0207668_10130826 3300025972 Bacteria 1916
240 Ga0207668_10138914 3300025972 Bacteria 1865
241 Ga0207668_10150501 3300025972 Bacteria 1801
242 Ga0207658_10009594 3300025986 Bacteria 6567
243 Ga0207658_11096636 3300025986 Bacteria 727
244 Ga0207677_10411539 3300026023 Bacteria 1149
245 Ga0207703_10008303 3300026035 Bacteria 8202
246 Ga0207703_10018509 3300026035 Bacteria 5439
247 Ga0207703_10309430 3300026035 Bacteria 1444
248 Ga0207639_10164006 3300026041 Bacteria 1875
249 Ga0207639_10798830 3300026041 Bacteria 879
250 Ga0207708_10816131 3300026075 Bacteria 804
251 Ga0207702_10002576 3300026078 Bacteria 17051
252 Ga0207702_10218777 3300026078 Bacteria 1774
253 Ga0207641_10422948 3300026088 Bacteria 1283
254 Ga0207648_10259121 3300026089 Bacteria 1551
255 Ga0207648_10707447 3300026089 Bacteria 934
256 Ga0207676_10365834 3300026095 Bacteria 1338
257 Ga0207676_10528770 3300026095 Bacteria 1124
258 Ga0207674_10100791 3300026116 Bacteria 2869
259 Ga0207675_100816367 3300026118 Bacteria 946
260 Ga0207675_100956880 3300026118 Bacteria 874
261 Ga0207683_10168519 3300026121 Bacteria 1982
262 Ga0207698_10125963 3300026142 Bacteria 2178
263 Ga0207698_10272849 3300026142 Bacteria 1560
264 Ga0209813_10000202 3300027866 Bacteria 18474
265 Ga0268266_10000202 3300028379 Bacteria 104100
266 Ga0268265_10015138 3300028380 Bacteria 5271
267 Ga0268265_10145283 3300028380 Bacteria 1992
268 Ga0268264_10012701 3300028381 Bacteria 6931
269 Ga0265328_10000118 3300031239 Bacteria 37735
270 Ga0265328_10008424 3300031239 Bacteria 4251
271 Ga0265328_10023944 3300031239 Bacteria 2311
272 Ga0265331_10000005 3300031250 Bacteria 465192
273 Ga0307408_100069009 3300031548 Bacteria 2605
274 Ga0307413_10177026 3300031824 Bacteria 1516
275 Ga0307410_10100515 3300031852 Bacteria 2072
276 Ga0307406_10118280 3300031901 Bacteria 1837
277 Ga0307406_10421100 3300031901 Bacteria 1064
278 Ga0307412_10000182 3300031911 Bacteria 44103
279 Ga0307412_10230733 3300031911 Bacteria 1425
280 Ga0307409_100009836 3300031995 Bacteria 5901
281 Ga0307409_100165703 3300031995 Bacteria 1939
282 Ga0307409_100398917 3300031995 Bacteria 1313
283 Ga0307416_100012620 3300032002 Bacteria 5703
284 Ga0307416_100076222 3300032002 Bacteria 2810
285 Ga0307416_100097022 3300032002 Bacteria 2551
286 Ga0307416_100270039 3300032002 Bacteria 1669
287 Ga0307414_10000100 3300032004 Bacteria 63343
288 Ga0307414_10191622 3300032004 Bacteria 1655
289 Ga0307414_10522967 3300032004 Bacteria 1053
290 Ga0307414_10967496 3300032004 Bacteria 783
291 Ga0307411_10257054 3300032005 Bacteria 1377
292 Ga0307415_100023780 3300032126 Bacteria 3812
293 Ga0373953_0085245 3300035117 Bacteria 1318
294 Ga0373956_0028309 3300035119 Bacteria 2438
295 Ga0373955_0275003 3300035172 Bacteria 1012
296 Ga0373924_0096947 3300035410 Bacteria 1266
297 Ga0373931_0041808 3300035691 Bacteria 2409
298 Ga0373935_0608364 3300035692 Bacteria 800
299 Ga0373927_0011165 3300035695 Bacteria 5982
300 Ga0373933_0336499 3300035724 Bacteria 979
301 Ga0373947_0213261 3300035725 Bacteria 1267
302 Ga0373937_0221418 3300036401 Bacteria 1781
303 Ga0373937_0275211 3300036401 Bacteria 1589
304 Ga0373937_0445458 3300036401 Bacteria 1230
305 Ga0373937_0580552 3300036401 Bacteria 1064
306 Ga0395899_0038076 3300037312 Bacteria 3603
307 Ga0395900_0039635 3300037418 Bacteria 4854
308 Ga0395900_0176543 3300037418 Bacteria 2172
309 Ga0395898_0259463 3300037466 Bacteria 1657
310 Ga0395905_0012162 3300037471 Bacteria 8289
311 Ga0436364_0030853 3300037853 Bacteria 6474
312 Ga0395901_0004958 3300038443 Bacteria 13431
313 Ga0395901_0203922 3300038443 Bacteria 2072
314 Ga0436365_0040252 3300039437 Bacteria 5550
315 Ga0436365_1538167 3300039437 Bacteria 4918
316 Ga0436361_0390380 3300039447 Bacteria 5301
317 Ga0436363_1259682 3300039450 Bacteria 996
318 Ga0436363_1296752 3300039450 Bacteria 3027
319 Ga0451853_1698836 3300041512 Bacteria 855
320 Ga0450923_026073 3300042125 Unclassified 1169
321 Ga0451577_0144831 3300042876 Bacteria 2136
322 Ga0466963_0106468 3300044694 Bacteria 1923
323 Ga0451576_0264257 3300045051 Bacteria 1799
324 Ga0451576_0660500 3300045051 Bacteria 1099
325 Ga0495592_0135391 3300046454 Bacteria 1719
326 Ga0495592_0189667 3300046454 Bacteria 1394
327 Ga0495603_0095202 3300046455 Bacteria 1740
328 Ga0495651_0003016 3300046462 Bacteria 13002
329 Ga0495651_0065823 3300046462 Bacteria 2767
330 Ga0495651_0104831 3300046462 Bacteria 2098
331 Ga0495653_0007466 3300046463 Bacteria 8940
332 Ga0495580_0178819 3300046472 Bacteria 1465
333 Ga0495664_0235327 3300046477 Bacteria 1108
334 Ga0495608_0002589 3300046511 Bacteria 12994
335 Ga0495608_0004160 3300046511 Bacteria 10374
336 Ga0495618_0015107 3300046514 Bacteria 4710
337 Ga0495628_0003134 3300046516 Bacteria 14837
338 Ga0495628_0090090 3300046516 Bacteria 2374
339 Ga0495628_0122150 3300046516 Bacteria 1997
340 Ga0495628_0272599 3300046516 Bacteria 1258
341 Ga0495642_0071142 3300046528 Bacteria 1455
342 Ga0495652_0005368 3300046529 Bacteria 12081
343 Ga0495652_0011385 3300046529 Bacteria 8044
344 Ga0495652_0080422 3300046529 Bacteria 2691
345 Ga0495587_0026999 3300046536 Bacteria 3497
346 Ga0495621_0034821 3300046539 Bacteria 1741
347 Ga0495621_0181222 3300046539 Bacteria 841
348 Ga0495645_0002548 3300046543 Bacteria 12365
349 Ga0495645_0006452 3300046543 Bacteria 8138
350 Ga0495645_0059663 3300046543 Bacteria 2766
351 Ga0495667_0096381 3300046559 Bacteria 1915
352 Ga0495635_0026819 3300046663 Bacteria 4008
353 Ga0495635_0166861 3300046663 Bacteria 1498
354 Ga0495657_0015573 3300046675 Bacteria 5559
355 Ga0495657_0034098 3300046675 Bacteria 3538
356 Ga0495599_0002549 3300046678 Bacteria 10615
357 Ga0495599_0039850 3300046678 Bacteria 2951
358 Ga0495623_0001599 3300046679 Bacteria 15265
359 Ga0495623_0050081 3300046679 Bacteria 2646
360 Ga0495623_0054356 3300046679 Bacteria 2526
361 Ga0495646_0002324 3300046680 Bacteria 11644
362 Ga0495658_0032746 3300046683 Bacteria 2841
363 Ga0495613_0412529 3300046689 Bacteria 920
364 Ga0495600_0008340 3300046809 Bacteria 6361
365 Ga0495600_0046686 3300046809 Bacteria 2825
366 Ga0495604_0006395 3300047317 Bacteria 9347
367 Ga0495602_0029613 3300048088 Bacteria 5209
368 Ga0495602_0058135 3300048088 Bacteria 3387
369 Ga0496101_0233543 3300048904 Unclassified 1430
370 Ga0496102_0078484 3300048905 Bacteria 3039
371 Ga0496103_0090983 3300048906 Bacteria 1925
372 Ga0496103_0094585 3300048906 Bacteria 1888
373 Ga0496104_0000132 3300048907 Bacteria 69205
374 Ga0496104_0002291 3300048907 Bacteria 16513
375 Ga0496104_0073285 3300048907 Bacteria 3257
376 Ga0496104_0082220 3300048907 Bacteria 3071
377 Ga0496104_0565115 3300048907 Bacteria 1048
378 Ga0496105_0053521 3300048908 Bacteria 3333
379 Ga0496105_0338356 3300048908 Bacteria 1204
380 Ga0496108_0045274 3300048911 Bacteria 3675
381 Ga0496108_0052653 3300048911 Bacteria 3412
382 Ga0496109_0045366 3300048912 Bacteria 3988
383 Ga0496110_0002182 3300048913 Bacteria 14610
384 Ga0496110_0070108 3300048913 Bacteria 3105
385 Ga0496110_0174813 3300048913 Bacteria 1949
386 Ga0496110_0453017 3300048913 Unclassified 1169
387 Ga0496111_0042358 3300048914 Bacteria 3269
388 Ga0496111_0558604 3300048914 Bacteria 840
389 Ga0496112_0020327 3300048915 Bacteria 6291
390 Ga0496112_0070157 3300048915 Bacteria 3463
391 Ga0496113_0001546 3300048916 Bacteria 12905
392 Ga0496113_0117500 3300048916 Bacteria 2076
393 Ga0496114_0285690 3300048917 Bacteria 1455
394 Ga0496114_0452253 3300048917 Bacteria 1137
395 Ga0496115_0036935 3300048918 Bacteria 3869
396 Ga0496115_0221739 3300048918 Unclassified 1560
397 Ga0496116_0037787 3300048919 Bacteria 3362
398 Ga0496117_0064725 3300048920 Bacteria 2490
399 Ga0496119_0056687 3300048922 Bacteria 2373
400 Ga0496119_0069144 3300048922 Bacteria 2076
401 Ga0496122_0098399 3300048925 Bacteria 1965
402 Ga0496123_0173299 3300048926 Bacteria 1135
403 Ga0496124_0083672 3300048927 Bacteria 2617
404 Ga0496124_0198973 3300048927 Bacteria 1525
405 Ga0496125_0023227 3300048928 Bacteria 5729
406 Ga0496125_0127034 3300048928 Bacteria 1804
407 Ga0496126_0024315 3300048929 Bacteria 5850
408 Ga0496126_0522614 3300048929 Bacteria 945
409 Ga0501031_0203125 3300049568 Bacteria 1293
410 Ga0501034_0011544 3300049571 Bacteria 9150
411 Ga0501034_0028364 3300049571 Bacteria 5696
412 Ga0501034_0097935 3300049571 Bacteria 2929
413 Ga0501037_0173349 3300049573 Bacteria 1533
414 Ga0501041_0132662 3300049577 Bacteria 1552
415 Ga0501041_0306867 3300049577 Bacteria 1000
416 Ga0501047_0508585 3300049581 Bacteria 1031
417 Ga0501048_0211645 3300049582 Bacteria 1375
418 Ga0501070_0474767 3300049586 Bacteria 1006
419 Ga0501070_0556081 3300049586 Bacteria 918
420 Ga0501070_0586823 3300049586 Bacteria 889
421 Ga0501072_0618864 3300049588 Bacteria 853
422 Ga0501073_0019290 3300049589 Bacteria 4925
423 Ga0501076_0045140 3300049592 Bacteria 3478
424 Ga0501077_0168547 3300049593 Bacteria 1391
425 Ga0501198_017973 3300049649 Bacteria 1103
426 Ga0501223_000309 3300049663 Bacteria 12162
427 Ga0501224_000027 3300049664 Bacteria 53610
428 Ga0501233_000078 3300049668 Bacteria 12773
429 Ga0501235_002290 3300049669 Bacteria 4118
430 Ga0501225_0000288 3300049705 Bacteria 15765
431 Ga0501079_0030626 3300049741 Bacteria 4135
432 Ga0501080_0000772 3300049742 Bacteria 26012
433 Ga0501080_0357871 3300049742 Bacteria 1317
434 Ga0501083_0002315 3300049744 Bacteria 13013
435 Ga0501035_0143882 3300049822 Bacteria 2072
436 Ga0501044_0386069 3300049823 Bacteria 1315
437 Ga0501045_0102136 3300049824 Bacteria 2123
438 Ga0501045_0519428 3300049824 Bacteria 884
439 Ga0501226_000116 3300049853 Bacteria 17688
440 nmdc:mga03683_170_c1 3300050489 Bacteria 21777
441 nmdc:mga03683_190111_c1 3300050489 Bacteria 939
442 nmdc:mga03n38_50662_c1 3300050490 Bacteria 1852
443 nmdc:mga00v17_19828_c1 3300050491 Bacteria 2253
444 nmdc:mga00v17_295899_c1 3300050491 Bacteria 1051
445 nmdc:mga00v17_612647_c1 3300050491 Bacteria 702
446 nmdc:mga0yw44_356940_c1 3300050492 Bacteria 985
447 nmdc:mga0yw44_429724_c1 3300050492 Bacteria 894
448 nmdc:mga0k408_145101_c1 3300050493 Bacteria 1413
449 nmdc:mga0k408_147623_c1 3300050493 Bacteria 1400
450 nmdc:mga0k408_33870_c1 3300050493 Bacteria 2923
451 nmdc:mga0k408_35248_c1 3300050493 Bacteria 2869
452 nmdc:mga06z11_102_c1 3300050494 Bacteria 36010
453 nmdc:mga04h51_15143_c1 3300050495 Bacteria 2218
454 nmdc:mga07m45_7_c1 3300050496 Bacteria 223540
455 nmdc:mga0n895_79350_c1 3300050512 Bacteria 3269
456 nmdc:mga08x19_182296_c1 3300050514 Bacteria 1434
457 nmdc:mga08x19_46588_c1 3300050514 Bacteria 2773
458 nmdc:mga08x19_57998_c1 3300050514 Bacteria 2504
459 nmdc:mga0sz30_607_c1 3300050516 Bacteria 13285
460 Ga0495601_0015379 3300053077 Bacteria 4625
461 Ga0495601_0017953 3300053077 Bacteria 4301
462 Ga0495601_0275005 3300053077 Bacteria 1098
463 Ga0495601_0317375 3300053077 Bacteria 1015
464 Ga0495595_0148203 3300053084 Bacteria 1154
465 Ga0495619_0269263 3300053085 Bacteria 1180
466 Ga0495619_0298822 3300053085 Bacteria 1115
467 Ga0500562_013413 3300053108 Bacteria 2093
468 Ga0500562_062371 3300053108 Bacteria 1002
469 Ga0500572_162871 3300053111 Bacteria 730
470 Ga0500595_005084 3300053119 Bacteria 5779
471 Ga0500607_000831 3300053121 Bacteria 29726
472 Ga0500658_0126297 3300053134 Bacteria 1137
473 Ga0500573_0168357 3300053140 Bacteria 1187
474 Ga0500619_006548 3300053154 Bacteria 2690
475 Ga0501084_0145961 3300054114 Bacteria 1993
476 Ga0587084_006131 3300059477 Bacteria 1447
477 Ga0587094_005308 3300059513 Bacteria 1499
478 Ga0587115_008824 3300059626 Bacteria 1223
479 Ga0587076_002888 3300059645 Bacteria 1983
480 Ga0587079_018791 3300059647 Bacteria 1216
481 Ga0587102_001164 3300059649 Bacteria 1766
482 Ga0587071_012671 3300060344 Bacteria 1442
483 Ga0587111_0005720 3300060346 Bacteria 1935
484 Ga0501082_0127999 3300060353 Bacteria 2203
485 Ga0501082_0384403 3300060353 Bacteria 1225
486 Ga0501082_0399418 3300060353 Bacteria 1200

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0127034 Ga0496125_0127034_420_980 182
2 3300039450 Ga0436363_1259682 Ga0436363_1259682_424_975 183
3 3300005347 Ga0070668_100191571 Ga0070668_1001915713 185
4 3300005548 Ga0070665_101298681 Ga0070665_1012986811 185
5 3300006042 Ga0075368_10002592 Ga0075368_100025926 185
6 3300006048 Ga0075363_100016345 Ga0075363_1000163453 185
7 3300014326 Ga0157380_10167222 Ga0157380_101672223 185
8 3300025972 Ga0207668_10150501 Ga0207668_101505013 185
9 3300035692 Ga0373935_0608364 Ga0373935_0608364_180_779 189
10 3300025925 Ga0207650_11025173 Ga0207650_110251731 191
11 3300044694 Ga0466963_0106468 Ga0466963_0106468_73_663 195
12 3300026095 Ga0207676_10528770 Ga0207676_105287702 196
13 3300046514 Ga0495618_0015107 Ga0495618_0015107_22_615 197
14 3300049586 Ga0501070_0556081 Ga0501070_0556081_305_904 199
15 3300005354 Ga0070675_101080061 Ga0070675_1010800611 203
16 3300005438 Ga0070701_10488840 Ga0070701_104888401 203
17 3300025931 Ga0207644_10483851 Ga0207644_104838512 203
18 3300026089 Ga0207648_10259121 Ga0207648_102591212 203
19 3300049823 Ga0501044_0386069 Ga0501044_0386069_25_639 204
20 3300053134 Ga0500658_0126297 Ga0500658_0126297_389_1003 204
21 iso_pu_bacteria 2896184354 2896186979 205
22 3300026089 Ga0207648_10707447 Ga0207648_107074471 206
23 3300048915 Ga0496112_0070157 Ga0496112_0070157_1182_1811 208
24 iso_pu_bacteria 2511231221 2512037357 208
25 iso_pu_bacteria 2597490356 2599101010 208
26 iso_pu_bacteria 8054002106 8054005642 208
27 3300005289 Ga0065704_10079012 Ga0065704_100790125 209
28 3300005331 Ga0070670_101199274 Ga0070670_1011992741 209
29 3300005347 Ga0070668_100008874 Ga0070668_1000088745 209
30 3300005353 Ga0070669_100008504 Ga0070669_1000085043 209
31 3300005355 Ga0070671_100006371 Ga0070671_1000063713 209
32 3300005367 Ga0070667_100207037 Ga0070667_1002070371 209
33 3300005548 Ga0070665_100000070 Ga0070665_10000007073 209
34 3300005841 Ga0068863_100001094 Ga0068863_10000109410 209
35 3300005842 Ga0068858_100308978 Ga0068858_1003089781 209
36 3300005844 Ga0068862_100037249 Ga0068862_1000372494 209
37 3300005985 Ga0081539_10013256 Ga0081539_100132565 209
38 3300006038 Ga0075365_10009056 Ga0075365_100090564 209
39 3300006042 Ga0075368_10000094 Ga0075368_1000009421 209
40 3300006048 Ga0075363_100004236 Ga0075363_1000042364 209
41 3300006051 Ga0075364_10080069 Ga0075364_100800692 209
42 3300006177 Ga0075362_10000681 Ga0075362_100006813 209
43 3300006178 Ga0075367_10005224 Ga0075367_100052245 209
44 3300006186 Ga0075369_10001385 Ga0075369_100013853 209
45 3300006195 Ga0075366_10034353 Ga0075366_100343533 209
46 3300006353 Ga0075370_10007345 Ga0075370_100073453 209
47 3300009011 Ga0105251_10005097 Ga0105251_100050975 209
48 3300009101 Ga0105247_10031708 Ga0105247_100317083 209
49 3300014326 Ga0157380_10717138 Ga0157380_107171382 209
50 3300025735 Ga0207713_1003159 Ga0207713_10031594 209
51 3300025923 Ga0207681_10002806 Ga0207681_100028068 209
52 3300025931 Ga0207644_10004490 Ga0207644_100044906 209
53 3300025941 Ga0207711_10003996 Ga0207711_100039965 209
54 3300025972 Ga0207668_10138914 Ga0207668_101389141 209
55 3300025986 Ga0207658_10009594 Ga0207658_100095946 209
56 3300026035 Ga0207703_10018509 Ga0207703_100185093 209
57 3300027866 Ga0209813_10000202 Ga0209813_100002023 209
58 3300028379 Ga0268266_10000202 Ga0268266_1000020248 209
59 3300028380 Ga0268265_10015138 Ga0268265_100151387 209
60 3300028381 Ga0268264_10012701 Ga0268264_100127017 209
61 3300031548 Ga0307408_100069009 Ga0307408_1000690093 209
62 3300031911 Ga0307412_10000182 Ga0307412_1000018213 209
63 3300031911 Ga0307412_10230733 Ga0307412_102307332 209
64 3300032002 Ga0307416_100097022 Ga0307416_1000970224 209
65 3300032004 Ga0307414_10000100 Ga0307414_1000010014 209
66 3300032004 Ga0307414_10967496 Ga0307414_109674961 209
67 3300042125 Ga0450923_026073 Ga0450923_026073_159_794 209
68 3300048904 Ga0496101_0233543 Ga0496101_0233543_296_928 209
69 3300048906 Ga0496103_0090983 Ga0496103_0090983_441_1082 209
70 3300048907 Ga0496104_0002291 Ga0496104_0002291_15435_16067 209
71 3300048907 Ga0496104_0073285 Ga0496104_0073285_628_1260 209
72 3300048913 Ga0496110_0453017 Ga0496110_0453017_102_734 209
73 3300048914 Ga0496111_0042358 Ga0496111_0042358_390_1022 209
74 3300048915 Ga0496112_0020327 Ga0496112_0020327_5113_5745 209
75 3300048916 Ga0496113_0117500 Ga0496113_0117500_1066_1698 209
76 3300048917 Ga0496114_0452253 Ga0496114_0452253_478_1110 209
77 3300048918 Ga0496115_0036935 Ga0496115_0036935_451_1083 209
78 3300048918 Ga0496115_0221739 Ga0496115_0221739_564_1196 209
79 3300048919 Ga0496116_0037787 Ga0496116_0037787_1445_2086 209
80 3300048920 Ga0496117_0064725 Ga0496117_0064725_1191_1832 209
81 3300048922 Ga0496119_0056687 Ga0496119_0056687_1348_1989 209
82 3300048922 Ga0496119_0069144 Ga0496119_0069144_1028_1660 209
83 3300048925 Ga0496122_0098399 Ga0496122_0098399_1197_1838 209
84 3300048926 Ga0496123_0173299 Ga0496123_0173299_23_664 209
85 3300048927 Ga0496124_0083672 Ga0496124_0083672_1610_2251 209
86 3300048927 Ga0496124_0198973 Ga0496124_0198973_367_1008 209
87 3300048928 Ga0496125_0023227 Ga0496125_0023227_825_1466 209
88 3300048929 Ga0496126_0024315 Ga0496126_0024315_4654_5295 209
89 3300048929 Ga0496126_0522614 Ga0496126_0522614_67_708 209
90 3300049571 Ga0501034_0097935 Ga0501034_0097935_1363_2025 209
91 3300049581 Ga0501047_0508585 Ga0501047_0508585_32_682 209
92 3300049649 Ga0501198_017973 Ga0501198_017973_390_1034 209
93 3300049663 Ga0501223_000309 Ga0501223_000309_9532_10176 209
94 3300049664 Ga0501224_000027 Ga0501224_000027_9532_10176 209
95 3300049668 Ga0501233_000078 Ga0501233_000078_3713_4357 209
96 3300049669 Ga0501235_002290 Ga0501235_002290_1073_1717 209
97 3300049705 Ga0501225_0000288 Ga0501225_0000288_5590_6234 209
98 3300049853 Ga0501226_000116 Ga0501226_000116_9532_10176 209
99 3300050489 nmdc:mga03683_170_c1 nmdc:mga03683_170_c1_809_1456 209
100 3300050490 nmdc:mga03n38_50662_c1 nmdc:mga03n38_50662_c1_42_689 209
101 3300050491 nmdc:mga00v17_19828_c1 nmdc:mga00v17_19828_c1_14_661 209
102 3300050491 nmdc:mga00v17_612647_c1 nmdc:mga00v17_612647_c1_42_689 209
103 3300050492 nmdc:mga0yw44_356940_c1 nmdc:mga0yw44_356940_c1_15_662 209
104 3300050493 nmdc:mga0k408_145101_c1 nmdc:mga0k408_145101_c1_555_1202 209
105 3300050494 nmdc:mga06z11_102_c1 nmdc:mga06z11_102_c1_4268_4915 209
106 3300050495 nmdc:mga04h51_15143_c1 nmdc:mga04h51_15143_c1_795_1442 209
107 3300050496 nmdc:mga07m45_7_c1 nmdc:mga07m45_7_c1_144395_145042 209
108 3300050516 nmdc:mga0sz30_607_c1 nmdc:mga0sz30_607_c1_11430_12077 209
109 3300053108 Ga0500562_062371 Ga0500562_062371_77_721 209
110 3300053121 Ga0500607_000831 Ga0500607_000831_10040_10714 209
111 3300005438 Ga0070701_10006946 Ga0070701_100069464 210
112 3300005439 Ga0070711_100141232 Ga0070711_1001412322 210
113 3300005471 Ga0070698_100178662 Ga0070698_1001786623 210
114 3300005549 Ga0070704_100124972 Ga0070704_1001249722 210
115 3300005563 Ga0068855_100023989 Ga0068855_1000239893 210
116 3300005617 Ga0068859_100019938 Ga0068859_1000199384 210
117 3300005618 Ga0068864_100913063 Ga0068864_1009130631 210
118 3300005842 Ga0068858_100179398 Ga0068858_1001793982 210
119 3300005844 Ga0068862_100198021 Ga0068862_1001980212 210
120 3300006237 Ga0097621_100733023 Ga0097621_1007330231 210
121 3300006931 Ga0097620_100019938 Ga0097620_1000199389 210
122 3300009093 Ga0105240_10617149 Ga0105240_106171492 210
123 3300009148 Ga0105243_10989364 Ga0105243_109893642 210
124 3300013307 Ga0157372_10036821 Ga0157372_100368217 210
125 3300025913 Ga0207695_10406332 Ga0207695_104063322 210
126 3300025935 Ga0207709_10546771 Ga0207709_105467712 210
127 3300025936 Ga0207670_10083821 Ga0207670_100838212 210
128 3300026035 Ga0207703_10008303 Ga0207703_100083032 210
129 3300026118 Ga0207675_100816367 Ga0207675_1008163672 210
130 3300028380 Ga0268265_10145283 Ga0268265_101452832 210
131 3300031901 Ga0307406_10421100 Ga0307406_104211002 210
132 3300032002 Ga0307416_100076222 Ga0307416_1000762224 210
133 3300035725 Ga0373947_0213261 Ga0373947_0213261_563_1195 210
134 3300042876 Ga0451577_0144831 Ga0451577_0144831_1107_1739 210
135 iso_pu_bacteria 2848858292 2848864221 210
136 3300005290 Ga0065712_10145043 Ga0065712_101450432 211
137 3300005327 Ga0070658_10001694 Ga0070658_1000169410 211
138 3300005327 Ga0070658_10247842 Ga0070658_102478422 211
139 3300005338 Ga0068868_100208319 Ga0068868_1002083192 211
140 3300005338 Ga0068868_100278029 Ga0068868_1002780292 211
141 3300005340 Ga0070689_100053438 Ga0070689_1000534385 211
142 3300005354 Ga0070675_100217554 Ga0070675_1002175541 211
143 3300005367 Ga0070667_101222812 Ga0070667_1012228121 211
144 3300005435 Ga0070714_100130753 Ga0070714_1001307532 211
145 3300005536 Ga0070697_100407121 Ga0070697_1004071212 211
146 3300005539 Ga0068853_100180489 Ga0068853_1001804892 211
147 3300005563 Ga0068855_100043509 Ga0068855_1000435097 211
148 3300005578 Ga0068854_100153628 Ga0068854_1001536282 211
149 3300005614 Ga0068856_100037745 Ga0068856_1000377454 211
150 3300005615 Ga0070702_100612163 Ga0070702_1006121632 211
151 3300005616 Ga0068852_100009489 Ga0068852_1000094891 211
152 3300005616 Ga0068852_100083374 Ga0068852_1000833743 211
153 3300005616 Ga0068852_100411847 Ga0068852_1004118472 211
154 3300005842 Ga0068858_100012022 Ga0068858_1000120223 211
155 3300006038 Ga0075365_10779899 Ga0075365_107798991 211
156 3300006237 Ga0097621_100020317 Ga0097621_1000203175 211
157 3300006237 Ga0097621_100024181 Ga0097621_1000241818 211
158 3300006237 Ga0097621_100327090 Ga0097621_1003270902 211
159 3300006353 Ga0075370_10362900 Ga0075370_103629001 211
160 3300007076 Ga0075435_100104637 Ga0075435_1001046374 211
161 3300009093 Ga0105240_10007874 Ga0105240_1000787415 211
162 3300009098 Ga0105245_10034031 Ga0105245_100340315 211
163 3300009147 Ga0114129_11215434 Ga0114129_112154342 211
164 3300009148 Ga0105243_10268404 Ga0105243_102684043 211
165 3300009174 Ga0105241_10030970 Ga0105241_100309702 211
166 3300009176 Ga0105242_10049730 Ga0105242_100497305 211
167 3300009177 Ga0105248_10277769 Ga0105248_102777693 211
168 3300009551 Ga0105238_10010811 Ga0105238_1001081112 211
169 3300013296 Ga0157374_10054473 Ga0157374_100544732 211
170 3300013297 Ga0157378_10046831 Ga0157378_100468312 211
171 3300013307 Ga0157372_10045441 Ga0157372_100454413 211
172 3300013308 Ga0157375_10329615 Ga0157375_103296153 211
173 3300013308 Ga0157375_11311185 Ga0157375_113111852 211
174 3300014325 Ga0163163_10902288 Ga0163163_109022881 211
175 3300014968 Ga0157379_10052935 Ga0157379_100529352 211
176 3300014969 Ga0157376_10812690 Ga0157376_108126901 211
177 3300025908 Ga0207643_10125507 Ga0207643_101255072 211
178 3300025913 Ga0207695_10038279 Ga0207695_100382793 211
179 3300025924 Ga0207694_10105824 Ga0207694_101058241 211
180 3300025926 Ga0207659_10181367 Ga0207659_101813673 211
181 3300025927 Ga0207687_10528340 Ga0207687_105283402 211
182 3300025929 Ga0207664_10279159 Ga0207664_102791592 211
183 3300025934 Ga0207686_10028897 Ga0207686_100288974 211
184 3300025934 Ga0207686_10560101 Ga0207686_105601011 211
185 3300025936 Ga0207670_10025761 Ga0207670_100257613 211
186 3300025936 Ga0207670_10278151 Ga0207670_102781512 211
187 3300025937 Ga0207669_10954808 Ga0207669_109548081 211
188 3300025940 Ga0207691_10004244 Ga0207691_100042449 211
189 3300025941 Ga0207711_10209090 Ga0207711_102090902 211
190 3300025949 Ga0207667_10011558 Ga0207667_100115586 211
191 3300025986 Ga0207658_11096636 Ga0207658_110966361 211
192 3300026023 Ga0207677_10411539 Ga0207677_104115392 211
193 3300026035 Ga0207703_10309430 Ga0207703_103094302 211
194 3300026075 Ga0207708_10816131 Ga0207708_108161311 211
195 3300026095 Ga0207676_10365834 Ga0207676_103658342 211
196 3300026118 Ga0207675_100956880 Ga0207675_1009568801 211
197 3300026121 Ga0207683_10168519 Ga0207683_101685193 211
198 3300026142 Ga0207698_10125963 Ga0207698_101259633 211
199 3300026142 Ga0207698_10272849 Ga0207698_102728492 211
200 3300031239 Ga0265328_10000118 Ga0265328_1000011818 211
201 3300031239 Ga0265328_10008424 Ga0265328_100084242 211
202 3300031239 Ga0265328_10023944 Ga0265328_100239442 211
203 3300031250 Ga0265331_10000005 Ga0265331_10000005244 211
204 3300032002 Ga0307416_100270039 Ga0307416_1002700392 211
205 3300035117 Ga0373953_0085245 Ga0373953_0085245_246_881 211
206 3300035119 Ga0373956_0028309 Ga0373956_0028309_1133_1768 211
207 3300035172 Ga0373955_0275003 Ga0373955_0275003_316_951 211
208 3300035410 Ga0373924_0096947 Ga0373924_0096947_200_835 211
209 3300035724 Ga0373933_0336499 Ga0373933_0336499_198_833 211
210 3300036401 Ga0373937_0221418 Ga0373937_0221418_813_1448 211
211 3300039437 Ga0436365_1538167 Ga0436365_1538167_1600_2235 211
212 3300041512 Ga0451853_1698836 Ga0451853_1698836_184_819 211
213 3300046454 Ga0495592_0189667 Ga0495592_0189667_322_957 211
214 3300046462 Ga0495651_0065823 Ga0495651_0065823_525_1160 211
215 3300046477 Ga0495664_0235327 Ga0495664_0235327_36_671 211
216 3300046516 Ga0495628_0122150 Ga0495628_0122150_545_1180 211
217 3300046536 Ga0495587_0026999 Ga0495587_0026999_1410_2045 211
218 3300046543 Ga0495645_0002548 Ga0495645_0002548_5053_5688 211
219 3300046559 Ga0495667_0096381 Ga0495667_0096381_1052_1687 211
220 3300046675 Ga0495657_0034098 Ga0495657_0034098_2549_3184 211
221 3300046678 Ga0495599_0039850 Ga0495599_0039850_1357_1992 211
222 3300046679 Ga0495623_0054356 Ga0495623_0054356_675_1310 211
223 3300046689 Ga0495613_0412529 Ga0495613_0412529_233_868 211
224 3300046809 Ga0495600_0046686 Ga0495600_0046686_1891_2526 211
225 3300048913 Ga0496110_0070108 Ga0496110_0070108_1833_2468 211
226 3300049577 Ga0501041_0306867 Ga0501041_0306867_121_759 211
227 3300049582 Ga0501048_0211645 Ga0501048_0211645_95_733 211
228 3300049592 Ga0501076_0045140 Ga0501076_0045140_1543_2181 211
229 3300049593 Ga0501077_0168547 Ga0501077_0168547_129_767 211
230 3300049741 Ga0501079_0030626 Ga0501079_0030626_3338_3976 211
231 3300049824 Ga0501045_0102136 Ga0501045_0102136_523_1161 211
232 3300050491 nmdc:mga00v17_295899_c1 nmdc:mga00v17_295899_c1_395_1030 211
233 3300050492 nmdc:mga0yw44_429724_c1 nmdc:mga0yw44_429724_c1_242_877 211
234 3300050493 nmdc:mga0k408_147623_c1 nmdc:mga0k408_147623_c1_735_1370 211
235 3300050493 nmdc:mga0k408_35248_c1 nmdc:mga0k408_35248_c1_1281_1922 211
236 3300050514 nmdc:mga08x19_57998_c1 nmdc:mga08x19_57998_c1_76_711 211
237 3300053077 Ga0495601_0015379 Ga0495601_0015379_396_1031 211
238 3300053085 Ga0495619_0298822 Ga0495619_0298822_47_682 211
239 iso_pu_bacteria 2939631187 2939634008 211
240 3300003763 Ga0055529_1001100 Ga0055529_100110010 212
241 3300005331 Ga0070670_100076600 Ga0070670_1000766002 212
242 3300005335 Ga0070666_10419944 Ga0070666_104199441 212
243 3300005347 Ga0070668_100238396 Ga0070668_1002383962 212
244 3300005434 Ga0070709_10123502 Ga0070709_101235022 212
245 3300005435 Ga0070714_100244405 Ga0070714_1002444052 212
246 3300005436 Ga0070713_100028787 Ga0070713_1000287873 212
247 3300005436 Ga0070713_100318664 Ga0070713_1003186642 212
248 3300005436 Ga0070713_100361150 Ga0070713_1003611501 212
249 3300005539 Ga0068853_100259317 Ga0068853_1002593172 212
250 3300005545 Ga0070695_100312074 Ga0070695_1003120741 212
251 3300005546 Ga0070696_100086338 Ga0070696_1000863383 212
252 3300005563 Ga0068855_100335585 Ga0068855_1003355852 212
253 3300005578 Ga0068854_100427728 Ga0068854_1004277282 212
254 3300005614 Ga0068856_100406864 Ga0068856_1004068642 212
255 3300005843 Ga0068860_100301011 Ga0068860_1003010111 212
256 3300006028 Ga0070717_10353393 Ga0070717_103533932 212
257 3300006051 Ga0075364_10081219 Ga0075364_100812192 212
258 3300006186 Ga0075369_10002009 Ga0075369_100020099 212
259 3300006914 Ga0075436_100065027 Ga0075436_1000650272 212
260 3300007788 Ga0099795_10041242 Ga0099795_100412422 212
261 3300009093 Ga0105240_10011007 Ga0105240_1001100712 212
262 3300009148 Ga0105243_10301428 Ga0105243_103014282 212
263 3300009176 Ga0105242_11239346 Ga0105242_112393461 212
264 3300009545 Ga0105237_10017969 Ga0105237_100179693 212
265 3300014497 Ga0182008_10025832 Ga0182008_100258322 212
266 3300025898 Ga0207692_10118289 Ga0207692_101182891 212
267 3300025906 Ga0207699_10035819 Ga0207699_100358192 212
268 3300025907 Ga0207645_10105765 Ga0207645_101057652 212
269 3300025913 Ga0207695_10249864 Ga0207695_102498642 212
270 3300025914 Ga0207671_10151632 Ga0207671_101516322 212
271 3300025933 Ga0207706_10187321 Ga0207706_101873213 212
272 3300025935 Ga0207709_10672917 Ga0207709_106729171 212
273 3300025945 Ga0207679_11022809 Ga0207679_110228091 212
274 3300026041 Ga0207639_10798830 Ga0207639_107988301 212
275 3300026078 Ga0207702_10218777 Ga0207702_102187772 212
276 3300032004 Ga0307414_10191622 Ga0307414_101916222 212
277 3300035691 Ga0373931_0041808 Ga0373931_0041808_1746_2387 212
278 3300035695 Ga0373927_0011165 Ga0373927_0011165_2222_2860 212
279 3300045051 Ga0451576_0264257 Ga0451576_0264257_510_1148 212
280 3300045051 Ga0451576_0660500 Ga0451576_0660500_243_881 212
281 3300046455 Ga0495603_0095202 Ga0495603_0095202_948_1589 212
282 3300046472 Ga0495580_0178819 Ga0495580_0178819_498_1136 212
283 3300046539 Ga0495621_0181222 Ga0495621_0181222_174_812 212
284 3300048907 Ga0496104_0000132 Ga0496104_0000132_13661_14302 212
285 3300048907 Ga0496104_0082220 Ga0496104_0082220_1473_2114 212
286 3300048908 Ga0496105_0053521 Ga0496105_0053521_2647_3288 212
287 3300048908 Ga0496105_0338356 Ga0496105_0338356_329_970 212
288 3300048911 Ga0496108_0045274 Ga0496108_0045274_2954_3595 212
289 3300048912 Ga0496109_0045366 Ga0496109_0045366_1276_1917 212
290 3300048913 Ga0496110_0002182 Ga0496110_0002182_9514_10155 212
291 3300048913 Ga0496110_0174813 Ga0496110_0174813_1294_1935 212
292 3300048914 Ga0496111_0558604 Ga0496111_0558604_88_729 212
293 3300048916 Ga0496113_0001546 Ga0496113_0001546_1165_1806 212
294 3300050489 nmdc:mga03683_190111_c1 nmdc:mga03683_190111_c1_211_852 212
295 3300050493 nmdc:mga0k408_33870_c1 nmdc:mga0k408_33870_c1_67_705 212
296 3300050514 nmdc:mga08x19_182296_c1 nmdc:mga08x19_182296_c1_514_1152 212
297 3300053108 Ga0500562_013413 Ga0500562_013413_478_1140 212
298 3300002774 JGI25150J39212_1008313 JGI25150J39212_10083131 213
299 3300005336 Ga0070680_100178168 Ga0070680_1001781681 213
300 3300005336 Ga0070680_100443206 Ga0070680_1004432061 213
301 3300005340 Ga0070689_100143623 Ga0070689_1001436232 213
302 3300005344 Ga0070661_100266265 Ga0070661_1002662652 213
303 3300005347 Ga0070668_100031641 Ga0070668_1000316413 213
304 3300005347 Ga0070668_100587731 Ga0070668_1005877311 213
305 3300005353 Ga0070669_100213043 Ga0070669_1002130432 213
306 3300005353 Ga0070669_100829778 Ga0070669_1008297781 213
307 3300005355 Ga0070671_100904867 Ga0070671_1009048671 213
308 3300005434 Ga0070709_10316702 Ga0070709_103167021 213
309 3300005435 Ga0070714_100022875 Ga0070714_1000228757 213
310 3300005445 Ga0070708_100028943 Ga0070708_1000289437 213
311 3300005455 Ga0070663_100460565 Ga0070663_1004605652 213
312 3300005458 Ga0070681_10012832 Ga0070681_100128323 213
313 3300005458 Ga0070681_10047196 Ga0070681_100471964 213
314 3300005459 Ga0068867_100910651 Ga0068867_1009106511 213
315 3300005467 Ga0070706_100060660 Ga0070706_1000606604 213
316 3300005468 Ga0070707_100082657 Ga0070707_1000826571 213
317 3300005471 Ga0070698_100023134 Ga0070698_1000231348 213
318 3300005518 Ga0070699_100080526 Ga0070699_1000805264 213
319 3300005530 Ga0070679_100008089 Ga0070679_1000080899 213
320 3300005530 Ga0070679_100097318 Ga0070679_1000973183 213
321 3300005536 Ga0070697_100498422 Ga0070697_1004984221 213
322 3300005545 Ga0070695_100600416 Ga0070695_1006004161 213
323 3300005546 Ga0070696_100478584 Ga0070696_1004785842 213
324 3300005563 Ga0068855_100479896 Ga0068855_1004798961 213
325 3300005563 Ga0068855_100600859 Ga0068855_1006008592 213
326 3300005564 Ga0070664_100034119 Ga0070664_1000341194 213
327 3300005577 Ga0068857_100128437 Ga0068857_1001284372 213
328 3300005614 Ga0068856_100003325 Ga0068856_1000033253 213
329 3300006173 Ga0070716_100061063 Ga0070716_1000610632 213
330 3300006871 Ga0075434_100078301 Ga0075434_1000783013 213
331 3300006914 Ga0075436_100032173 Ga0075436_1000321732 213
332 3300007076 Ga0075435_100072442 Ga0075435_1000724422 213
333 3300009098 Ga0105245_10794913 Ga0105245_107949131 213
334 3300009147 Ga0114129_10541051 Ga0114129_105410512 213
335 3300009174 Ga0105241_10089214 Ga0105241_100892142 213
336 3300012513 Ga0157326_1002540 Ga0157326_10025402 213
337 3300013100 Ga0157373_10077649 Ga0157373_100776493 213
338 3300013104 Ga0157370_10112381 Ga0157370_101123813 213
339 3300013105 Ga0157369_10391577 Ga0157369_103915772 213
340 3300013297 Ga0157378_10936094 Ga0157378_109360942 213
341 3300013307 Ga0157372_10063295 Ga0157372_100632952 213
342 3300013307 Ga0157372_10259244 Ga0157372_102592442 213
343 3300021377 Ga0213874_10045859 Ga0213874_100458591 213
344 3300021377 Ga0213874_10061997 Ga0213874_100619971 213
345 3300021388 Ga0213875_10184059 Ga0213875_101840592 213
346 3300021441 Ga0213871_10031457 Ga0213871_100314571 213
347 3300025263 Ga0209565_1013585 Ga0209565_10135851 213
348 3300025291 Ga0209675_1031116 Ga0209675_10311162 213
349 3300025295 Ga0209564_1000823 Ga0209564_100082312 213
350 3300025911 Ga0207654_10096125 Ga0207654_100961252 213
351 3300025912 Ga0207707_10013313 Ga0207707_100133133 213
352 3300025912 Ga0207707_10068931 Ga0207707_100689313 213
353 3300025917 Ga0207660_10045308 Ga0207660_100453083 213
354 3300025917 Ga0207660_10140932 Ga0207660_101409323 213
355 3300025920 Ga0207649_10241863 Ga0207649_102418632 213
356 3300025921 Ga0207652_10009141 Ga0207652_100091414 213
357 3300025921 Ga0207652_10138820 Ga0207652_101388203 213
358 3300025929 Ga0207664_10249530 Ga0207664_102495302 213
359 3300025945 Ga0207679_10172122 Ga0207679_101721222 213
360 3300025949 Ga0207667_10112261 Ga0207667_101122613 213
361 3300025949 Ga0207667_10119726 Ga0207667_101197263 213
362 3300025972 Ga0207668_10130826 Ga0207668_101308262 213
363 3300026041 Ga0207639_10164006 Ga0207639_101640062 213
364 3300026078 Ga0207702_10002576 Ga0207702_1000257616 213
365 3300026088 Ga0207641_10422948 Ga0207641_104229482 213
366 3300026116 Ga0207674_10100791 Ga0207674_101007913 213
367 3300031824 Ga0307413_10177026 Ga0307413_101770262 213
368 3300031852 Ga0307410_10100515 Ga0307410_101005152 213
369 3300031901 Ga0307406_10118280 Ga0307406_101182802 213
370 3300031995 Ga0307409_100009836 Ga0307409_1000098364 213
371 3300031995 Ga0307409_100165703 Ga0307409_1001657032 213
372 3300031995 Ga0307409_100398917 Ga0307409_1003989172 213
373 3300032002 Ga0307416_100012620 Ga0307416_1000126203 213
374 3300032004 Ga0307414_10522967 Ga0307414_105229672 213
375 3300032005 Ga0307411_10257054 Ga0307411_102570542 213
376 3300032126 Ga0307415_100023780 Ga0307415_1000237804 213
377 3300036401 Ga0373937_0275211 Ga0373937_0275211_502_1143 213
378 3300036401 Ga0373937_0580552 Ga0373937_0580552_223_864 213
379 3300037853 Ga0436364_0030853 Ga0436364_0030853_4049_4690 213
380 3300039437 Ga0436365_0040252 Ga0436365_0040252_1418_2059 213
381 3300046543 Ga0495645_0059663 Ga0495645_0059663_841_1482 213
382 3300049568 Ga0501031_0203125 Ga0501031_0203125_133_783 213
383 3300049571 Ga0501034_0011544 Ga0501034_0011544_8011_8661 213
384 3300049571 Ga0501034_0028364 Ga0501034_0028364_3067_3708 213
385 3300049573 Ga0501037_0173349 Ga0501037_0173349_645_1295 213
386 3300049577 Ga0501041_0132662 Ga0501041_0132662_783_1424 213
387 3300049586 Ga0501070_0474767 Ga0501070_0474767_336_977 213
388 3300049586 Ga0501070_0586823 Ga0501070_0586823_82_723 213
389 3300049588 Ga0501072_0618864 Ga0501072_0618864_22_663 213
390 3300049589 Ga0501073_0019290 Ga0501073_0019290_129_770 213
391 3300049742 Ga0501080_0000772 Ga0501080_0000772_13120_13761 213
392 3300049742 Ga0501080_0357871 Ga0501080_0357871_607_1248 213
393 3300049744 Ga0501083_0002315 Ga0501083_0002315_11747_12388 213
394 3300049822 Ga0501035_0143882 Ga0501035_0143882_271_912 213
395 3300049824 Ga0501045_0519428 Ga0501045_0519428_142_783 213
396 3300050512 nmdc:mga0n895_79350_c1 nmdc:mga0n895_79350_c1_1528_2172 213
397 3300050514 nmdc:mga08x19_46588_c1 nmdc:mga08x19_46588_c1_356_1000 213
398 3300053077 Ga0495601_0317375 Ga0495601_0317375_258_899 213
399 3300053084 Ga0495595_0148203 Ga0495595_0148203_49_690 213
400 3300054114 Ga0501084_0145961 Ga0501084_0145961_1178_1819 213
401 3300060353 Ga0501082_0127999 Ga0501082_0127999_129_770 213
402 3300060353 Ga0501082_0384403 Ga0501082_0384403_93_734 213
403 3300060353 Ga0501082_0399418 Ga0501082_0399418_501_1142 213
404 3300003323 rootH1_10189855 rootH1_101898552 214
405 3300005337 Ga0070682_100071718 Ga0070682_1000717182 214
406 3300005356 Ga0070674_100267465 Ga0070674_1002674651 214
407 3300006175 Ga0070712_100003321 Ga0070712_1000033215 214
408 3300006358 Ga0068871_100277689 Ga0068871_1002776891 214
409 3300021377 Ga0213874_10069911 Ga0213874_100699112 214
410 3300025915 Ga0207693_10012704 Ga0207693_100127042 214
411 3300036401 Ga0373937_0445458 Ga0373937_0445458_392_1036 214
412 3300039450 Ga0436363_1296752 Ga0436363_1296752_1266_1922 214
413 3300046663 Ga0495635_0166861 Ga0495635_0166861_310_954 214
414 3300053085 Ga0495619_0269263 Ga0495619_0269263_232_876 214
415 3300021361 Ga0213872_10041602 Ga0213872_100416021 216
416 iso_pu_bacteria 2818991436 2819544396 216
417 3300037312 Ga0395899_0038076 Ga0395899_0038076_2703_3359 218
418 3300037418 Ga0395900_0039635 Ga0395900_0039635_4112_4771 218
419 3300037418 Ga0395900_0176543 Ga0395900_0176543_1365_2021 218
420 3300037466 Ga0395898_0259463 Ga0395898_0259463_90_746 218
421 3300037471 Ga0395905_0012162 Ga0395905_0012162_7591_8250 218
422 3300038443 Ga0395901_0004958 Ga0395901_0004958_9891_10547 218
423 3300038443 Ga0395901_0203922 Ga0395901_0203922_77_733 218
424 3300059477 Ga0587084_006131 Ga0587084_006131_522_1181 218
425 3300059513 Ga0587094_005308 Ga0587094_005308_717_1376 218
426 3300059626 Ga0587115_008824 Ga0587115_008824_30_689 218
427 3300059645 Ga0587076_002888 Ga0587076_002888_533_1192 218
428 3300059647 Ga0587079_018791 Ga0587079_018791_287_946 218
429 3300059649 Ga0587102_001164 Ga0587102_001164_1071_1730 218
430 3300060344 Ga0587071_012671 Ga0587071_012671_715_1374 218
431 3300060346 Ga0587111_0005720 Ga0587111_0005720_732_1391 218
432 iso_pu_bacteria 2643221603 2644030392 218
433 3300021361 Ga0213872_10052258 Ga0213872_100522583 219
434 3300025250 Ga0209026_1001428 Ga0209026_10014289 219
435 3300039447 Ga0436361_0390380 Ga0436361_0390380_1813_2472 219
436 3300046528 Ga0495642_0071142 Ga0495642_0071142_238_903 219
437 3300046539 Ga0495621_0034821 Ga0495621_0034821_963_1628 219
438 3300048905 Ga0496102_0078484 Ga0496102_0078484_768_1433 219
439 3300048906 Ga0496103_0094585 Ga0496103_0094585_378_1043 219
440 3300048907 Ga0496104_0565115 Ga0496104_0565115_167_832 219
441 3300048911 Ga0496108_0052653 Ga0496108_0052653_2487_3152 219
442 3300048917 Ga0496114_0285690 Ga0496114_0285690_637_1302 219
443 3300002737 JGI25162J39368_1000268 JGI25162J39368_100026834 220
444 3300003214 JGI25165J46597_1000270 JGI25165J46597_100027024 220
445 3300003751 Ga0055538_1000105 Ga0055538_100010524 220
446 3300003752 Ga0055539_1000153 Ga0055539_100015324 220
447 3300003756 Ga0055533_1000155 Ga0055533_100015524 220
448 3300003759 Ga0055525_1000208 Ga0055525_100020833 220
449 3300003841 Ga0055541_1000102 Ga0055541_100010224 220
450 3300014497 Ga0182008_10059363 Ga0182008_100593632 220
451 3300014497 Ga0182008_10086857 Ga0182008_100868572 220
452 3300015261 Ga0182006_1021149 Ga0182006_10211492 220
453 3300015262 Ga0182007_10001140 Ga0182007_1000114012 220
454 3300015262 Ga0182007_10009543 Ga0182007_100095432 220
455 3300015265 Ga0182005_1002993 Ga0182005_10029932 220
456 3300025207 Ga0209760_106452 Ga0209760_1064522 220
457 3300025224 Ga0209784_100027 Ga0209784_100027327 220
458 3300025225 Ga0209566_100027 Ga0209566_100027327 220
459 3300025226 Ga0209674_100044 Ga0209674_100044327 220
460 3300025230 Ga0209563_100048 Ga0209563_100048327 220
461 3300025231 Ga0207427_101706 Ga0207427_1017065 220
462 3300025233 Ga0209437_100055 Ga0209437_100055327 220
463 3300025253 Ga0209677_100028 Ga0209677_100028327 220
464 3300025261 Ga0209233_1000070 Ga0209233_1000070327 220
465 3300046454 Ga0495592_0135391 Ga0495592_0135391_704_1366 220
466 3300046462 Ga0495651_0003016 Ga0495651_0003016_1447_2109 220
467 3300046462 Ga0495651_0104831 Ga0495651_0104831_765_1427 220
468 3300046463 Ga0495653_0007466 Ga0495653_0007466_1871_2533 220
469 3300046511 Ga0495608_0002589 Ga0495608_0002589_7957_8619 220
470 3300046511 Ga0495608_0004160 Ga0495608_0004160_469_1131 220
471 3300046516 Ga0495628_0003134 Ga0495628_0003134_12625_13287 220
472 3300046516 Ga0495628_0090090 Ga0495628_0090090_367_1029 220
473 3300046516 Ga0495628_0272599 Ga0495628_0272599_80_742 220
474 3300046529 Ga0495652_0005368 Ga0495652_0005368_10549_11211 220
475 3300046529 Ga0495652_0011385 Ga0495652_0011385_2905_3567 220
476 3300046529 Ga0495652_0080422 Ga0495652_0080422_182_844 220
477 3300046543 Ga0495645_0006452 Ga0495645_0006452_2539_3201 220
478 3300046663 Ga0495635_0026819 Ga0495635_0026819_393_1055 220
479 3300046675 Ga0495657_0015573 Ga0495657_0015573_3672_4334 220
480 3300046678 Ga0495599_0002549 Ga0495599_0002549_7151_7813 220
481 3300046679 Ga0495623_0001599 Ga0495623_0001599_11061_11723 220
482 3300046679 Ga0495623_0050081 Ga0495623_0050081_932_1594 220
483 3300046680 Ga0495646_0002324 Ga0495646_0002324_5674_6336 220
484 3300046683 Ga0495658_0032746 Ga0495658_0032746_309_971 220
485 3300046809 Ga0495600_0008340 Ga0495600_0008340_3861_4523 220
486 3300047317 Ga0495604_0006395 Ga0495604_0006395_2870_3532 220
487 3300048088 Ga0495602_0029613 Ga0495602_0029613_121_783 220
488 3300048088 Ga0495602_0058135 Ga0495602_0058135_982_1644 220
489 3300053077 Ga0495601_0017953 Ga0495601_0017953_504_1166 220
490 3300053077 Ga0495601_0275005 Ga0495601_0275005_398_1060 220
491 3300053111 Ga0500572_162871 Ga0500572_162871_14_676 220
492 3300053119 Ga0500595_005084 Ga0500595_005084_135_797 220
493 3300053140 Ga0500573_0168357 Ga0500573_0168357_157_819 220
494 3300053154 Ga0500619_006548 Ga0500619_006548_557_1219 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

12

93

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

21

94

0.91

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

16

99

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9766 1 219
2cz2-assembly1.cif.gz_A-2 crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal) 0.9758 2 220
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9721 1 219
8e8p-assembly1.cif.gz_B gstz1a 0.9697 2 220
4pxo-assembly1.cif.gz_B crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) 0.9697 1 220
ID Description Score Start End Superfamily
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9899 4 84 3.40.30.10
2cz2A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9765 4 84 3.40.30.10
2v6kB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9731 90 219 1.20.1050.10
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9708 2 81 3.40.30.10
2v6kB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9658 90 219 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A0M9I1N3-F1-model_v4 deleted 0.9947 1 219
AF-A0A4R6F2N1-F1-model_v4 Maleylacetoacetate isomerase 0.9946 2 219 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A0Q4H1E7-F1-model_v4 Maleylacetoacetate isomerase 0.9938 1 219 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A6J5FNF1-F1-model_v4 deleted 0.9936 1 219
AF-A2VVB5-F1-model_v4 deleted 0.9933 2 219

Feature Viewer

pLDDT pTM Quality
96.39 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map