F454637

General Info

Members Datasets Scaffolds Average Seq Length
494 277 494 162

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0193363|Ga0501036_0193363_558_1106
Length 182
Sequence MIERMLHGGAANSAEDFMAISVGDKLPQHTFTTIGGEGPEPITTADVFAGKKVALFAVPGAYTPTCHQQHMPGFVSRLGDLAAKGIDTVACTAVNDIFVLQNWAKDTGALGKVVMLADGSAEFARKIGLDIDLTTRGLGVRSKRYAMLVEDGVVKVLNVEDAPPQHDRSSAATLCSMIDYAI

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
141 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
142 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
162 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
183 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
250 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
271 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
272 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
273 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.12
Nodule 0
Rhizoplane 9.11
Rhizosphere 78.95
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1011792 3300000546 Bacteria 931
2 JGI25405J52794_10034275 3300003911 Bacteria 1061
3 Ga0058861_11445454 3300004800 Bacteria 674
4 Ga0070658_10034310 3300005327 Bacteria 4083
5 Ga0070676_10003900 3300005328 Bacteria 7828
6 Ga0070676_10393138 3300005328 Bacteria 963
7 Ga0070676_10524868 3300005328 Bacteria 844
8 Ga0070676_10863177 3300005328 Bacteria 672
9 Ga0068869_100043663 3300005334 Bacteria 3221
10 Ga0068869_100429567 3300005334 Bacteria 1091
11 Ga0068869_100571923 3300005334 Bacteria 952
12 Ga0070680_100012963 3300005336 Bacteria 6484
13 Ga0070680_100042194 3300005336 Bacteria 3700
14 Ga0070682_100008980 3300005337 Bacteria 5648
15 Ga0070660_100039356 3300005339 Bacteria 3593
16 Ga0070687_100244839 3300005343 Bacteria 1111
17 Ga0070661_100462794 3300005344 Bacteria 1010
18 Ga0070692_10375646 3300005345 Bacteria 890
19 Ga0070668_100223682 3300005347 Bacteria 1553
20 Ga0070668_100265860 3300005347 Bacteria 1428
21 Ga0070668_101236339 3300005347 Bacteria 677
22 Ga0070675_100622145 3300005354 Bacteria 980
23 Ga0070674_100883085 3300005356 Bacteria 778
24 Ga0070688_100574285 3300005365 Bacteria 860
25 Ga0070659_100042196 3300005366 Bacteria 3566
26 Ga0070659_100886943 3300005366 Bacteria 779
27 Ga0070667_100398586 3300005367 Bacteria 1252
28 Ga0070703_10001032 3300005406 Bacteria 8712
29 Ga0070709_10513181 3300005434 Bacteria 912
30 Ga0070713_100127292 3300005436 Unclassified 2242
31 Ga0070701_10210988 3300005438 Bacteria 1153
32 Ga0070711_100206967 3300005439 Unclassified 1517
33 Ga0070711_100412875 3300005439 Bacteria 1098
34 Ga0070705_100000057 3300005440 Bacteria 58275
35 Ga0070705_100020481 3300005440 Bacteria 3502
36 Ga0070700_100024128 3300005441 Bacteria 3567
37 Ga0070700_100229525 3300005441 Bacteria 1320
38 Ga0070700_100512875 3300005441 Bacteria 925
39 Ga0070700_101185888 3300005441 Bacteria 637
40 Ga0070694_100101889 3300005444 Bacteria 2032
41 Ga0070708_100010655 3300005445 Bacteria 7456
42 Ga0070708_100181252 3300005445 Bacteria 1969
43 Ga0070663_100006259 3300005455 Bacteria 7138
44 Ga0070663_100839884 3300005455 Bacteria 790
45 Ga0070662_100445574 3300005457 Bacteria 1074
46 Ga0070662_100758756 3300005457 Bacteria 823
47 Ga0070662_101264619 3300005457 Bacteria 635
48 Ga0070681_10001360 3300005458 Bacteria 21379
49 Ga0070681_10054060 3300005458 Bacteria 4001
50 Ga0068867_100409284 3300005459 Bacteria 1146
51 Ga0068867_100717525 3300005459 Bacteria 884
52 Ga0070707_100011550 3300005468 Bacteria 8236
53 Ga0070698_100172967 3300005471 Bacteria 2100
54 Ga0070699_100000158 3300005518 Bacteria 64029
55 Ga0070679_100053846 3300005530 Bacteria 4006
56 Ga0070697_100142163 3300005536 Bacteria 2019
57 Ga0068853_100003714 3300005539 Bacteria 11721
58 Ga0070672_100422353 3300005543 Bacteria 1145
59 Ga0070695_100000439 3300005545 Bacteria 21648
60 Ga0070695_100073683 3300005545 Bacteria 2242
61 Ga0070695_100352627 3300005545 Bacteria 1103
62 Ga0070696_100009530 3300005546 Bacteria 6500
63 Ga0070696_100012791 3300005546 Bacteria 5635
64 Ga0070696_100042585 3300005546 Bacteria 3138
65 Ga0070693_100003679 3300005547 Bacteria 7168
66 Ga0070693_100866716 3300005547 Bacteria 674
67 Ga0070665_100319489 3300005548 Bacteria 1557
68 Ga0070665_101437852 3300005548 Bacteria 698
69 Ga0070665_102140687 3300005548 Bacteria 564
70 Ga0070704_100000383 3300005549 Bacteria 20192
71 Ga0070704_100066322 3300005549 Bacteria 2602
72 Ga0070704_100833917 3300005549 Bacteria 826
73 Ga0068855_100272718 3300005563 Bacteria 1881
74 Ga0068855_101251822 3300005563 Bacteria 770
75 Ga0068857_100017152 3300005577 Bacteria 6343
76 Ga0068857_100063586 3300005577 Bacteria 3281
77 Ga0070702_100048377 3300005615 Bacteria 2420
78 Ga0070702_100061875 3300005615 Bacteria 2181
79 Ga0068852_100109599 3300005616 Bacteria 2508
80 Ga0068859_100004801 3300005617 Bacteria 13760
81 Ga0068864_100215544 3300005618 Bacteria 1770
82 Ga0068861_100135274 3300005719 Bacteria 2005
83 Ga0068861_100156077 3300005719 Bacteria 1878
84 Ga0068861_100197926 3300005719 Bacteria 1685
85 Ga0068861_101320587 3300005719 Bacteria 702
86 Ga0068851_10061132 3300005834 Bacteria 1930
87 Ga0068870_10167215 3300005840 Bacteria 1309
88 Ga0068858_100133314 3300005842 Bacteria 2330
89 Ga0068860_100035993 3300005843 Bacteria 4746
90 Ga0068860_100164644 3300005843 Bacteria 2140
91 Ga0068862_100001821 3300005844 Bacteria 19311
92 Ga0068862_101058162 3300005844 Bacteria 805
93 Ga0081455_10009824 3300005937 Bacteria 9800
94 Ga0081455_10482649 3300005937 Bacteria 837
95 Ga0081540_1000165 3300005983 Bacteria 68435
96 Ga0081540_1000873 3300005983 Bacteria 27254
97 Ga0075365_10014899 3300006038 Bacteria 4687
98 Ga0075365_10047112 3300006038 Bacteria 2833
99 Ga0075365_10091608 3300006038 Bacteria 2072
100 Ga0075365_10680443 3300006038 Unclassified 727
101 Ga0075368_10008257 3300006042 Bacteria 3701
102 Ga0075368_10019000 3300006042 Bacteria 2590
103 Ga0075363_100003941 3300006048 Bacteria 6409
104 Ga0075363_100016578 3300006048 Bacteria 3641
105 Ga0075363_100074091 3300006048 Bacteria 1853
106 Ga0075363_100124002 3300006048 Bacteria 1445
107 Ga0075363_100339105 3300006048 Bacteria 876
108 Ga0075364_10009087 3300006051 Bacteria 5952
109 Ga0070716_100623214 3300006173 Unclassified 814
110 Ga0075362_10169736 3300006177 Bacteria 1053
111 Ga0075367_10007360 3300006178 Bacteria 5629
112 Ga0075367_10129049 3300006178 Bacteria 1562
113 Ga0075369_10134750 3300006186 Bacteria 1124
114 Ga0075370_10719393 3300006353 Bacteria 607
115 Ga0075428_100003086 3300006844 Bacteria 18176
116 Ga0075428_100173041 3300006844 Bacteria 2340
117 Ga0075430_100046367 3300006846 Bacteria 3671
118 Ga0075431_100016100 3300006847 Bacteria 7586
119 Ga0075431_100026132 3300006847 Bacteria 5988
120 Ga0075433_10005783 3300006852 Bacteria 9734
121 Ga0075433_10727296 3300006852 Bacteria 869
122 Ga0075434_100055224 3300006871 Bacteria 3946
123 Ga0075434_100562246 3300006871 Bacteria 1160
124 Ga0068865_100127167 3300006881 Bacteria 1904
125 Ga0068865_100455148 3300006881 Bacteria 1059
126 Ga0097620_100004801 3300006931 Bacteria 13760
127 Ga0075435_100009318 3300007076 Bacteria 7100
128 Ga0099794_10177815 3300007265 Unclassified 1086
129 Ga0099794_10266434 3300007265 Bacteria 885
130 Ga0099795_10325785 3300007788 Bacteria 681
131 Ga0111539_10007284 3300009094 Bacteria 14165
132 Ga0111539_10095202 3300009094 Bacteria 3498
133 Ga0111539_10190885 3300009094 Bacteria 2390
134 Ga0111539_10219011 3300009094 Bacteria 2217
135 Ga0111539_12140740 3300009094 Bacteria 649
136 Ga0105247_10455656 3300009101 Bacteria 923
137 Ga0114129_10061159 3300009147 Bacteria 5264
138 Ga0114129_10369823 3300009147 Bacteria 1895
139 Ga0105243_10236470 3300009148 Bacteria 1623
140 Ga0105243_10260798 3300009148 Bacteria 1551
141 Ga0105241_10091409 3300009174 Bacteria 2401
142 Ga0105241_11272778 3300009174 Bacteria 699
143 Ga0105248_10083978 3300009177 Bacteria 3582
144 Ga0105237_10004832 3300009545 Bacteria 15478
145 Ga0105237_11059025 3300009545 Bacteria 818
146 Ga0105237_12089590 3300009545 Bacteria 575
147 Ga0105238_10608827 3300009551 Bacteria 1101
148 Ga0105249_10308927 3300009553 Bacteria 1589
149 Ga0105249_10369753 3300009553 Bacteria 1457
150 Ga0099796_10164801 3300010159 Bacteria 881
151 Ga0105239_10131194 3300010375 Bacteria 2787
152 Ga0105239_10510003 3300010375 Bacteria 1368
153 Ga0105239_10541082 3300010375 Bacteria 1326
154 Ga0105239_10733482 3300010375 Bacteria 1130
155 Ga0105246_10294155 3300011119 Unclassified 1308
156 Ga0105246_10322668 3300011119 Bacteria 1256
157 Ga0157378_11451519 3300013297 Bacteria 730
158 Ga0163162_10567298 3300013306 Bacteria 1262
159 Ga0157380_10342618 3300014326 Bacteria 1395
160 Ga0157377_10373783 3300014745 Bacteria 963
161 Ga0157379_10076461 3300014968 Bacteria 2998
162 Ga0157379_10370037 3300014968 Bacteria 1314
163 Ga0157379_10417927 3300014968 Bacteria 1235
164 Ga0157376_10116850 3300014969 Bacteria 2358
165 Ga0157376_11199974 3300014969 Bacteria 787
166 Ga0207656_10423866 3300025321 Bacteria 671
167 Ga0207653_10001713 3300025885 Bacteria 7010
168 Ga0207647_10004485 3300025904 Bacteria 10342
169 Ga0207645_10010078 3300025907 Bacteria 6506
170 Ga0207645_10127865 3300025907 Bacteria 1652
171 Ga0207705_10240566 3300025909 Bacteria 1379
172 Ga0207684_11163139 3300025910 Bacteria 640
173 Ga0207654_10344159 3300025911 Bacteria 1025
174 Ga0207707_10009970 3300025912 Bacteria 8238
175 Ga0207707_10018713 3300025912 Bacteria 6038
176 Ga0207695_10368296 3300025913 Bacteria 1323
177 Ga0207671_10048996 3300025914 Bacteria 3126
178 Ga0207663_10047945 3300025916 Bacteria 2641
179 Ga0207660_10002741 3300025917 Bacteria 11535
180 Ga0207660_10325505 3300025917 Bacteria 1228
181 Ga0207662_10468547 3300025918 Bacteria 864
182 Ga0207657_10051808 3300025919 Bacteria 3566
183 Ga0207649_10700715 3300025920 Bacteria 785
184 Ga0207652_10063744 3300025921 Bacteria 3188
185 Ga0207646_10053931 3300025922 Bacteria 3596
186 Ga0207694_10050597 3300025924 Bacteria 3219
187 Ga0207659_10629448 3300025926 Bacteria 916
188 Ga0207690_10006536 3300025932 Bacteria 6914
189 Ga0207690_10314264 3300025932 Bacteria 1229
190 Ga0207706_10033999 3300025933 Bacteria 4537
191 Ga0207706_10551380 3300025933 Bacteria 992
192 Ga0207686_10376526 3300025934 Bacteria 1075
193 Ga0207709_10318361 3300025935 Bacteria 1163
194 Ga0207670_11331945 3300025936 Bacteria 609
195 Ga0207669_10642724 3300025937 Bacteria 867
196 Ga0207669_10913578 3300025937 Bacteria 734
197 Ga0207704_10345240 3300025938 Bacteria 1157
198 Ga0207704_10421618 3300025938 Bacteria 1058
199 Ga0207665_10555041 3300025939 Unclassified 893
200 Ga0207711_10054032 3300025941 Bacteria 3445
201 Ga0207689_10144453 3300025942 Bacteria 1960
202 Ga0207667_10031461 3300025949 Bacteria 5728
203 Ga0207667_10863362 3300025949 Bacteria 899
204 Ga0207712_10040945 3300025961 Bacteria 3182
205 Ga0207668_10154905 3300025972 Bacteria 1779
206 Ga0207668_10356862 3300025972 Bacteria 1224
207 Ga0207640_11102589 3300025981 Bacteria 702
208 Ga0207658_10369961 3300025986 Bacteria 1253
209 Ga0207658_11002244 3300025986 Bacteria 762
210 Ga0207658_11313798 3300025986 Bacteria 661
211 Ga0207703_10116131 3300026035 Bacteria 2291
212 Ga0207678_10000049 3300026067 Bacteria 90312
213 Ga0207678_11023488 3300026067 Bacteria 731
214 Ga0207708_10100215 3300026075 Bacteria 2241
215 Ga0207708_11218246 3300026075 Bacteria 658
216 Ga0207648_10462900 3300026089 Unclassified 1156
217 Ga0207648_10653299 3300026089 Bacteria 972
218 Ga0207676_10114765 3300026095 Bacteria 2260
219 Ga0207674_10002164 3300026116 Bacteria 24857
220 Ga0207675_100018399 3300026118 Bacteria 6515
221 Ga0207675_100148176 3300026118 Bacteria 2233
222 Ga0207675_100173564 3300026118 Bacteria 2061
223 Ga0207698_10171092 3300026142 Bacteria 1913
224 Ga0209588_1099839 3300027671 Bacteria 934
225 Ga0209813_10004386 3300027866 Bacteria 3369
226 Ga0209813_10006413 3300027866 Bacteria 2905
227 Ga0207428_10193477 3300027907 Bacteria 1533
228 Ga0265354_1000582 3300028016 Bacteria 6172
229 Ga0265356_1000339 3300028017 Bacteria 8588
230 Ga0265355_1010605 3300028036 Bacteria 752
231 Ga0268266_11183106 3300028379 Bacteria 739
232 Ga0268265_10001771 3300028380 Bacteria 17321
233 Ga0268265_10137699 3300028380 Bacteria 2039
234 Ga0268265_10777811 3300028380 Bacteria 931
235 Ga0268264_10020410 3300028381 Bacteria 5416
236 Ga0268264_10145477 3300028381 Bacteria 2119
237 Ga0268264_10264660 3300028381 Bacteria 1604
238 Ga0265338_10182404 3300028800 Bacteria 1599
239 Ga0265765_1005906 3300030879 Unclassified 1293
240 Ga0265760_10001220 3300031090 Bacteria 7525
241 Ga0265760_10008637 3300031090 Bacteria 2911
242 Ga0265340_10056887 3300031247 Bacteria 1881
243 Ga0265340_10104127 3300031247 Bacteria 1317
244 Ga0265339_10136124 3300031249 Bacteria 1253
245 Ga0307513_10006480 3300031456 Bacteria 15285
246 Ga0307408_100188514 3300031548 Bacteria 1660
247 Ga0316579_10182410 3300031691 Bacteria 1015
248 Ga0316576_10014299 3300031727 Bacteria 5302
249 Ga0316578_10020177 3300031728 Bacteria 3679
250 Ga0307516_10000033 3300031730 Bacteria 155697
251 Ga0307405_10157201 3300031731 Bacteria 1606
252 Ga0307406_10091551 3300031901 Bacteria 2049
253 Ga0307406_10736809 3300031901 Bacteria 826
254 Ga0307415_100623095 3300032126 Bacteria 963
255 Ga0307510_10455513 3300033180 Bacteria 720
256 Ga0307510_10525719 3300033180 Bacteria 627
257 Ga0316214_1028342 3300033545 Unclassified 792
258 Ga0373929_0026734 3300035085 Bacteria 1208
259 Ga0373940_0003224 3300035088 Bacteria 3301
260 Ga0373949_0077570 3300035090 Bacteria 880
261 Ga0373939_0000782 3300035114 Bacteria 7839
262 Ga0373941_0342056 3300035115 Bacteria 606
263 Ga0373953_0023411 3300035117 Bacteria 2337
264 Ga0373954_0063711 3300035118 Bacteria 1742
265 Ga0373955_0009949 3300035172 Bacteria 4476
266 Ga0316574_0131058 3300035398 Bacteria 1613
267 Ga0316574_0386334 3300035398 Unclassified 883
268 Ga0373924_0152810 3300035410 Bacteria 1010
269 Ga0373931_0000272 3300035691 Bacteria 21907
270 Ga0373935_0220308 3300035692 Bacteria 1318
271 Ga0373933_0161144 3300035724 Bacteria 1424
272 Ga0373933_0818228 3300035724 Bacteria 613
273 Ga0373937_0346313 3300036401 Unclassified 1407
274 Ga0373937_0597626 3300036401 Bacteria 1047
275 Ga0316584_0006667 3300036712 Bacteria 7832
276 Ga0373925_0087452 3300037068 Unclassified 2379
277 Ga0395899_0038776 3300037312 Bacteria 3567
278 Ga0395900_0034029 3300037418 Bacteria 5245
279 Ga0395900_0803843 3300037418 Bacteria 868
280 Ga0395898_0025574 3300037466 Bacteria 5946
281 Ga0395898_0257832 3300037466 Bacteria 1663
282 Ga0395898_0462559 3300037466 Bacteria 1208
283 Ga0395901_0237900 3300038443 Bacteria 1900
284 Ga0400483_055574 3300039062 Bacteria 1780
285 Ga0436362_0145567 3300039453 Bacteria 1414
286 Ga0451576_0127783 3300045051 Bacteria 2648
287 Ga0495651_0189031 3300046462 Bacteria 1451
288 Ga0495664_0085585 3300046477 Bacteria 1893
289 Ga0495584_0567732 3300046491 Bacteria 578
290 Ga0495652_0202075 3300046529 Bacteria 1507
291 Ga0495587_0081590 3300046536 Bacteria 1874
292 Ga0495668_0242951 3300046616 Bacteria 986
293 Ga0495659_0159407 3300046664 Bacteria 910
294 Ga0495669_0536724 3300046684 Bacteria 569
295 Ga0495604_0357218 3300047317 Bacteria 970
296 Ga0495674_0819303 3300047319 Bacteria 723
297 Ga0495680_0477821 3300047322 Bacteria 849
298 Ga0495675_0341556 3300047444 Bacteria 882
299 Ga0495673_0063019 3300047469 Bacteria 1582
300 Ga0495686_0000131 3300047472 Bacteria 152064
301 Ga0496100_0132157 3300048903 Bacteria 1759
302 Ga0496101_0195191 3300048904 Bacteria 1564
303 Ga0496101_0609407 3300048904 Bacteria 863
304 Ga0496102_0002036 3300048905 Bacteria 17466
305 Ga0496102_0006561 3300048905 Bacteria 9937
306 Ga0496102_0075957 3300048905 Bacteria 3089
307 Ga0496102_0138838 3300048905 Bacteria 2278
308 Ga0496102_0874884 3300048905 Bacteria 820
309 Ga0496103_0071483 3300048906 Bacteria 2171
310 Ga0496103_0131528 3300048906 Bacteria 1598
311 Ga0496103_0278140 3300048906 Bacteria 1077
312 Ga0496104_0001121 3300048907 Bacteria 22928
313 Ga0496104_0009288 3300048907 Bacteria 8745
314 Ga0496104_0024498 3300048907 Bacteria 5551
315 Ga0496104_0735204 3300048907 Bacteria 894
316 Ga0496104_1549736 3300048907 Bacteria 565
317 Ga0496105_0319961 3300048908 Unclassified 1243
318 Ga0496105_0623254 3300048908 Bacteria 835
319 Ga0496106_0003493 3300048909 Bacteria 11707
320 Ga0496106_0015956 3300048909 Bacteria 5554
321 Ga0496106_0196508 3300048909 Bacteria 1605
322 Ga0496107_0020753 3300048910 Bacteria 4642
323 Ga0496107_0052193 3300048910 Bacteria 2949
324 Ga0496107_0759377 3300048910 Unclassified 711
325 Ga0496107_1065074 3300048910 Bacteria 585
326 Ga0496108_0041999 3300048911 Bacteria 3816
327 Ga0496108_0049676 3300048911 Bacteria 3508
328 Ga0496108_1626330 3300048911 Bacteria 534
329 Ga0496109_0021712 3300048912 Bacteria 5681
330 Ga0496109_0125585 3300048912 Bacteria 2392
331 Ga0496109_1343841 3300048912 Bacteria 650
332 Ga0496110_0054366 3300048913 Bacteria 3522
333 Ga0496110_1178727 3300048913 Bacteria 675
334 Ga0496111_0036443 3300048914 Bacteria 3517
335 Ga0496111_0084786 3300048914 Bacteria 2316
336 Ga0496111_0572773 3300048914 Bacteria 828
337 Ga0496112_0059563 3300048915 Bacteria 3763
338 Ga0496113_0486610 3300048916 Bacteria 991
339 Ga0496114_0301616 3300048917 Bacteria 1414
340 Ga0496114_0329131 3300048917 Unclassified 1350
341 Ga0496114_0361235 3300048917 Bacteria 1285
342 Ga0496115_0017042 3300048918 Bacteria 5542
343 Ga0496115_0018108 3300048918 Bacteria 5399
344 Ga0496115_0061098 3300048918 Bacteria 3037
345 Ga0496115_0329371 3300048918 Bacteria 1248
346 Ga0496117_0059439 3300048920 Bacteria 2640
347 Ga0496118_0013943 3300048921 Bacteria 7559
348 Ga0496119_0017491 3300048922 Bacteria 5389
349 Ga0501032_0147108 3300049569 Bacteria 1551
350 Ga0501032_0254758 3300049569 Bacteria 1139
351 Ga0501033_0160474 3300049570 Bacteria 1619
352 Ga0501033_0402335 3300049570 Bacteria 955
353 Ga0501034_0000014 3300049571 Bacteria 297798
354 Ga0501034_0020034 3300049571 Bacteria 6832
355 Ga0501036_0193363 3300049572 Bacteria 1712
356 Ga0501036_0830240 3300049572 Bacteria 760
357 Ga0501036_0973351 3300049572 Bacteria 695
358 Ga0501037_0023819 3300049573 Bacteria 4527
359 Ga0501037_0059866 3300049573 Bacteria 2778
360 Ga0501037_0533210 3300049573 Bacteria 794
361 Ga0501037_0618566 3300049573 Unclassified 726
362 Ga0501038_0160948 3300049574 Bacteria 1824
363 Ga0501038_0701898 3300049574 Bacteria 758
364 Ga0501039_0000252 3300049575 Bacteria 38995
365 Ga0501039_0133245 3300049575 Bacteria 1950
366 Ga0501039_0588023 3300049575 Bacteria 873
367 Ga0501040_0155110 3300049576 Bacteria 1617
368 Ga0501040_0242187 3300049576 Bacteria 1286
369 Ga0501041_0039799 3300049577 Bacteria 2853
370 Ga0501041_0139359 3300049577 Bacteria 1512
371 Ga0501041_0402475 3300049577 Bacteria 867
372 Ga0501042_0443824 3300049578 Bacteria 941
373 Ga0501043_0089462 3300049579 Bacteria 2420
374 Ga0501043_0417177 3300049579 Bacteria 1012
375 Ga0501046_0016378 3300049580 Bacteria 6211
376 Ga0501047_0000222 3300049581 Bacteria 67957
377 Ga0501047_0097183 3300049581 Bacteria 2823
378 Ga0501047_0237495 3300049581 Bacteria 1674
379 Ga0501047_0307512 3300049581 Bacteria 1426
380 Ga0501048_0001086 3300049582 Bacteria 20394
381 Ga0501048_0343511 3300049582 Bacteria 1064
382 Ga0501048_0679581 3300049582 Unclassified 739
383 Ga0501048_0986477 3300049582 Bacteria 606
384 Ga0501067_0004360 3300049583 Bacteria 7794
385 Ga0501067_0015205 3300049583 Bacteria 4261
386 Ga0501067_0175698 3300049583 Bacteria 1193
387 Ga0501068_0791705 3300049584 Bacteria 622
388 Ga0501069_0496889 3300049585 Bacteria 728
389 Ga0501070_0039587 3300049586 Bacteria 3932
390 Ga0501070_0396179 3300049586 Bacteria 1117
391 Ga0501071_0035837 3300049587 Bacteria 3536
392 Ga0501071_0278970 3300049587 Bacteria 1265
393 Ga0501072_0113801 3300049588 Bacteria 2154
394 Ga0501072_0228292 3300049588 Bacteria 1483
395 Ga0501073_0036233 3300049589 Bacteria 3506
396 Ga0501073_0059780 3300049589 Bacteria 2661
397 Ga0501073_0326440 3300049589 Bacteria 1059
398 Ga0501074_0013397 3300049590 Bacteria 5961
399 Ga0501074_0458839 3300049590 Bacteria 903
400 Ga0501075_0362817 3300049591 Bacteria 1104
401 Ga0501075_0766701 3300049591 Bacteria 734
402 Ga0501076_0005392 3300049592 Bacteria 9192
403 Ga0501076_0215397 3300049592 Bacteria 1570
404 Ga0501076_0909014 3300049592 Bacteria 726
405 Ga0501077_0001336 3300049593 Bacteria 14904
406 Ga0501077_0034371 3300049593 Bacteria 3227
407 Ga0501077_0350553 3300049593 Bacteria 942
408 Ga0501077_0694919 3300049593 Bacteria 654
409 Ga0501077_0771623 3300049593 Bacteria 618
410 Ga0501079_0006446 3300049741 Bacteria 8814
411 Ga0501079_0126345 3300049741 Bacteria 1990
412 Ga0501080_0000907 3300049742 Bacteria 24268
413 Ga0501080_0322082 3300049742 Bacteria 1399
414 Ga0501081_0021006 3300049743 Bacteria 4357
415 Ga0501081_0044600 3300049743 Bacteria 3044
416 Ga0501081_0175462 3300049743 Bacteria 1549
417 Ga0501081_0193362 3300049743 Bacteria 1474
418 Ga0501081_0213504 3300049743 Bacteria 1402
419 Ga0501035_0000034 3300049822 Bacteria 174589
420 Ga0501044_0000039 3300049823 Bacteria 158218
421 Ga0501044_0001983 3300049823 Bacteria 23662
422 Ga0501044_0058601 3300049823 Bacteria 3949
423 Ga0501044_0388807 3300049823 Bacteria 1309
424 Ga0501045_0228731 3300049824 Bacteria 1384
425 nmdc:mga03683_10698_c1 3300050489 Bacteria 3296
426 nmdc:mga03683_346738_c1 3300050489 Bacteria 702
427 nmdc:mga03n38_23089_c1 3300050490 Bacteria 2526
428 nmdc:mga03n38_248897_c1 3300050490 Bacteria 938
429 nmdc:mga03n38_4837_c1 3300050490 Bacteria 4512
430 nmdc:mga03n38_4918_c2 3300050490 Bacteria 3731
431 nmdc:mga03n38_64554_c1 3300050490 Bacteria 1676
432 nmdc:mga03n38_76060_c1 3300050490 Bacteria 1565
433 nmdc:mga00v17_2197_c1 3300050491 Bacteria 10030
434 nmdc:mga00v17_274108_c1 3300050491 Bacteria 1095
435 nmdc:mga0yw44_1063425_c1 3300050492 Bacteria 547
436 nmdc:mga0yw44_46136_c1 3300050492 Bacteria 2615
437 nmdc:mga0yw44_5020_c1 3300050492 Bacteria 6183
438 nmdc:mga0k408_603207_c1 3300050493 Bacteria 647
439 nmdc:mga06z11_116676_c1 3300050494 Bacteria 1485
440 nmdc:mga06z11_29564_c1 3300050494 Bacteria 2641
441 nmdc:mga06z11_296824_c1 3300050494 Bacteria 960
442 nmdc:mga06z11_4683_c1 3300050494 Bacteria 5402
443 nmdc:mga06z11_70971_c1 3300050494 Bacteria 1843
444 nmdc:mga04h51_119614_c1 3300050495 Bacteria 980
445 nmdc:mga04h51_154307_c1 3300050495 Bacteria 880
446 nmdc:mga04h51_190156_c1 3300050495 Bacteria 803
447 nmdc:mga04h51_7147_c1 3300050495 Bacteria 2555
448 nmdc:mga07m45_295981_c1 3300050496 Bacteria 941
449 nmdc:mga07m45_634680_c1 3300050496 Bacteria 616
450 nmdc:mga05p37_312242_c1 3300050507 Bacteria 1863
451 nmdc:mga05p37_332773_c1 3300050507 Bacteria 1793
452 nmdc:mga05p37_555519_c1 3300050507 Bacteria 1306
453 nmdc:mga09592_110810_c1 3300050508 Bacteria 2355
454 nmdc:mga09592_729379_c1 3300050508 Bacteria 842
455 nmdc:mga0qj67_5071_c1 3300050509 Bacteria 9583
456 nmdc:mga0qj67_77784_c1 3300050509 Bacteria 2655
457 nmdc:mga06r32_117974_c1 3300050510 Bacteria 2616
458 nmdc:mga06r32_17231_c1 3300050510 Bacteria 6594
459 nmdc:mga06r32_209279_c1 3300050510 Bacteria 1938
460 nmdc:mga06r32_452343_c1 3300050510 Bacteria 1264
461 nmdc:mga06r32_61975_c1 3300050510 Bacteria 3602
462 nmdc:mga08y16_10691_c1 3300050511 Bacteria 9631
463 nmdc:mga08y16_1299626_c1 3300050511 Bacteria 694
464 nmdc:mga08y16_308291_c1 3300050511 Bacteria 1630
465 nmdc:mga08y16_730271_c1 3300050511 Bacteria 988
466 nmdc:mga08y16_882464_c1 3300050511 Bacteria 882
467 nmdc:mga0n895_1273_c1 3300050512 Bacteria 18618
468 nmdc:mga0n895_308240_c1 3300050512 Bacteria 1605
469 nmdc:mga0rr50_17097_c1 3300050513 Bacteria 4832
470 nmdc:mga0a205_54545_c1 3300050515 Bacteria 3860
471 Ga0495601_0433315 3300053077 Unclassified 851
472 Ga0495601_0584205 3300053077 Bacteria 717
473 Ga0495612_0030314 3300053078 Bacteria 2178
474 Ga0495612_0282110 3300053078 Unclassified 743
475 Ga0495595_0165305 3300053084 Bacteria 1093
476 Ga0495619_0029946 3300053085 Bacteria 3520
477 Ga0500651_0186440 3300053093 Bacteria 1230
478 Ga0500641_0074935 3300053096 Bacteria 1430
479 Ga0500650_0379082 3300053098 Bacteria 615
480 Ga0500555_056605 3300053103 Bacteria 1063
481 Ga0500642_0027873 3300053130 Bacteria 2324
482 Ga0500616_0266934 3300053153 Bacteria 724
483 Ga0501084_0004508 3300054114 Bacteria 11385
484 Ga0501084_0190944 3300054114 Bacteria 1728
485 Ga0501084_1350900 3300054114 Bacteria 597
486 Ga0501084_1374492 3300054114 Bacteria 592
487 Ga0501082_0003580 3300060353 Bacteria 13565
488 Ga0501082_0066797 3300060353 Bacteria 3097
489 Ga0501082_0076619 3300060353 Bacteria 2883
490 Ga0501082_0602029 3300060353 Bacteria 962
491 Ga0501082_0932897 3300060353 Bacteria 759
492 Ga0501082_1004652 3300060353 Bacteria 729
493 Ga0530510_0224243 3300061734 Bacteria 1397
494 Ga0530510_0317947 3300061734 Bacteria 1167

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050495 nmdc:mga04h51_154307_c1 nmdc:mga04h51_154307_c1_12_449 133
2 3300049591 Ga0501075_0766701 Ga0501075_0766701_73_675 141
3 3300049743 Ga0501081_0213504 Ga0501081_0213504_363_965 141
4 3300035398 Ga0316574_0386334 Ga0316574_0386334_11_460 144
5 3300048911 Ga0496108_1626330 Ga0496108_1626330_11_460 144
6 3300050490 nmdc:mga03n38_64554_c1 nmdc:mga03n38_64554_c1_10_468 144
7 3300060353 Ga0501082_1004652 Ga0501082_1004652_268_717 144
8 3300048911 Ga0496108_0041999 Ga0496108_0041999_29_472 145
9 3300031456 Ga0307513_10006480 Ga0307513_1000648012 146
10 3300033180 Ga0307510_10525719 Ga0307510_105257191 146
11 3300048907 Ga0496104_1549736 Ga0496104_1549736_95_550 146
12 3300053093 Ga0500651_0186440 Ga0500651_0186440_727_1212 146
13 3300053096 Ga0500641_0074935 Ga0500641_0074935_634_1119 146
14 3300053098 Ga0500650_0379082 Ga0500650_0379082_89_574 146
15 3300053130 Ga0500642_0027873 Ga0500642_0027873_1118_1603 146
16 3300006042 Ga0075368_10019000 Ga0075368_100190002 149
17 3300006048 Ga0075363_100074091 Ga0075363_1000740913 149
18 3300050490 nmdc:mga03n38_248897_c1 nmdc:mga03n38_248897_c1_37_522 149
19 3300050491 nmdc:mga00v17_274108_c1 nmdc:mga00v17_274108_c1_207_692 149
20 3300050493 nmdc:mga0k408_603207_c1 nmdc:mga0k408_603207_c1_128_613 149
21 3300006048 Ga0075363_100124002 Ga0075363_1001240021 151
22 3300050490 nmdc:mga03n38_76060_c1 nmdc:mga03n38_76060_c1_810_1295 151
23 3300005334 Ga0068869_100571923 Ga0068869_1005719232 152
24 3300048908 Ga0496105_0623254 Ga0496105_0623254_351_824 152
25 3300006177 Ga0075362_10169736 Ga0075362_101697362 157
26 3300050489 nmdc:mga03683_10698_c1 nmdc:mga03683_10698_c1_974_1450 157
27 3300050489 nmdc:mga03683_346738_c1 nmdc:mga03683_346738_c1_59_535 157
28 3300005328 Ga0070676_10393138 Ga0070676_103931382 158
29 3300005347 Ga0070668_101236339 Ga0070668_1012363392 158
30 3300005356 Ga0070674_100883085 Ga0070674_1008830852 158
31 3300005445 Ga0070708_100181252 Ga0070708_1001812523 158
32 3300005459 Ga0068867_100409284 Ga0068867_1004092842 158
33 3300005468 Ga0070707_100011550 Ga0070707_1000115509 158
34 3300005548 Ga0070665_102140687 Ga0070665_1021406871 158
35 3300005844 Ga0068862_101058162 Ga0068862_1010581622 158
36 3300006186 Ga0075369_10134750 Ga0075369_101347502 158
37 3300009177 Ga0105248_10083978 Ga0105248_100839784 158
38 3300025907 Ga0207645_10127865 Ga0207645_101278651 158
39 3300025922 Ga0207646_10053931 Ga0207646_100539312 158
40 3300025934 Ga0207686_10376526 Ga0207686_103765262 158
41 3300025937 Ga0207669_10642724 Ga0207669_106427241 158
42 3300025941 Ga0207711_10054032 Ga0207711_100540324 158
43 3300025972 Ga0207668_10356862 Ga0207668_103568621 158
44 3300025986 Ga0207658_11002244 Ga0207658_110022441 158
45 3300026067 Ga0207678_11023488 Ga0207678_110234881 158
46 3300026089 Ga0207648_10653299 Ga0207648_106532991 158
47 3300028380 Ga0268265_10777811 Ga0268265_107778111 158
48 3300028381 Ga0268264_10264660 Ga0268264_102646602 158
49 3300031548 Ga0307408_100188514 Ga0307408_1001885142 158
50 3300039453 Ga0436362_0145567 Ga0436362_0145567_53_535 158
51 3300047469 Ga0495673_0063019 Ga0495673_0063019_426_902 158
52 3300047472 Ga0495686_0000131 Ga0495686_0000131_35800_36276 158
53 3300048906 Ga0496103_0278140 Ga0496103_0278140_102_581 158
54 3300048909 Ga0496106_0196508 Ga0496106_0196508_426_905 158
55 3300048910 Ga0496107_1065074 Ga0496107_1065074_55_534 158
56 3300048920 Ga0496117_0059439 Ga0496117_0059439_1607_2083 158
57 3300048921 Ga0496118_0013943 Ga0496118_0013943_5368_5844 158
58 3300048922 Ga0496119_0017491 Ga0496119_0017491_3178_3654 158
59 3300049569 Ga0501032_0147108 Ga0501032_0147108_687_1163 158
60 3300049579 Ga0501043_0089462 Ga0501043_0089462_837_1313 158
61 3300049581 Ga0501047_0237495 Ga0501047_0237495_751_1227 158
62 3300005327 Ga0070658_10034310 Ga0070658_100343102 159
63 3300005328 Ga0070676_10003900 Ga0070676_100039006 159
64 3300005334 Ga0068869_100043663 Ga0068869_1000436632 159
65 3300005354 Ga0070675_100622145 Ga0070675_1006221452 159
66 3300005457 Ga0070662_100758756 Ga0070662_1007587562 159
67 3300005543 Ga0070672_100422353 Ga0070672_1004223532 159
68 3300005719 Ga0068861_101320587 Ga0068861_1013205871 159
69 3300005937 Ga0081455_10482649 Ga0081455_104826492 159
70 3300006881 Ga0068865_100455148 Ga0068865_1004551482 159
71 3300009551 Ga0105238_10608827 Ga0105238_106088272 159
72 3300010375 Ga0105239_10510003 Ga0105239_105100032 159
73 3300010375 Ga0105239_10541082 Ga0105239_105410822 159
74 3300014326 Ga0157380_10342618 Ga0157380_103426182 159
75 3300014968 Ga0157379_10370037 Ga0157379_103700371 159
76 3300014968 Ga0157379_10417927 Ga0157379_104179273 159
77 3300025907 Ga0207645_10010078 Ga0207645_100100782 159
78 3300025936 Ga0207670_11331945 Ga0207670_113319451 159
79 3300025938 Ga0207704_10345240 Ga0207704_103452401 159
80 3300025981 Ga0207640_11102589 Ga0207640_111025892 159
81 3300026089 Ga0207648_10462900 Ga0207648_104629002 159
82 3300046616 Ga0495668_0242951 Ga0495668_0242951_10_504 159
83 3300048904 Ga0496101_0609407 Ga0496101_0609407_87_572 159
84 3300048905 Ga0496102_0075957 Ga0496102_0075957_1479_1964 159
85 3300048907 Ga0496104_0024498 Ga0496104_0024498_1724_2209 159
86 3300048912 Ga0496109_0125585 Ga0496109_0125585_1409_1894 159
87 3300048914 Ga0496111_0084786 Ga0496111_0084786_52_537 159
88 3300048915 Ga0496112_0059563 Ga0496112_0059563_986_1471 159
89 3300048917 Ga0496114_0361235 Ga0496114_0361235_50_535 159
90 3300048918 Ga0496115_0017042 Ga0496115_0017042_3213_3698 159
91 3300050512 nmdc:mga0n895_308240_c1 nmdc:mga0n895_308240_c1_769_1272 159
92 3300000546 LJNas_1011792 LJNas_10117922 160
93 3300003911 JGI25405J52794_10034275 JGI25405J52794_100342751 160
94 3300004800 Ga0058861_11445454 Ga0058861_114454541 160
95 3300005328 Ga0070676_10524868 Ga0070676_105248681 160
96 3300005328 Ga0070676_10863177 Ga0070676_108631771 160
97 3300005334 Ga0068869_100429567 Ga0068869_1004295672 160
98 3300005336 Ga0070680_100012963 Ga0070680_1000129631 160
99 3300005336 Ga0070680_100042194 Ga0070680_1000421943 160
100 3300005337 Ga0070682_100008980 Ga0070682_1000089804 160
101 3300005339 Ga0070660_100039356 Ga0070660_1000393563 160
102 3300005343 Ga0070687_100244839 Ga0070687_1002448391 160
103 3300005344 Ga0070661_100462794 Ga0070661_1004627942 160
104 3300005345 Ga0070692_10375646 Ga0070692_103756462 160
105 3300005347 Ga0070668_100223682 Ga0070668_1002236821 160
106 3300005347 Ga0070668_100265860 Ga0070668_1002658602 160
107 3300005365 Ga0070688_100574285 Ga0070688_1005742852 160
108 3300005366 Ga0070659_100042196 Ga0070659_1000421964 160
109 3300005366 Ga0070659_100886943 Ga0070659_1008869432 160
110 3300005367 Ga0070667_100398586 Ga0070667_1003985862 160
111 3300005406 Ga0070703_10001032 Ga0070703_100010328 160
112 3300005434 Ga0070709_10513181 Ga0070709_105131812 160
113 3300005436 Ga0070713_100127292 Ga0070713_1001272922 160
114 3300005438 Ga0070701_10210988 Ga0070701_102109882 160
115 3300005439 Ga0070711_100206967 Ga0070711_1002069672 160
116 3300005439 Ga0070711_100412875 Ga0070711_1004128752 160
117 3300005440 Ga0070705_100000057 Ga0070705_10000005718 160
118 3300005440 Ga0070705_100020481 Ga0070705_1000204814 160
119 3300005441 Ga0070700_100024128 Ga0070700_1000241283 160
120 3300005441 Ga0070700_100229525 Ga0070700_1002295252 160
121 3300005441 Ga0070700_100512875 Ga0070700_1005128751 160
122 3300005441 Ga0070700_101185888 Ga0070700_1011858881 160
123 3300005444 Ga0070694_100101889 Ga0070694_1001018891 160
124 3300005445 Ga0070708_100010655 Ga0070708_1000106554 160
125 3300005455 Ga0070663_100006259 Ga0070663_1000062598 160
126 3300005455 Ga0070663_100839884 Ga0070663_1008398842 160
127 3300005457 Ga0070662_100445574 Ga0070662_1004455741 160
128 3300005457 Ga0070662_101264619 Ga0070662_1012646191 160
129 3300005458 Ga0070681_10001360 Ga0070681_100013608 160
130 3300005458 Ga0070681_10054060 Ga0070681_100540604 160
131 3300005459 Ga0068867_100717525 Ga0068867_1007175252 160
132 3300005471 Ga0070698_100172967 Ga0070698_1001729673 160
133 3300005518 Ga0070699_100000158 Ga0070699_10000015857 160
134 3300005530 Ga0070679_100053846 Ga0070679_1000538463 160
135 3300005536 Ga0070697_100142163 Ga0070697_1001421632 160
136 3300005539 Ga0068853_100003714 Ga0068853_1000037148 160
137 3300005545 Ga0070695_100000439 Ga0070695_1000004398 160
138 3300005545 Ga0070695_100073683 Ga0070695_1000736833 160
139 3300005545 Ga0070695_100352627 Ga0070695_1003526271 160
140 3300005546 Ga0070696_100009530 Ga0070696_1000095305 160
141 3300005546 Ga0070696_100012791 Ga0070696_1000127913 160
142 3300005546 Ga0070696_100042585 Ga0070696_1000425853 160
143 3300005547 Ga0070693_100003679 Ga0070693_1000036794 160
144 3300005547 Ga0070693_100866716 Ga0070693_1008667161 160
145 3300005548 Ga0070665_100319489 Ga0070665_1003194891 160
146 3300005548 Ga0070665_101437852 Ga0070665_1014378522 160
147 3300005549 Ga0070704_100000383 Ga0070704_1000003834 160
148 3300005549 Ga0070704_100066322 Ga0070704_1000663223 160
149 3300005549 Ga0070704_100833917 Ga0070704_1008339171 160
150 3300005563 Ga0068855_100272718 Ga0068855_1002727182 160
151 3300005563 Ga0068855_101251822 Ga0068855_1012518221 160
152 3300005577 Ga0068857_100017152 Ga0068857_1000171524 160
153 3300005577 Ga0068857_100063586 Ga0068857_1000635861 160
154 3300005615 Ga0070702_100048377 Ga0070702_1000483772 160
155 3300005615 Ga0070702_100061875 Ga0070702_1000618752 160
156 3300005616 Ga0068852_100109599 Ga0068852_1001095993 160
157 3300005617 Ga0068859_100004801 Ga0068859_1000048011 160
158 3300005618 Ga0068864_100215544 Ga0068864_1002155442 160
159 3300005719 Ga0068861_100135274 Ga0068861_1001352743 160
160 3300005719 Ga0068861_100156077 Ga0068861_1001560773 160
161 3300005719 Ga0068861_100197926 Ga0068861_1001979261 160
162 3300005834 Ga0068851_10061132 Ga0068851_100611321 160
163 3300005840 Ga0068870_10167215 Ga0068870_101672152 160
164 3300005842 Ga0068858_100133314 Ga0068858_1001333143 160
165 3300005843 Ga0068860_100035993 Ga0068860_1000359934 160
166 3300005843 Ga0068860_100164644 Ga0068860_1001646443 160
167 3300005844 Ga0068862_100001821 Ga0068862_10000182111 160
168 3300005937 Ga0081455_10009824 Ga0081455_100098247 160
169 3300005983 Ga0081540_1000165 Ga0081540_100016519 160
170 3300005983 Ga0081540_1000873 Ga0081540_100087322 160
171 3300006038 Ga0075365_10014899 Ga0075365_100148994 160
172 3300006038 Ga0075365_10047112 Ga0075365_100471123 160
173 3300006038 Ga0075365_10091608 Ga0075365_100916083 160
174 3300006038 Ga0075365_10680443 Ga0075365_106804432 160
175 3300006042 Ga0075368_10008257 Ga0075368_100082574 160
176 3300006048 Ga0075363_100003941 Ga0075363_1000039413 160
177 3300006048 Ga0075363_100016578 Ga0075363_1000165783 160
178 3300006048 Ga0075363_100339105 Ga0075363_1003391051 160
179 3300006051 Ga0075364_10009087 Ga0075364_100090877 160
180 3300006173 Ga0070716_100623214 Ga0070716_1006232142 160
181 3300006178 Ga0075367_10007360 Ga0075367_100073603 160
182 3300006178 Ga0075367_10129049 Ga0075367_101290492 160
183 3300006353 Ga0075370_10719393 Ga0075370_107193931 160
184 3300006844 Ga0075428_100003086 Ga0075428_1000030862 160
185 3300006844 Ga0075428_100173041 Ga0075428_1001730412 160
186 3300006846 Ga0075430_100046367 Ga0075430_1000463672 160
187 3300006847 Ga0075431_100016100 Ga0075431_1000161002 160
188 3300006847 Ga0075431_100026132 Ga0075431_1000261325 160
189 3300006852 Ga0075433_10005783 Ga0075433_100057839 160
190 3300006852 Ga0075433_10727296 Ga0075433_107272961 160
191 3300006871 Ga0075434_100055224 Ga0075434_1000552244 160
192 3300006871 Ga0075434_100562246 Ga0075434_1005622462 160
193 3300006881 Ga0068865_100127167 Ga0068865_1001271672 160
194 3300006931 Ga0097620_100004801 Ga0097620_1000048011 160
195 3300007076 Ga0075435_100009318 Ga0075435_1000093185 160
196 3300007265 Ga0099794_10177815 Ga0099794_101778152 160
197 3300007265 Ga0099794_10266434 Ga0099794_102664342 160
198 3300007788 Ga0099795_10325785 Ga0099795_103257851 160
199 3300009094 Ga0111539_10007284 Ga0111539_100072847 160
200 3300009094 Ga0111539_10095202 Ga0111539_100952024 160
201 3300009094 Ga0111539_10190885 Ga0111539_101908851 160
202 3300009094 Ga0111539_10219011 Ga0111539_102190112 160
203 3300009094 Ga0111539_12140740 Ga0111539_121407401 160
204 3300009101 Ga0105247_10455656 Ga0105247_104556561 160
205 3300009147 Ga0114129_10061159 Ga0114129_100611596 160
206 3300009147 Ga0114129_10369823 Ga0114129_103698232 160
207 3300009148 Ga0105243_10236470 Ga0105243_102364702 160
208 3300009148 Ga0105243_10260798 Ga0105243_102607982 160
209 3300009174 Ga0105241_10091409 Ga0105241_100914092 160
210 3300009174 Ga0105241_11272778 Ga0105241_112727781 160
211 3300009545 Ga0105237_10004832 Ga0105237_100048321 160
212 3300009545 Ga0105237_11059025 Ga0105237_110590251 160
213 3300009545 Ga0105237_12089590 Ga0105237_120895901 160
214 3300009553 Ga0105249_10308927 Ga0105249_103089271 160
215 3300009553 Ga0105249_10369753 Ga0105249_103697532 160
216 3300010159 Ga0099796_10164801 Ga0099796_101648012 160
217 3300010375 Ga0105239_10131194 Ga0105239_101311943 160
218 3300010375 Ga0105239_10733482 Ga0105239_107334822 160
219 3300011119 Ga0105246_10294155 Ga0105246_102941551 160
220 3300011119 Ga0105246_10322668 Ga0105246_103226682 160
221 3300013297 Ga0157378_11451519 Ga0157378_114515192 160
222 3300013306 Ga0163162_10567298 Ga0163162_105672983 160
223 3300014745 Ga0157377_10373783 Ga0157377_103737832 160
224 3300014968 Ga0157379_10076461 Ga0157379_100764613 160
225 3300014969 Ga0157376_10116850 Ga0157376_101168503 160
226 3300014969 Ga0157376_11199974 Ga0157376_111999741 160
227 3300025321 Ga0207656_10423866 Ga0207656_104238662 160
228 3300025885 Ga0207653_10001713 Ga0207653_100017135 160
229 3300025904 Ga0207647_10004485 Ga0207647_1000448511 160
230 3300025909 Ga0207705_10240566 Ga0207705_102405663 160
231 3300025910 Ga0207684_11163139 Ga0207684_111631391 160
232 3300025911 Ga0207654_10344159 Ga0207654_103441592 160
233 3300025912 Ga0207707_10009970 Ga0207707_100099704 160
234 3300025912 Ga0207707_10018713 Ga0207707_100187134 160
235 3300025913 Ga0207695_10368296 Ga0207695_103682962 160
236 3300025914 Ga0207671_10048996 Ga0207671_100489964 160
237 3300025916 Ga0207663_10047945 Ga0207663_100479452 160
238 3300025917 Ga0207660_10002741 Ga0207660_100027416 160
239 3300025917 Ga0207660_10325505 Ga0207660_103255051 160
240 3300025918 Ga0207662_10468547 Ga0207662_104685471 160
241 3300025919 Ga0207657_10051808 Ga0207657_100518083 160
242 3300025920 Ga0207649_10700715 Ga0207649_107007152 160
243 3300025921 Ga0207652_10063744 Ga0207652_100637444 160
244 3300025924 Ga0207694_10050597 Ga0207694_100505974 160
245 3300025926 Ga0207659_10629448 Ga0207659_106294482 160
246 3300025932 Ga0207690_10006536 Ga0207690_100065363 160
247 3300025932 Ga0207690_10314264 Ga0207690_103142642 160
248 3300025933 Ga0207706_10033999 Ga0207706_100339992 160
249 3300025933 Ga0207706_10551380 Ga0207706_105513802 160
250 3300025935 Ga0207709_10318361 Ga0207709_103183612 160
251 3300025937 Ga0207669_10913578 Ga0207669_109135781 160
252 3300025938 Ga0207704_10421618 Ga0207704_104216182 160
253 3300025939 Ga0207665_10555041 Ga0207665_105550412 160
254 3300025942 Ga0207689_10144453 Ga0207689_101444533 160
255 3300025949 Ga0207667_10031461 Ga0207667_100314613 160
256 3300025949 Ga0207667_10863362 Ga0207667_108633622 160
257 3300025961 Ga0207712_10040945 Ga0207712_100409452 160
258 3300025972 Ga0207668_10154905 Ga0207668_101549052 160
259 3300025986 Ga0207658_10369961 Ga0207658_103699612 160
260 3300025986 Ga0207658_11313798 Ga0207658_113137981 160
261 3300026035 Ga0207703_10116131 Ga0207703_101161313 160
262 3300026067 Ga0207678_10000049 Ga0207678_1000004971 160
263 3300026075 Ga0207708_10100215 Ga0207708_101002154 160
264 3300026075 Ga0207708_11218246 Ga0207708_112182462 160
265 3300026095 Ga0207676_10114765 Ga0207676_101147652 160
266 3300026116 Ga0207674_10002164 Ga0207674_100021644 160
267 3300026118 Ga0207675_100018399 Ga0207675_1000183995 160
268 3300026118 Ga0207675_100148176 Ga0207675_1001481761 160
269 3300026118 Ga0207675_100173564 Ga0207675_1001735642 160
270 3300026142 Ga0207698_10171092 Ga0207698_101710923 160
271 3300027671 Ga0209588_1099839 Ga0209588_10998392 160
272 3300027866 Ga0209813_10004386 Ga0209813_100043865 160
273 3300027866 Ga0209813_10006413 Ga0209813_100064132 160
274 3300027907 Ga0207428_10193477 Ga0207428_101934772 160
275 3300028016 Ga0265354_1000582 Ga0265354_10005822 160
276 3300028017 Ga0265356_1000339 Ga0265356_10003397 160
277 3300028036 Ga0265355_1010605 Ga0265355_10106052 160
278 3300028379 Ga0268266_11183106 Ga0268266_111831061 160
279 3300028380 Ga0268265_10001771 Ga0268265_100017715 160
280 3300028380 Ga0268265_10137699 Ga0268265_101376993 160
281 3300028381 Ga0268264_10020410 Ga0268264_100204102 160
282 3300028381 Ga0268264_10145477 Ga0268264_101454772 160
283 3300028800 Ga0265338_10182404 Ga0265338_101824042 160
284 3300030879 Ga0265765_1005906 Ga0265765_10059062 160
285 3300031090 Ga0265760_10001220 Ga0265760_100012208 160
286 3300031090 Ga0265760_10008637 Ga0265760_100086372 160
287 3300031247 Ga0265340_10056887 Ga0265340_100568872 160
288 3300031247 Ga0265340_10104127 Ga0265340_101041272 160
289 3300031249 Ga0265339_10136124 Ga0265339_101361242 160
290 3300031691 Ga0316579_10182410 Ga0316579_101824102 160
291 3300031727 Ga0316576_10014299 Ga0316576_100142994 160
292 3300031728 Ga0316578_10020177 Ga0316578_100201774 160
293 3300031730 Ga0307516_10000033 Ga0307516_1000003357 160
294 3300031731 Ga0307405_10157201 Ga0307405_101572012 160
295 3300031901 Ga0307406_10091551 Ga0307406_100915512 160
296 3300031901 Ga0307406_10736809 Ga0307406_107368091 160
297 3300032126 Ga0307415_100623095 Ga0307415_1006230951 160
298 3300033180 Ga0307510_10455513 Ga0307510_104555131 160
299 3300033545 Ga0316214_1028342 Ga0316214_10283421 160
300 3300035085 Ga0373929_0026734 Ga0373929_0026734_57_542 160
301 3300035088 Ga0373940_0003224 Ga0373940_0003224_1557_2042 160
302 3300035090 Ga0373949_0077570 Ga0373949_0077570_249_734 160
303 3300035114 Ga0373939_0000782 Ga0373939_0000782_6877_7362 160
304 3300035115 Ga0373941_0342056 Ga0373941_0342056_98_583 160
305 3300035117 Ga0373953_0023411 Ga0373953_0023411_291_788 160
306 3300035118 Ga0373954_0063711 Ga0373954_0063711_260_757 160
307 3300035172 Ga0373955_0009949 Ga0373955_0009949_3741_4238 160
308 3300035398 Ga0316574_0131058 Ga0316574_0131058_98_586 160
309 3300035410 Ga0373924_0152810 Ga0373924_0152810_188_685 160
310 3300035691 Ga0373931_0000272 Ga0373931_0000272_21307_21792 160
311 3300035692 Ga0373935_0220308 Ga0373935_0220308_68_565 160
312 3300035724 Ga0373933_0161144 Ga0373933_0161144_857_1354 160
313 3300035724 Ga0373933_0818228 Ga0373933_0818228_76_558 160
314 3300036401 Ga0373937_0346313 Ga0373937_0346313_660_1142 160
315 3300036401 Ga0373937_0597626 Ga0373937_0597626_61_558 160
316 3300036712 Ga0316584_0006667 Ga0316584_0006667_2659_3147 160
317 3300037068 Ga0373925_0087452 Ga0373925_0087452_983_1465 160
318 3300037312 Ga0395899_0038776 Ga0395899_0038776_172_657 160
319 3300037418 Ga0395900_0034029 Ga0395900_0034029_138_635 160
320 3300037418 Ga0395900_0803843 Ga0395900_0803843_41_538 160
321 3300037466 Ga0395898_0025574 Ga0395898_0025574_168_665 160
322 3300037466 Ga0395898_0257832 Ga0395898_0257832_966_1463 160
323 3300037466 Ga0395898_0462559 Ga0395898_0462559_448_945 160
324 3300038443 Ga0395901_0237900 Ga0395901_0237900_633_1130 160
325 3300039062 Ga0400483_055574 Ga0400483_055574_132_614 160
326 3300045051 Ga0451576_0127783 Ga0451576_0127783_1792_2274 160
327 3300046462 Ga0495651_0189031 Ga0495651_0189031_490_987 160
328 3300046477 Ga0495664_0085585 Ga0495664_0085585_498_995 160
329 3300046491 Ga0495584_0567732 Ga0495584_0567732_23_508 160
330 3300046529 Ga0495652_0202075 Ga0495652_0202075_522_1019 160
331 3300046536 Ga0495587_0081590 Ga0495587_0081590_911_1408 160
332 3300046664 Ga0495659_0159407 Ga0495659_0159407_179_664 160
333 3300046684 Ga0495669_0536724 Ga0495669_0536724_51_548 160
334 3300047317 Ga0495604_0357218 Ga0495604_0357218_441_923 160
335 3300047319 Ga0495674_0819303 Ga0495674_0819303_194_691 160
336 3300047322 Ga0495680_0477821 Ga0495680_0477821_301_798 160
337 3300047444 Ga0495675_0341556 Ga0495675_0341556_213_710 160
338 3300048903 Ga0496100_0132157 Ga0496100_0132157_56_553 160
339 3300048904 Ga0496101_0195191 Ga0496101_0195191_824_1321 160
340 3300048905 Ga0496102_0002036 Ga0496102_0002036_75_560 160
341 3300048905 Ga0496102_0006561 Ga0496102_0006561_5872_6369 160
342 3300048905 Ga0496102_0138838 Ga0496102_0138838_1405_1902 160
343 3300048905 Ga0496102_0874884 Ga0496102_0874884_241_729 160
344 3300048906 Ga0496103_0071483 Ga0496103_0071483_1199_1696 160
345 3300048906 Ga0496103_0131528 Ga0496103_0131528_186_671 160
346 3300048907 Ga0496104_0001121 Ga0496104_0001121_20020_20508 160
347 3300048907 Ga0496104_0009288 Ga0496104_0009288_4499_4981 160
348 3300048907 Ga0496104_0735204 Ga0496104_0735204_250_738 160
349 3300048908 Ga0496105_0319961 Ga0496105_0319961_660_1142 160
350 3300048909 Ga0496106_0003493 Ga0496106_0003493_11145_11642 160
351 3300048909 Ga0496106_0015956 Ga0496106_0015956_5010_5495 160
352 3300048910 Ga0496107_0020753 Ga0496107_0020753_2159_2644 160
353 3300048910 Ga0496107_0052193 Ga0496107_0052193_236_733 160
354 3300048910 Ga0496107_0759377 Ga0496107_0759377_142_624 160
355 3300048911 Ga0496108_0049676 Ga0496108_0049676_2388_2876 160
356 3300048912 Ga0496109_0021712 Ga0496109_0021712_547_1035 160
357 3300048912 Ga0496109_1343841 Ga0496109_1343841_38_535 160
358 3300048913 Ga0496110_0054366 Ga0496110_0054366_2263_2751 160
359 3300048913 Ga0496110_1178727 Ga0496110_1178727_69_554 160
360 3300048914 Ga0496111_0036443 Ga0496111_0036443_2376_2864 160
361 3300048914 Ga0496111_0572773 Ga0496111_0572773_323_811 160
362 3300048916 Ga0496113_0486610 Ga0496113_0486610_151_639 160
363 3300048917 Ga0496114_0301616 Ga0496114_0301616_757_1254 160
364 3300048917 Ga0496114_0329131 Ga0496114_0329131_438_920 160
365 3300048918 Ga0496115_0018108 Ga0496115_0018108_1730_2227 160
366 3300048918 Ga0496115_0061098 Ga0496115_0061098_1107_1589 160
367 3300048918 Ga0496115_0329371 Ga0496115_0329371_11_496 160
368 3300049569 Ga0501032_0254758 Ga0501032_0254758_607_1104 160
369 3300049570 Ga0501033_0160474 Ga0501033_0160474_939_1436 160
370 3300049570 Ga0501033_0402335 Ga0501033_0402335_11_508 160
371 3300049571 Ga0501034_0000014 Ga0501034_0000014_154335_154832 160
372 3300049571 Ga0501034_0020034 Ga0501034_0020034_3316_3813 160
373 3300049572 Ga0501036_0193363 Ga0501036_0193363_558_1106 160
374 3300049572 Ga0501036_0830240 Ga0501036_0830240_224_721 160
375 3300049572 Ga0501036_0973351 Ga0501036_0973351_95_592 160
376 3300049573 Ga0501037_0023819 Ga0501037_0023819_139_621 160
377 3300049573 Ga0501037_0059866 Ga0501037_0059866_1347_1844 160
378 3300049573 Ga0501037_0533210 Ga0501037_0533210_211_696 160
379 3300049573 Ga0501037_0618566 Ga0501037_0618566_200_685 160
380 3300049574 Ga0501038_0160948 Ga0501038_0160948_135_632 160
381 3300049574 Ga0501038_0701898 Ga0501038_0701898_189_674 160
382 3300049575 Ga0501039_0000252 Ga0501039_0000252_15066_15563 160
383 3300049575 Ga0501039_0133245 Ga0501039_0133245_1133_1618 160
384 3300049575 Ga0501039_0588023 Ga0501039_0588023_234_731 160
385 3300049576 Ga0501040_0155110 Ga0501040_0155110_449_946 160
386 3300049576 Ga0501040_0242187 Ga0501040_0242187_708_1205 160
387 3300049577 Ga0501041_0039799 Ga0501041_0039799_247_732 160
388 3300049577 Ga0501041_0139359 Ga0501041_0139359_760_1245 160
389 3300049577 Ga0501041_0402475 Ga0501041_0402475_59_544 160
390 3300049578 Ga0501042_0443824 Ga0501042_0443824_137_685 160
391 3300049579 Ga0501043_0417177 Ga0501043_0417177_227_724 160
392 3300049580 Ga0501046_0016378 Ga0501046_0016378_607_1104 160
393 3300049581 Ga0501047_0000222 Ga0501047_0000222_16431_16928 160
394 3300049581 Ga0501047_0097183 Ga0501047_0097183_2047_2544 160
395 3300049581 Ga0501047_0307512 Ga0501047_0307512_100_597 160
396 3300049582 Ga0501048_0001086 Ga0501048_0001086_12058_12555 160
397 3300049582 Ga0501048_0343511 Ga0501048_0343511_362_859 160
398 3300049582 Ga0501048_0679581 Ga0501048_0679581_226_711 160
399 3300049582 Ga0501048_0986477 Ga0501048_0986477_55_540 160
400 3300049583 Ga0501067_0004360 Ga0501067_0004360_1303_1800 160
401 3300049583 Ga0501067_0015205 Ga0501067_0015205_2415_2912 160
402 3300049583 Ga0501067_0175698 Ga0501067_0175698_116_613 160
403 3300049584 Ga0501068_0791705 Ga0501068_0791705_59_547 160
404 3300049585 Ga0501069_0496889 Ga0501069_0496889_61_546 160
405 3300049586 Ga0501070_0039587 Ga0501070_0039587_3083_3580 160
406 3300049586 Ga0501070_0396179 Ga0501070_0396179_492_977 160
407 3300049587 Ga0501071_0035837 Ga0501071_0035837_1398_1883 160
408 3300049587 Ga0501071_0278970 Ga0501071_0278970_510_1058 160
409 3300049588 Ga0501072_0113801 Ga0501072_0113801_778_1263 160
410 3300049588 Ga0501072_0228292 Ga0501072_0228292_932_1417 160
411 3300049589 Ga0501073_0036233 Ga0501073_0036233_525_1010 160
412 3300049589 Ga0501073_0059780 Ga0501073_0059780_482_979 160
413 3300049589 Ga0501073_0326440 Ga0501073_0326440_286_783 160
414 3300049590 Ga0501074_0013397 Ga0501074_0013397_2496_2981 160
415 3300049590 Ga0501074_0458839 Ga0501074_0458839_296_781 160
416 3300049591 Ga0501075_0362817 Ga0501075_0362817_190_675 160
417 3300049592 Ga0501076_0005392 Ga0501076_0005392_3085_3570 160
418 3300049592 Ga0501076_0215397 Ga0501076_0215397_349_834 160
419 3300049592 Ga0501076_0909014 Ga0501076_0909014_99_647 160
420 3300049593 Ga0501077_0001336 Ga0501077_0001336_6399_6884 160
421 3300049593 Ga0501077_0034371 Ga0501077_0034371_222_707 160
422 3300049593 Ga0501077_0350553 Ga0501077_0350553_300_785 160
423 3300049593 Ga0501077_0694919 Ga0501077_0694919_109_594 160
424 3300049593 Ga0501077_0771623 Ga0501077_0771623_43_540 160
425 3300049741 Ga0501079_0006446 Ga0501079_0006446_2265_2750 160
426 3300049741 Ga0501079_0126345 Ga0501079_0126345_1231_1716 160
427 3300049742 Ga0501080_0000907 Ga0501080_0000907_10335_10832 160
428 3300049742 Ga0501080_0322082 Ga0501080_0322082_522_1007 160
429 3300049743 Ga0501081_0021006 Ga0501081_0021006_1224_1709 160
430 3300049743 Ga0501081_0044600 Ga0501081_0044600_1154_1639 160
431 3300049743 Ga0501081_0175462 Ga0501081_0175462_771_1268 160
432 3300049743 Ga0501081_0193362 Ga0501081_0193362_880_1365 160
433 3300049822 Ga0501035_0000034 Ga0501035_0000034_66065_66562 160
434 3300049823 Ga0501044_0000039 Ga0501044_0000039_63002_63499 160
435 3300049823 Ga0501044_0001983 Ga0501044_0001983_3814_4296 160
436 3300049823 Ga0501044_0058601 Ga0501044_0058601_1617_2114 160
437 3300049823 Ga0501044_0388807 Ga0501044_0388807_775_1272 160
438 3300049824 Ga0501045_0228731 Ga0501045_0228731_267_764 160
439 3300050490 nmdc:mga03n38_23089_c1 nmdc:mga03n38_23089_c1_1784_2272 160
440 3300050490 nmdc:mga03n38_4837_c1 nmdc:mga03n38_4837_c1_990_1478 160
441 3300050490 nmdc:mga03n38_4918_c2 nmdc:mga03n38_4918_c2_1022_1510 160
442 3300050491 nmdc:mga00v17_2197_c1 nmdc:mga00v17_2197_c1_2558_3046 160
443 3300050492 nmdc:mga0yw44_1063425_c1 nmdc:mga0yw44_1063425_c1_16_516 160
444 3300050492 nmdc:mga0yw44_46136_c1 nmdc:mga0yw44_46136_c1_764_1252 160
445 3300050492 nmdc:mga0yw44_5020_c1 nmdc:mga0yw44_5020_c1_1560_2048 160
446 3300050494 nmdc:mga06z11_116676_c1 nmdc:mga06z11_116676_c1_290_796 160
447 3300050494 nmdc:mga06z11_29564_c1 nmdc:mga06z11_29564_c1_1117_1605 160
448 3300050494 nmdc:mga06z11_296824_c1 nmdc:mga06z11_296824_c1_405_893 160
449 3300050494 nmdc:mga06z11_4683_c1 nmdc:mga06z11_4683_c1_1183_1671 160
450 3300050494 nmdc:mga06z11_70971_c1 nmdc:mga06z11_70971_c1_249_737 160
451 3300050495 nmdc:mga04h51_119614_c1 nmdc:mga04h51_119614_c1_80_568 160
452 3300050495 nmdc:mga04h51_190156_c1 nmdc:mga04h51_190156_c1_255_761 160
453 3300050495 nmdc:mga04h51_7147_c1 nmdc:mga04h51_7147_c1_1001_1489 160
454 3300050496 nmdc:mga07m45_295981_c1 nmdc:mga07m45_295981_c1_71_559 160
455 3300050496 nmdc:mga07m45_634680_c1 nmdc:mga07m45_634680_c1_62_568 160
456 3300050507 nmdc:mga05p37_312242_c1 nmdc:mga05p37_312242_c1_819_1304 160
457 3300050507 nmdc:mga05p37_332773_c1 nmdc:mga05p37_332773_c1_702_1187 160
458 3300050507 nmdc:mga05p37_555519_c1 nmdc:mga05p37_555519_c1_386_874 160
459 3300050508 nmdc:mga09592_110810_c1 nmdc:mga09592_110810_c1_1697_2185 160
460 3300050508 nmdc:mga09592_729379_c1 nmdc:mga09592_729379_c1_261_749 160
461 3300050509 nmdc:mga0qj67_5071_c1 nmdc:mga0qj67_5071_c1_4468_4956 160
462 3300050509 nmdc:mga0qj67_77784_c1 nmdc:mga0qj67_77784_c1_533_1021 160
463 3300050510 nmdc:mga06r32_117974_c1 nmdc:mga06r32_117974_c1_432_920 160
464 3300050510 nmdc:mga06r32_17231_c1 nmdc:mga06r32_17231_c1_2185_2670 160
465 3300050510 nmdc:mga06r32_209279_c1 nmdc:mga06r32_209279_c1_1301_1786 160
466 3300050510 nmdc:mga06r32_452343_c1 nmdc:mga06r32_452343_c1_588_1076 160
467 3300050510 nmdc:mga06r32_61975_c1 nmdc:mga06r32_61975_c1_2445_2933 160
468 3300050511 nmdc:mga08y16_10691_c1 nmdc:mga08y16_10691_c1_8197_8682 160
469 3300050511 nmdc:mga08y16_1299626_c1 nmdc:mga08y16_1299626_c1_57_542 160
470 3300050511 nmdc:mga08y16_308291_c1 nmdc:mga08y16_308291_c1_190_675 160
471 3300050511 nmdc:mga08y16_730271_c1 nmdc:mga08y16_730271_c1_448_936 160
472 3300050511 nmdc:mga08y16_882464_c1 nmdc:mga08y16_882464_c1_318_806 160
473 3300050512 nmdc:mga0n895_1273_c1 nmdc:mga0n895_1273_c1_13792_14277 160
474 3300050513 nmdc:mga0rr50_17097_c1 nmdc:mga0rr50_17097_c1_2830_3315 160
475 3300050515 nmdc:mga0a205_54545_c1 nmdc:mga0a205_54545_c1_1160_1645 160
476 3300053077 Ga0495601_0433315 Ga0495601_0433315_200_682 160
477 3300053077 Ga0495601_0584205 Ga0495601_0584205_42_539 160
478 3300053078 Ga0495612_0030314 Ga0495612_0030314_1563_2060 160
479 3300053078 Ga0495612_0282110 Ga0495612_0282110_189_671 160
480 3300053084 Ga0495595_0165305 Ga0495595_0165305_562_1059 160
481 3300053085 Ga0495619_0029946 Ga0495619_0029946_177_674 160
482 3300053103 Ga0500555_056605 Ga0500555_056605_288_785 160
483 3300053153 Ga0500616_0266934 Ga0500616_0266934_44_532 160
484 3300054114 Ga0501084_0004508 Ga0501084_0004508_5166_5651 160
485 3300054114 Ga0501084_0190944 Ga0501084_0190944_737_1222 160
486 3300054114 Ga0501084_1350900 Ga0501084_1350900_72_569 160
487 3300054114 Ga0501084_1374492 Ga0501084_1374492_78_566 160
488 3300060353 Ga0501082_0003580 Ga0501082_0003580_10544_11029 160
489 3300060353 Ga0501082_0066797 Ga0501082_0066797_2209_2706 160
490 3300060353 Ga0501082_0076619 Ga0501082_0076619_1562_2047 160
491 3300060353 Ga0501082_0602029 Ga0501082_0602029_181_669 160
492 3300060353 Ga0501082_0932897 Ga0501082_0932897_95_580 160
493 3300061734 Ga0530510_0224243 Ga0530510_0224243_600_1085 160
494 3300061734 Ga0530510_0317947 Ga0530510_0317947_77_562 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

21

175

0.9

PF00578

AhpC-TSA

AhpC/TSA family

22

157

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k1g-assembly1.cif.gz_A-2 crystal structure of reduced prx3 from vibrio vulnificus 0.9837 2 159
4f82-assembly1.cif.gz_B x-ray crystal structure of a putative thioredoxin reductase from burkholderia cenocepacia 0.9836 1 160
5k2j-assembly4.cif.gz_H crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus 0.9821 2 159
5k2j-assembly6.cif.gz_K crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus 0.9799 2 160
3uma-assembly3.cif.gz_C crystal structure of a hypothetical peroxiredoxin protein frm sinorhizobium meliloti 0.9797 1 160
ID Description Score Start End Superfamily
4f82B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9836 1 160 3.40.30.10
4f82B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9776 1 160 3.40.30.10
af_Q54N76_3_172_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9643 1 160 3.40.30.10
3umaA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9616 1 160 3.40.30.10
af_A0A1D6HW14_71_234_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9613 6 160 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A534EDJ2-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 1.002 1 160 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A4V1SR03-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 1.002 39 160 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A537RAC6-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.9994 1 115 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A523MNG4-F1-model_v4 Peroxiredoxin 0.9977 74 160 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454
AF-A0A1Q7TUM0-F1-model_v4 Glutathione-dependent peroxiredoxin (EC 1.11.1.27) 0.9967 1 141 GO:0005737
GO:0008379
GO:0034599
GO:0042744
GO:0045454

Feature Viewer

pLDDT pTM Quality
96.02 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map