F454637
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 494 | 277 | 494 | 162 |
Family's Representative Sequence
| Representative Sequence | 3300049572|Ga0501036_0193363|Ga0501036_0193363_558_1106 |
| Length | 182 |
| Sequence | MIERMLHGGAANSAEDFMAISVGDKLPQHTFTTIGGEGPEPITTADVFAGKKVALFAVPGAYTPTCHQQHMPGFVSRLGDLAAKGIDTVACTAVNDIFVLQNWAKDTGALGKVVMLADGSAEFARKIGLDIDLTTRGLGVRSKRYAMLVEDGVVKVLNVEDAPPQHDRSSAATLCSMIDYAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 59 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 141 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 142 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 150 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 152 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 153 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 154 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 155 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 156 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 160 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 161 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 162 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 163 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 166 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 171 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 183 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 206 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 207 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 216 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 217 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 218 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 250 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 251 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 252 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 254 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 255 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 256 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 270 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 271 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 272 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 273 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 274 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.19 |
| Metatranscriptomes | 0.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.12 |
| Nodule | 0 |
| Rhizoplane | 9.11 |
| Rhizosphere | 78.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1011792 | 3300000546 | Bacteria | 931 |
| 2 | JGI25405J52794_10034275 | 3300003911 | Bacteria | 1061 |
| 3 | Ga0058861_11445454 | 3300004800 | Bacteria | 674 |
| 4 | Ga0070658_10034310 | 3300005327 | Bacteria | 4083 |
| 5 | Ga0070676_10003900 | 3300005328 | Bacteria | 7828 |
| 6 | Ga0070676_10393138 | 3300005328 | Bacteria | 963 |
| 7 | Ga0070676_10524868 | 3300005328 | Bacteria | 844 |
| 8 | Ga0070676_10863177 | 3300005328 | Bacteria | 672 |
| 9 | Ga0068869_100043663 | 3300005334 | Bacteria | 3221 |
| 10 | Ga0068869_100429567 | 3300005334 | Bacteria | 1091 |
| 11 | Ga0068869_100571923 | 3300005334 | Bacteria | 952 |
| 12 | Ga0070680_100012963 | 3300005336 | Bacteria | 6484 |
| 13 | Ga0070680_100042194 | 3300005336 | Bacteria | 3700 |
| 14 | Ga0070682_100008980 | 3300005337 | Bacteria | 5648 |
| 15 | Ga0070660_100039356 | 3300005339 | Bacteria | 3593 |
| 16 | Ga0070687_100244839 | 3300005343 | Bacteria | 1111 |
| 17 | Ga0070661_100462794 | 3300005344 | Bacteria | 1010 |
| 18 | Ga0070692_10375646 | 3300005345 | Bacteria | 890 |
| 19 | Ga0070668_100223682 | 3300005347 | Bacteria | 1553 |
| 20 | Ga0070668_100265860 | 3300005347 | Bacteria | 1428 |
| 21 | Ga0070668_101236339 | 3300005347 | Bacteria | 677 |
| 22 | Ga0070675_100622145 | 3300005354 | Bacteria | 980 |
| 23 | Ga0070674_100883085 | 3300005356 | Bacteria | 778 |
| 24 | Ga0070688_100574285 | 3300005365 | Bacteria | 860 |
| 25 | Ga0070659_100042196 | 3300005366 | Bacteria | 3566 |
| 26 | Ga0070659_100886943 | 3300005366 | Bacteria | 779 |
| 27 | Ga0070667_100398586 | 3300005367 | Bacteria | 1252 |
| 28 | Ga0070703_10001032 | 3300005406 | Bacteria | 8712 |
| 29 | Ga0070709_10513181 | 3300005434 | Bacteria | 912 |
| 30 | Ga0070713_100127292 | 3300005436 | Unclassified | 2242 |
| 31 | Ga0070701_10210988 | 3300005438 | Bacteria | 1153 |
| 32 | Ga0070711_100206967 | 3300005439 | Unclassified | 1517 |
| 33 | Ga0070711_100412875 | 3300005439 | Bacteria | 1098 |
| 34 | Ga0070705_100000057 | 3300005440 | Bacteria | 58275 |
| 35 | Ga0070705_100020481 | 3300005440 | Bacteria | 3502 |
| 36 | Ga0070700_100024128 | 3300005441 | Bacteria | 3567 |
| 37 | Ga0070700_100229525 | 3300005441 | Bacteria | 1320 |
| 38 | Ga0070700_100512875 | 3300005441 | Bacteria | 925 |
| 39 | Ga0070700_101185888 | 3300005441 | Bacteria | 637 |
| 40 | Ga0070694_100101889 | 3300005444 | Bacteria | 2032 |
| 41 | Ga0070708_100010655 | 3300005445 | Bacteria | 7456 |
| 42 | Ga0070708_100181252 | 3300005445 | Bacteria | 1969 |
| 43 | Ga0070663_100006259 | 3300005455 | Bacteria | 7138 |
| 44 | Ga0070663_100839884 | 3300005455 | Bacteria | 790 |
| 45 | Ga0070662_100445574 | 3300005457 | Bacteria | 1074 |
| 46 | Ga0070662_100758756 | 3300005457 | Bacteria | 823 |
| 47 | Ga0070662_101264619 | 3300005457 | Bacteria | 635 |
| 48 | Ga0070681_10001360 | 3300005458 | Bacteria | 21379 |
| 49 | Ga0070681_10054060 | 3300005458 | Bacteria | 4001 |
| 50 | Ga0068867_100409284 | 3300005459 | Bacteria | 1146 |
| 51 | Ga0068867_100717525 | 3300005459 | Bacteria | 884 |
| 52 | Ga0070707_100011550 | 3300005468 | Bacteria | 8236 |
| 53 | Ga0070698_100172967 | 3300005471 | Bacteria | 2100 |
| 54 | Ga0070699_100000158 | 3300005518 | Bacteria | 64029 |
| 55 | Ga0070679_100053846 | 3300005530 | Bacteria | 4006 |
| 56 | Ga0070697_100142163 | 3300005536 | Bacteria | 2019 |
| 57 | Ga0068853_100003714 | 3300005539 | Bacteria | 11721 |
| 58 | Ga0070672_100422353 | 3300005543 | Bacteria | 1145 |
| 59 | Ga0070695_100000439 | 3300005545 | Bacteria | 21648 |
| 60 | Ga0070695_100073683 | 3300005545 | Bacteria | 2242 |
| 61 | Ga0070695_100352627 | 3300005545 | Bacteria | 1103 |
| 62 | Ga0070696_100009530 | 3300005546 | Bacteria | 6500 |
| 63 | Ga0070696_100012791 | 3300005546 | Bacteria | 5635 |
| 64 | Ga0070696_100042585 | 3300005546 | Bacteria | 3138 |
| 65 | Ga0070693_100003679 | 3300005547 | Bacteria | 7168 |
| 66 | Ga0070693_100866716 | 3300005547 | Bacteria | 674 |
| 67 | Ga0070665_100319489 | 3300005548 | Bacteria | 1557 |
| 68 | Ga0070665_101437852 | 3300005548 | Bacteria | 698 |
| 69 | Ga0070665_102140687 | 3300005548 | Bacteria | 564 |
| 70 | Ga0070704_100000383 | 3300005549 | Bacteria | 20192 |
| 71 | Ga0070704_100066322 | 3300005549 | Bacteria | 2602 |
| 72 | Ga0070704_100833917 | 3300005549 | Bacteria | 826 |
| 73 | Ga0068855_100272718 | 3300005563 | Bacteria | 1881 |
| 74 | Ga0068855_101251822 | 3300005563 | Bacteria | 770 |
| 75 | Ga0068857_100017152 | 3300005577 | Bacteria | 6343 |
| 76 | Ga0068857_100063586 | 3300005577 | Bacteria | 3281 |
| 77 | Ga0070702_100048377 | 3300005615 | Bacteria | 2420 |
| 78 | Ga0070702_100061875 | 3300005615 | Bacteria | 2181 |
| 79 | Ga0068852_100109599 | 3300005616 | Bacteria | 2508 |
| 80 | Ga0068859_100004801 | 3300005617 | Bacteria | 13760 |
| 81 | Ga0068864_100215544 | 3300005618 | Bacteria | 1770 |
| 82 | Ga0068861_100135274 | 3300005719 | Bacteria | 2005 |
| 83 | Ga0068861_100156077 | 3300005719 | Bacteria | 1878 |
| 84 | Ga0068861_100197926 | 3300005719 | Bacteria | 1685 |
| 85 | Ga0068861_101320587 | 3300005719 | Bacteria | 702 |
| 86 | Ga0068851_10061132 | 3300005834 | Bacteria | 1930 |
| 87 | Ga0068870_10167215 | 3300005840 | Bacteria | 1309 |
| 88 | Ga0068858_100133314 | 3300005842 | Bacteria | 2330 |
| 89 | Ga0068860_100035993 | 3300005843 | Bacteria | 4746 |
| 90 | Ga0068860_100164644 | 3300005843 | Bacteria | 2140 |
| 91 | Ga0068862_100001821 | 3300005844 | Bacteria | 19311 |
| 92 | Ga0068862_101058162 | 3300005844 | Bacteria | 805 |
| 93 | Ga0081455_10009824 | 3300005937 | Bacteria | 9800 |
| 94 | Ga0081455_10482649 | 3300005937 | Bacteria | 837 |
| 95 | Ga0081540_1000165 | 3300005983 | Bacteria | 68435 |
| 96 | Ga0081540_1000873 | 3300005983 | Bacteria | 27254 |
| 97 | Ga0075365_10014899 | 3300006038 | Bacteria | 4687 |
| 98 | Ga0075365_10047112 | 3300006038 | Bacteria | 2833 |
| 99 | Ga0075365_10091608 | 3300006038 | Bacteria | 2072 |
| 100 | Ga0075365_10680443 | 3300006038 | Unclassified | 727 |
| 101 | Ga0075368_10008257 | 3300006042 | Bacteria | 3701 |
| 102 | Ga0075368_10019000 | 3300006042 | Bacteria | 2590 |
| 103 | Ga0075363_100003941 | 3300006048 | Bacteria | 6409 |
| 104 | Ga0075363_100016578 | 3300006048 | Bacteria | 3641 |
| 105 | Ga0075363_100074091 | 3300006048 | Bacteria | 1853 |
| 106 | Ga0075363_100124002 | 3300006048 | Bacteria | 1445 |
| 107 | Ga0075363_100339105 | 3300006048 | Bacteria | 876 |
| 108 | Ga0075364_10009087 | 3300006051 | Bacteria | 5952 |
| 109 | Ga0070716_100623214 | 3300006173 | Unclassified | 814 |
| 110 | Ga0075362_10169736 | 3300006177 | Bacteria | 1053 |
| 111 | Ga0075367_10007360 | 3300006178 | Bacteria | 5629 |
| 112 | Ga0075367_10129049 | 3300006178 | Bacteria | 1562 |
| 113 | Ga0075369_10134750 | 3300006186 | Bacteria | 1124 |
| 114 | Ga0075370_10719393 | 3300006353 | Bacteria | 607 |
| 115 | Ga0075428_100003086 | 3300006844 | Bacteria | 18176 |
| 116 | Ga0075428_100173041 | 3300006844 | Bacteria | 2340 |
| 117 | Ga0075430_100046367 | 3300006846 | Bacteria | 3671 |
| 118 | Ga0075431_100016100 | 3300006847 | Bacteria | 7586 |
| 119 | Ga0075431_100026132 | 3300006847 | Bacteria | 5988 |
| 120 | Ga0075433_10005783 | 3300006852 | Bacteria | 9734 |
| 121 | Ga0075433_10727296 | 3300006852 | Bacteria | 869 |
| 122 | Ga0075434_100055224 | 3300006871 | Bacteria | 3946 |
| 123 | Ga0075434_100562246 | 3300006871 | Bacteria | 1160 |
| 124 | Ga0068865_100127167 | 3300006881 | Bacteria | 1904 |
| 125 | Ga0068865_100455148 | 3300006881 | Bacteria | 1059 |
| 126 | Ga0097620_100004801 | 3300006931 | Bacteria | 13760 |
| 127 | Ga0075435_100009318 | 3300007076 | Bacteria | 7100 |
| 128 | Ga0099794_10177815 | 3300007265 | Unclassified | 1086 |
| 129 | Ga0099794_10266434 | 3300007265 | Bacteria | 885 |
| 130 | Ga0099795_10325785 | 3300007788 | Bacteria | 681 |
| 131 | Ga0111539_10007284 | 3300009094 | Bacteria | 14165 |
| 132 | Ga0111539_10095202 | 3300009094 | Bacteria | 3498 |
| 133 | Ga0111539_10190885 | 3300009094 | Bacteria | 2390 |
| 134 | Ga0111539_10219011 | 3300009094 | Bacteria | 2217 |
| 135 | Ga0111539_12140740 | 3300009094 | Bacteria | 649 |
| 136 | Ga0105247_10455656 | 3300009101 | Bacteria | 923 |
| 137 | Ga0114129_10061159 | 3300009147 | Bacteria | 5264 |
| 138 | Ga0114129_10369823 | 3300009147 | Bacteria | 1895 |
| 139 | Ga0105243_10236470 | 3300009148 | Bacteria | 1623 |
| 140 | Ga0105243_10260798 | 3300009148 | Bacteria | 1551 |
| 141 | Ga0105241_10091409 | 3300009174 | Bacteria | 2401 |
| 142 | Ga0105241_11272778 | 3300009174 | Bacteria | 699 |
| 143 | Ga0105248_10083978 | 3300009177 | Bacteria | 3582 |
| 144 | Ga0105237_10004832 | 3300009545 | Bacteria | 15478 |
| 145 | Ga0105237_11059025 | 3300009545 | Bacteria | 818 |
| 146 | Ga0105237_12089590 | 3300009545 | Bacteria | 575 |
| 147 | Ga0105238_10608827 | 3300009551 | Bacteria | 1101 |
| 148 | Ga0105249_10308927 | 3300009553 | Bacteria | 1589 |
| 149 | Ga0105249_10369753 | 3300009553 | Bacteria | 1457 |
| 150 | Ga0099796_10164801 | 3300010159 | Bacteria | 881 |
| 151 | Ga0105239_10131194 | 3300010375 | Bacteria | 2787 |
| 152 | Ga0105239_10510003 | 3300010375 | Bacteria | 1368 |
| 153 | Ga0105239_10541082 | 3300010375 | Bacteria | 1326 |
| 154 | Ga0105239_10733482 | 3300010375 | Bacteria | 1130 |
| 155 | Ga0105246_10294155 | 3300011119 | Unclassified | 1308 |
| 156 | Ga0105246_10322668 | 3300011119 | Bacteria | 1256 |
| 157 | Ga0157378_11451519 | 3300013297 | Bacteria | 730 |
| 158 | Ga0163162_10567298 | 3300013306 | Bacteria | 1262 |
| 159 | Ga0157380_10342618 | 3300014326 | Bacteria | 1395 |
| 160 | Ga0157377_10373783 | 3300014745 | Bacteria | 963 |
| 161 | Ga0157379_10076461 | 3300014968 | Bacteria | 2998 |
| 162 | Ga0157379_10370037 | 3300014968 | Bacteria | 1314 |
| 163 | Ga0157379_10417927 | 3300014968 | Bacteria | 1235 |
| 164 | Ga0157376_10116850 | 3300014969 | Bacteria | 2358 |
| 165 | Ga0157376_11199974 | 3300014969 | Bacteria | 787 |
| 166 | Ga0207656_10423866 | 3300025321 | Bacteria | 671 |
| 167 | Ga0207653_10001713 | 3300025885 | Bacteria | 7010 |
| 168 | Ga0207647_10004485 | 3300025904 | Bacteria | 10342 |
| 169 | Ga0207645_10010078 | 3300025907 | Bacteria | 6506 |
| 170 | Ga0207645_10127865 | 3300025907 | Bacteria | 1652 |
| 171 | Ga0207705_10240566 | 3300025909 | Bacteria | 1379 |
| 172 | Ga0207684_11163139 | 3300025910 | Bacteria | 640 |
| 173 | Ga0207654_10344159 | 3300025911 | Bacteria | 1025 |
| 174 | Ga0207707_10009970 | 3300025912 | Bacteria | 8238 |
| 175 | Ga0207707_10018713 | 3300025912 | Bacteria | 6038 |
| 176 | Ga0207695_10368296 | 3300025913 | Bacteria | 1323 |
| 177 | Ga0207671_10048996 | 3300025914 | Bacteria | 3126 |
| 178 | Ga0207663_10047945 | 3300025916 | Bacteria | 2641 |
| 179 | Ga0207660_10002741 | 3300025917 | Bacteria | 11535 |
| 180 | Ga0207660_10325505 | 3300025917 | Bacteria | 1228 |
| 181 | Ga0207662_10468547 | 3300025918 | Bacteria | 864 |
| 182 | Ga0207657_10051808 | 3300025919 | Bacteria | 3566 |
| 183 | Ga0207649_10700715 | 3300025920 | Bacteria | 785 |
| 184 | Ga0207652_10063744 | 3300025921 | Bacteria | 3188 |
| 185 | Ga0207646_10053931 | 3300025922 | Bacteria | 3596 |
| 186 | Ga0207694_10050597 | 3300025924 | Bacteria | 3219 |
| 187 | Ga0207659_10629448 | 3300025926 | Bacteria | 916 |
| 188 | Ga0207690_10006536 | 3300025932 | Bacteria | 6914 |
| 189 | Ga0207690_10314264 | 3300025932 | Bacteria | 1229 |
| 190 | Ga0207706_10033999 | 3300025933 | Bacteria | 4537 |
| 191 | Ga0207706_10551380 | 3300025933 | Bacteria | 992 |
| 192 | Ga0207686_10376526 | 3300025934 | Bacteria | 1075 |
| 193 | Ga0207709_10318361 | 3300025935 | Bacteria | 1163 |
| 194 | Ga0207670_11331945 | 3300025936 | Bacteria | 609 |
| 195 | Ga0207669_10642724 | 3300025937 | Bacteria | 867 |
| 196 | Ga0207669_10913578 | 3300025937 | Bacteria | 734 |
| 197 | Ga0207704_10345240 | 3300025938 | Bacteria | 1157 |
| 198 | Ga0207704_10421618 | 3300025938 | Bacteria | 1058 |
| 199 | Ga0207665_10555041 | 3300025939 | Unclassified | 893 |
| 200 | Ga0207711_10054032 | 3300025941 | Bacteria | 3445 |
| 201 | Ga0207689_10144453 | 3300025942 | Bacteria | 1960 |
| 202 | Ga0207667_10031461 | 3300025949 | Bacteria | 5728 |
| 203 | Ga0207667_10863362 | 3300025949 | Bacteria | 899 |
| 204 | Ga0207712_10040945 | 3300025961 | Bacteria | 3182 |
| 205 | Ga0207668_10154905 | 3300025972 | Bacteria | 1779 |
| 206 | Ga0207668_10356862 | 3300025972 | Bacteria | 1224 |
| 207 | Ga0207640_11102589 | 3300025981 | Bacteria | 702 |
| 208 | Ga0207658_10369961 | 3300025986 | Bacteria | 1253 |
| 209 | Ga0207658_11002244 | 3300025986 | Bacteria | 762 |
| 210 | Ga0207658_11313798 | 3300025986 | Bacteria | 661 |
| 211 | Ga0207703_10116131 | 3300026035 | Bacteria | 2291 |
| 212 | Ga0207678_10000049 | 3300026067 | Bacteria | 90312 |
| 213 | Ga0207678_11023488 | 3300026067 | Bacteria | 731 |
| 214 | Ga0207708_10100215 | 3300026075 | Bacteria | 2241 |
| 215 | Ga0207708_11218246 | 3300026075 | Bacteria | 658 |
| 216 | Ga0207648_10462900 | 3300026089 | Unclassified | 1156 |
| 217 | Ga0207648_10653299 | 3300026089 | Bacteria | 972 |
| 218 | Ga0207676_10114765 | 3300026095 | Bacteria | 2260 |
| 219 | Ga0207674_10002164 | 3300026116 | Bacteria | 24857 |
| 220 | Ga0207675_100018399 | 3300026118 | Bacteria | 6515 |
| 221 | Ga0207675_100148176 | 3300026118 | Bacteria | 2233 |
| 222 | Ga0207675_100173564 | 3300026118 | Bacteria | 2061 |
| 223 | Ga0207698_10171092 | 3300026142 | Bacteria | 1913 |
| 224 | Ga0209588_1099839 | 3300027671 | Bacteria | 934 |
| 225 | Ga0209813_10004386 | 3300027866 | Bacteria | 3369 |
| 226 | Ga0209813_10006413 | 3300027866 | Bacteria | 2905 |
| 227 | Ga0207428_10193477 | 3300027907 | Bacteria | 1533 |
| 228 | Ga0265354_1000582 | 3300028016 | Bacteria | 6172 |
| 229 | Ga0265356_1000339 | 3300028017 | Bacteria | 8588 |
| 230 | Ga0265355_1010605 | 3300028036 | Bacteria | 752 |
| 231 | Ga0268266_11183106 | 3300028379 | Bacteria | 739 |
| 232 | Ga0268265_10001771 | 3300028380 | Bacteria | 17321 |
| 233 | Ga0268265_10137699 | 3300028380 | Bacteria | 2039 |
| 234 | Ga0268265_10777811 | 3300028380 | Bacteria | 931 |
| 235 | Ga0268264_10020410 | 3300028381 | Bacteria | 5416 |
| 236 | Ga0268264_10145477 | 3300028381 | Bacteria | 2119 |
| 237 | Ga0268264_10264660 | 3300028381 | Bacteria | 1604 |
| 238 | Ga0265338_10182404 | 3300028800 | Bacteria | 1599 |
| 239 | Ga0265765_1005906 | 3300030879 | Unclassified | 1293 |
| 240 | Ga0265760_10001220 | 3300031090 | Bacteria | 7525 |
| 241 | Ga0265760_10008637 | 3300031090 | Bacteria | 2911 |
| 242 | Ga0265340_10056887 | 3300031247 | Bacteria | 1881 |
| 243 | Ga0265340_10104127 | 3300031247 | Bacteria | 1317 |
| 244 | Ga0265339_10136124 | 3300031249 | Bacteria | 1253 |
| 245 | Ga0307513_10006480 | 3300031456 | Bacteria | 15285 |
| 246 | Ga0307408_100188514 | 3300031548 | Bacteria | 1660 |
| 247 | Ga0316579_10182410 | 3300031691 | Bacteria | 1015 |
| 248 | Ga0316576_10014299 | 3300031727 | Bacteria | 5302 |
| 249 | Ga0316578_10020177 | 3300031728 | Bacteria | 3679 |
| 250 | Ga0307516_10000033 | 3300031730 | Bacteria | 155697 |
| 251 | Ga0307405_10157201 | 3300031731 | Bacteria | 1606 |
| 252 | Ga0307406_10091551 | 3300031901 | Bacteria | 2049 |
| 253 | Ga0307406_10736809 | 3300031901 | Bacteria | 826 |
| 254 | Ga0307415_100623095 | 3300032126 | Bacteria | 963 |
| 255 | Ga0307510_10455513 | 3300033180 | Bacteria | 720 |
| 256 | Ga0307510_10525719 | 3300033180 | Bacteria | 627 |
| 257 | Ga0316214_1028342 | 3300033545 | Unclassified | 792 |
| 258 | Ga0373929_0026734 | 3300035085 | Bacteria | 1208 |
| 259 | Ga0373940_0003224 | 3300035088 | Bacteria | 3301 |
| 260 | Ga0373949_0077570 | 3300035090 | Bacteria | 880 |
| 261 | Ga0373939_0000782 | 3300035114 | Bacteria | 7839 |
| 262 | Ga0373941_0342056 | 3300035115 | Bacteria | 606 |
| 263 | Ga0373953_0023411 | 3300035117 | Bacteria | 2337 |
| 264 | Ga0373954_0063711 | 3300035118 | Bacteria | 1742 |
| 265 | Ga0373955_0009949 | 3300035172 | Bacteria | 4476 |
| 266 | Ga0316574_0131058 | 3300035398 | Bacteria | 1613 |
| 267 | Ga0316574_0386334 | 3300035398 | Unclassified | 883 |
| 268 | Ga0373924_0152810 | 3300035410 | Bacteria | 1010 |
| 269 | Ga0373931_0000272 | 3300035691 | Bacteria | 21907 |
| 270 | Ga0373935_0220308 | 3300035692 | Bacteria | 1318 |
| 271 | Ga0373933_0161144 | 3300035724 | Bacteria | 1424 |
| 272 | Ga0373933_0818228 | 3300035724 | Bacteria | 613 |
| 273 | Ga0373937_0346313 | 3300036401 | Unclassified | 1407 |
| 274 | Ga0373937_0597626 | 3300036401 | Bacteria | 1047 |
| 275 | Ga0316584_0006667 | 3300036712 | Bacteria | 7832 |
| 276 | Ga0373925_0087452 | 3300037068 | Unclassified | 2379 |
| 277 | Ga0395899_0038776 | 3300037312 | Bacteria | 3567 |
| 278 | Ga0395900_0034029 | 3300037418 | Bacteria | 5245 |
| 279 | Ga0395900_0803843 | 3300037418 | Bacteria | 868 |
| 280 | Ga0395898_0025574 | 3300037466 | Bacteria | 5946 |
| 281 | Ga0395898_0257832 | 3300037466 | Bacteria | 1663 |
| 282 | Ga0395898_0462559 | 3300037466 | Bacteria | 1208 |
| 283 | Ga0395901_0237900 | 3300038443 | Bacteria | 1900 |
| 284 | Ga0400483_055574 | 3300039062 | Bacteria | 1780 |
| 285 | Ga0436362_0145567 | 3300039453 | Bacteria | 1414 |
| 286 | Ga0451576_0127783 | 3300045051 | Bacteria | 2648 |
| 287 | Ga0495651_0189031 | 3300046462 | Bacteria | 1451 |
| 288 | Ga0495664_0085585 | 3300046477 | Bacteria | 1893 |
| 289 | Ga0495584_0567732 | 3300046491 | Bacteria | 578 |
| 290 | Ga0495652_0202075 | 3300046529 | Bacteria | 1507 |
| 291 | Ga0495587_0081590 | 3300046536 | Bacteria | 1874 |
| 292 | Ga0495668_0242951 | 3300046616 | Bacteria | 986 |
| 293 | Ga0495659_0159407 | 3300046664 | Bacteria | 910 |
| 294 | Ga0495669_0536724 | 3300046684 | Bacteria | 569 |
| 295 | Ga0495604_0357218 | 3300047317 | Bacteria | 970 |
| 296 | Ga0495674_0819303 | 3300047319 | Bacteria | 723 |
| 297 | Ga0495680_0477821 | 3300047322 | Bacteria | 849 |
| 298 | Ga0495675_0341556 | 3300047444 | Bacteria | 882 |
| 299 | Ga0495673_0063019 | 3300047469 | Bacteria | 1582 |
| 300 | Ga0495686_0000131 | 3300047472 | Bacteria | 152064 |
| 301 | Ga0496100_0132157 | 3300048903 | Bacteria | 1759 |
| 302 | Ga0496101_0195191 | 3300048904 | Bacteria | 1564 |
| 303 | Ga0496101_0609407 | 3300048904 | Bacteria | 863 |
| 304 | Ga0496102_0002036 | 3300048905 | Bacteria | 17466 |
| 305 | Ga0496102_0006561 | 3300048905 | Bacteria | 9937 |
| 306 | Ga0496102_0075957 | 3300048905 | Bacteria | 3089 |
| 307 | Ga0496102_0138838 | 3300048905 | Bacteria | 2278 |
| 308 | Ga0496102_0874884 | 3300048905 | Bacteria | 820 |
| 309 | Ga0496103_0071483 | 3300048906 | Bacteria | 2171 |
| 310 | Ga0496103_0131528 | 3300048906 | Bacteria | 1598 |
| 311 | Ga0496103_0278140 | 3300048906 | Bacteria | 1077 |
| 312 | Ga0496104_0001121 | 3300048907 | Bacteria | 22928 |
| 313 | Ga0496104_0009288 | 3300048907 | Bacteria | 8745 |
| 314 | Ga0496104_0024498 | 3300048907 | Bacteria | 5551 |
| 315 | Ga0496104_0735204 | 3300048907 | Bacteria | 894 |
| 316 | Ga0496104_1549736 | 3300048907 | Bacteria | 565 |
| 317 | Ga0496105_0319961 | 3300048908 | Unclassified | 1243 |
| 318 | Ga0496105_0623254 | 3300048908 | Bacteria | 835 |
| 319 | Ga0496106_0003493 | 3300048909 | Bacteria | 11707 |
| 320 | Ga0496106_0015956 | 3300048909 | Bacteria | 5554 |
| 321 | Ga0496106_0196508 | 3300048909 | Bacteria | 1605 |
| 322 | Ga0496107_0020753 | 3300048910 | Bacteria | 4642 |
| 323 | Ga0496107_0052193 | 3300048910 | Bacteria | 2949 |
| 324 | Ga0496107_0759377 | 3300048910 | Unclassified | 711 |
| 325 | Ga0496107_1065074 | 3300048910 | Bacteria | 585 |
| 326 | Ga0496108_0041999 | 3300048911 | Bacteria | 3816 |
| 327 | Ga0496108_0049676 | 3300048911 | Bacteria | 3508 |
| 328 | Ga0496108_1626330 | 3300048911 | Bacteria | 534 |
| 329 | Ga0496109_0021712 | 3300048912 | Bacteria | 5681 |
| 330 | Ga0496109_0125585 | 3300048912 | Bacteria | 2392 |
| 331 | Ga0496109_1343841 | 3300048912 | Bacteria | 650 |
| 332 | Ga0496110_0054366 | 3300048913 | Bacteria | 3522 |
| 333 | Ga0496110_1178727 | 3300048913 | Bacteria | 675 |
| 334 | Ga0496111_0036443 | 3300048914 | Bacteria | 3517 |
| 335 | Ga0496111_0084786 | 3300048914 | Bacteria | 2316 |
| 336 | Ga0496111_0572773 | 3300048914 | Bacteria | 828 |
| 337 | Ga0496112_0059563 | 3300048915 | Bacteria | 3763 |
| 338 | Ga0496113_0486610 | 3300048916 | Bacteria | 991 |
| 339 | Ga0496114_0301616 | 3300048917 | Bacteria | 1414 |
| 340 | Ga0496114_0329131 | 3300048917 | Unclassified | 1350 |
| 341 | Ga0496114_0361235 | 3300048917 | Bacteria | 1285 |
| 342 | Ga0496115_0017042 | 3300048918 | Bacteria | 5542 |
| 343 | Ga0496115_0018108 | 3300048918 | Bacteria | 5399 |
| 344 | Ga0496115_0061098 | 3300048918 | Bacteria | 3037 |
| 345 | Ga0496115_0329371 | 3300048918 | Bacteria | 1248 |
| 346 | Ga0496117_0059439 | 3300048920 | Bacteria | 2640 |
| 347 | Ga0496118_0013943 | 3300048921 | Bacteria | 7559 |
| 348 | Ga0496119_0017491 | 3300048922 | Bacteria | 5389 |
| 349 | Ga0501032_0147108 | 3300049569 | Bacteria | 1551 |
| 350 | Ga0501032_0254758 | 3300049569 | Bacteria | 1139 |
| 351 | Ga0501033_0160474 | 3300049570 | Bacteria | 1619 |
| 352 | Ga0501033_0402335 | 3300049570 | Bacteria | 955 |
| 353 | Ga0501034_0000014 | 3300049571 | Bacteria | 297798 |
| 354 | Ga0501034_0020034 | 3300049571 | Bacteria | 6832 |
| 355 | Ga0501036_0193363 | 3300049572 | Bacteria | 1712 |
| 356 | Ga0501036_0830240 | 3300049572 | Bacteria | 760 |
| 357 | Ga0501036_0973351 | 3300049572 | Bacteria | 695 |
| 358 | Ga0501037_0023819 | 3300049573 | Bacteria | 4527 |
| 359 | Ga0501037_0059866 | 3300049573 | Bacteria | 2778 |
| 360 | Ga0501037_0533210 | 3300049573 | Bacteria | 794 |
| 361 | Ga0501037_0618566 | 3300049573 | Unclassified | 726 |
| 362 | Ga0501038_0160948 | 3300049574 | Bacteria | 1824 |
| 363 | Ga0501038_0701898 | 3300049574 | Bacteria | 758 |
| 364 | Ga0501039_0000252 | 3300049575 | Bacteria | 38995 |
| 365 | Ga0501039_0133245 | 3300049575 | Bacteria | 1950 |
| 366 | Ga0501039_0588023 | 3300049575 | Bacteria | 873 |
| 367 | Ga0501040_0155110 | 3300049576 | Bacteria | 1617 |
| 368 | Ga0501040_0242187 | 3300049576 | Bacteria | 1286 |
| 369 | Ga0501041_0039799 | 3300049577 | Bacteria | 2853 |
| 370 | Ga0501041_0139359 | 3300049577 | Bacteria | 1512 |
| 371 | Ga0501041_0402475 | 3300049577 | Bacteria | 867 |
| 372 | Ga0501042_0443824 | 3300049578 | Bacteria | 941 |
| 373 | Ga0501043_0089462 | 3300049579 | Bacteria | 2420 |
| 374 | Ga0501043_0417177 | 3300049579 | Bacteria | 1012 |
| 375 | Ga0501046_0016378 | 3300049580 | Bacteria | 6211 |
| 376 | Ga0501047_0000222 | 3300049581 | Bacteria | 67957 |
| 377 | Ga0501047_0097183 | 3300049581 | Bacteria | 2823 |
| 378 | Ga0501047_0237495 | 3300049581 | Bacteria | 1674 |
| 379 | Ga0501047_0307512 | 3300049581 | Bacteria | 1426 |
| 380 | Ga0501048_0001086 | 3300049582 | Bacteria | 20394 |
| 381 | Ga0501048_0343511 | 3300049582 | Bacteria | 1064 |
| 382 | Ga0501048_0679581 | 3300049582 | Unclassified | 739 |
| 383 | Ga0501048_0986477 | 3300049582 | Bacteria | 606 |
| 384 | Ga0501067_0004360 | 3300049583 | Bacteria | 7794 |
| 385 | Ga0501067_0015205 | 3300049583 | Bacteria | 4261 |
| 386 | Ga0501067_0175698 | 3300049583 | Bacteria | 1193 |
| 387 | Ga0501068_0791705 | 3300049584 | Bacteria | 622 |
| 388 | Ga0501069_0496889 | 3300049585 | Bacteria | 728 |
| 389 | Ga0501070_0039587 | 3300049586 | Bacteria | 3932 |
| 390 | Ga0501070_0396179 | 3300049586 | Bacteria | 1117 |
| 391 | Ga0501071_0035837 | 3300049587 | Bacteria | 3536 |
| 392 | Ga0501071_0278970 | 3300049587 | Bacteria | 1265 |
| 393 | Ga0501072_0113801 | 3300049588 | Bacteria | 2154 |
| 394 | Ga0501072_0228292 | 3300049588 | Bacteria | 1483 |
| 395 | Ga0501073_0036233 | 3300049589 | Bacteria | 3506 |
| 396 | Ga0501073_0059780 | 3300049589 | Bacteria | 2661 |
| 397 | Ga0501073_0326440 | 3300049589 | Bacteria | 1059 |
| 398 | Ga0501074_0013397 | 3300049590 | Bacteria | 5961 |
| 399 | Ga0501074_0458839 | 3300049590 | Bacteria | 903 |
| 400 | Ga0501075_0362817 | 3300049591 | Bacteria | 1104 |
| 401 | Ga0501075_0766701 | 3300049591 | Bacteria | 734 |
| 402 | Ga0501076_0005392 | 3300049592 | Bacteria | 9192 |
| 403 | Ga0501076_0215397 | 3300049592 | Bacteria | 1570 |
| 404 | Ga0501076_0909014 | 3300049592 | Bacteria | 726 |
| 405 | Ga0501077_0001336 | 3300049593 | Bacteria | 14904 |
| 406 | Ga0501077_0034371 | 3300049593 | Bacteria | 3227 |
| 407 | Ga0501077_0350553 | 3300049593 | Bacteria | 942 |
| 408 | Ga0501077_0694919 | 3300049593 | Bacteria | 654 |
| 409 | Ga0501077_0771623 | 3300049593 | Bacteria | 618 |
| 410 | Ga0501079_0006446 | 3300049741 | Bacteria | 8814 |
| 411 | Ga0501079_0126345 | 3300049741 | Bacteria | 1990 |
| 412 | Ga0501080_0000907 | 3300049742 | Bacteria | 24268 |
| 413 | Ga0501080_0322082 | 3300049742 | Bacteria | 1399 |
| 414 | Ga0501081_0021006 | 3300049743 | Bacteria | 4357 |
| 415 | Ga0501081_0044600 | 3300049743 | Bacteria | 3044 |
| 416 | Ga0501081_0175462 | 3300049743 | Bacteria | 1549 |
| 417 | Ga0501081_0193362 | 3300049743 | Bacteria | 1474 |
| 418 | Ga0501081_0213504 | 3300049743 | Bacteria | 1402 |
| 419 | Ga0501035_0000034 | 3300049822 | Bacteria | 174589 |
| 420 | Ga0501044_0000039 | 3300049823 | Bacteria | 158218 |
| 421 | Ga0501044_0001983 | 3300049823 | Bacteria | 23662 |
| 422 | Ga0501044_0058601 | 3300049823 | Bacteria | 3949 |
| 423 | Ga0501044_0388807 | 3300049823 | Bacteria | 1309 |
| 424 | Ga0501045_0228731 | 3300049824 | Bacteria | 1384 |
| 425 | nmdc:mga03683_10698_c1 | 3300050489 | Bacteria | 3296 |
| 426 | nmdc:mga03683_346738_c1 | 3300050489 | Bacteria | 702 |
| 427 | nmdc:mga03n38_23089_c1 | 3300050490 | Bacteria | 2526 |
| 428 | nmdc:mga03n38_248897_c1 | 3300050490 | Bacteria | 938 |
| 429 | nmdc:mga03n38_4837_c1 | 3300050490 | Bacteria | 4512 |
| 430 | nmdc:mga03n38_4918_c2 | 3300050490 | Bacteria | 3731 |
| 431 | nmdc:mga03n38_64554_c1 | 3300050490 | Bacteria | 1676 |
| 432 | nmdc:mga03n38_76060_c1 | 3300050490 | Bacteria | 1565 |
| 433 | nmdc:mga00v17_2197_c1 | 3300050491 | Bacteria | 10030 |
| 434 | nmdc:mga00v17_274108_c1 | 3300050491 | Bacteria | 1095 |
| 435 | nmdc:mga0yw44_1063425_c1 | 3300050492 | Bacteria | 547 |
| 436 | nmdc:mga0yw44_46136_c1 | 3300050492 | Bacteria | 2615 |
| 437 | nmdc:mga0yw44_5020_c1 | 3300050492 | Bacteria | 6183 |
| 438 | nmdc:mga0k408_603207_c1 | 3300050493 | Bacteria | 647 |
| 439 | nmdc:mga06z11_116676_c1 | 3300050494 | Bacteria | 1485 |
| 440 | nmdc:mga06z11_29564_c1 | 3300050494 | Bacteria | 2641 |
| 441 | nmdc:mga06z11_296824_c1 | 3300050494 | Bacteria | 960 |
| 442 | nmdc:mga06z11_4683_c1 | 3300050494 | Bacteria | 5402 |
| 443 | nmdc:mga06z11_70971_c1 | 3300050494 | Bacteria | 1843 |
| 444 | nmdc:mga04h51_119614_c1 | 3300050495 | Bacteria | 980 |
| 445 | nmdc:mga04h51_154307_c1 | 3300050495 | Bacteria | 880 |
| 446 | nmdc:mga04h51_190156_c1 | 3300050495 | Bacteria | 803 |
| 447 | nmdc:mga04h51_7147_c1 | 3300050495 | Bacteria | 2555 |
| 448 | nmdc:mga07m45_295981_c1 | 3300050496 | Bacteria | 941 |
| 449 | nmdc:mga07m45_634680_c1 | 3300050496 | Bacteria | 616 |
| 450 | nmdc:mga05p37_312242_c1 | 3300050507 | Bacteria | 1863 |
| 451 | nmdc:mga05p37_332773_c1 | 3300050507 | Bacteria | 1793 |
| 452 | nmdc:mga05p37_555519_c1 | 3300050507 | Bacteria | 1306 |
| 453 | nmdc:mga09592_110810_c1 | 3300050508 | Bacteria | 2355 |
| 454 | nmdc:mga09592_729379_c1 | 3300050508 | Bacteria | 842 |
| 455 | nmdc:mga0qj67_5071_c1 | 3300050509 | Bacteria | 9583 |
| 456 | nmdc:mga0qj67_77784_c1 | 3300050509 | Bacteria | 2655 |
| 457 | nmdc:mga06r32_117974_c1 | 3300050510 | Bacteria | 2616 |
| 458 | nmdc:mga06r32_17231_c1 | 3300050510 | Bacteria | 6594 |
| 459 | nmdc:mga06r32_209279_c1 | 3300050510 | Bacteria | 1938 |
| 460 | nmdc:mga06r32_452343_c1 | 3300050510 | Bacteria | 1264 |
| 461 | nmdc:mga06r32_61975_c1 | 3300050510 | Bacteria | 3602 |
| 462 | nmdc:mga08y16_10691_c1 | 3300050511 | Bacteria | 9631 |
| 463 | nmdc:mga08y16_1299626_c1 | 3300050511 | Bacteria | 694 |
| 464 | nmdc:mga08y16_308291_c1 | 3300050511 | Bacteria | 1630 |
| 465 | nmdc:mga08y16_730271_c1 | 3300050511 | Bacteria | 988 |
| 466 | nmdc:mga08y16_882464_c1 | 3300050511 | Bacteria | 882 |
| 467 | nmdc:mga0n895_1273_c1 | 3300050512 | Bacteria | 18618 |
| 468 | nmdc:mga0n895_308240_c1 | 3300050512 | Bacteria | 1605 |
| 469 | nmdc:mga0rr50_17097_c1 | 3300050513 | Bacteria | 4832 |
| 470 | nmdc:mga0a205_54545_c1 | 3300050515 | Bacteria | 3860 |
| 471 | Ga0495601_0433315 | 3300053077 | Unclassified | 851 |
| 472 | Ga0495601_0584205 | 3300053077 | Bacteria | 717 |
| 473 | Ga0495612_0030314 | 3300053078 | Bacteria | 2178 |
| 474 | Ga0495612_0282110 | 3300053078 | Unclassified | 743 |
| 475 | Ga0495595_0165305 | 3300053084 | Bacteria | 1093 |
| 476 | Ga0495619_0029946 | 3300053085 | Bacteria | 3520 |
| 477 | Ga0500651_0186440 | 3300053093 | Bacteria | 1230 |
| 478 | Ga0500641_0074935 | 3300053096 | Bacteria | 1430 |
| 479 | Ga0500650_0379082 | 3300053098 | Bacteria | 615 |
| 480 | Ga0500555_056605 | 3300053103 | Bacteria | 1063 |
| 481 | Ga0500642_0027873 | 3300053130 | Bacteria | 2324 |
| 482 | Ga0500616_0266934 | 3300053153 | Bacteria | 724 |
| 483 | Ga0501084_0004508 | 3300054114 | Bacteria | 11385 |
| 484 | Ga0501084_0190944 | 3300054114 | Bacteria | 1728 |
| 485 | Ga0501084_1350900 | 3300054114 | Bacteria | 597 |
| 486 | Ga0501084_1374492 | 3300054114 | Bacteria | 592 |
| 487 | Ga0501082_0003580 | 3300060353 | Bacteria | 13565 |
| 488 | Ga0501082_0066797 | 3300060353 | Bacteria | 3097 |
| 489 | Ga0501082_0076619 | 3300060353 | Bacteria | 2883 |
| 490 | Ga0501082_0602029 | 3300060353 | Bacteria | 962 |
| 491 | Ga0501082_0932897 | 3300060353 | Bacteria | 759 |
| 492 | Ga0501082_1004652 | 3300060353 | Bacteria | 729 |
| 493 | Ga0530510_0224243 | 3300061734 | Bacteria | 1397 |
| 494 | Ga0530510_0317947 | 3300061734 | Bacteria | 1167 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050495 | nmdc:mga04h51_154307_c1 | nmdc:mga04h51_154307_c1_12_449 | 133 |
| 2 | 3300049591 | Ga0501075_0766701 | Ga0501075_0766701_73_675 | 141 |
| 3 | 3300049743 | Ga0501081_0213504 | Ga0501081_0213504_363_965 | 141 |
| 4 | 3300035398 | Ga0316574_0386334 | Ga0316574_0386334_11_460 | 144 |
| 5 | 3300048911 | Ga0496108_1626330 | Ga0496108_1626330_11_460 | 144 |
| 6 | 3300050490 | nmdc:mga03n38_64554_c1 | nmdc:mga03n38_64554_c1_10_468 | 144 |
| 7 | 3300060353 | Ga0501082_1004652 | Ga0501082_1004652_268_717 | 144 |
| 8 | 3300048911 | Ga0496108_0041999 | Ga0496108_0041999_29_472 | 145 |
| 9 | 3300031456 | Ga0307513_10006480 | Ga0307513_1000648012 | 146 |
| 10 | 3300033180 | Ga0307510_10525719 | Ga0307510_105257191 | 146 |
| 11 | 3300048907 | Ga0496104_1549736 | Ga0496104_1549736_95_550 | 146 |
| 12 | 3300053093 | Ga0500651_0186440 | Ga0500651_0186440_727_1212 | 146 |
| 13 | 3300053096 | Ga0500641_0074935 | Ga0500641_0074935_634_1119 | 146 |
| 14 | 3300053098 | Ga0500650_0379082 | Ga0500650_0379082_89_574 | 146 |
| 15 | 3300053130 | Ga0500642_0027873 | Ga0500642_0027873_1118_1603 | 146 |
| 16 | 3300006042 | Ga0075368_10019000 | Ga0075368_100190002 | 149 |
| 17 | 3300006048 | Ga0075363_100074091 | Ga0075363_1000740913 | 149 |
| 18 | 3300050490 | nmdc:mga03n38_248897_c1 | nmdc:mga03n38_248897_c1_37_522 | 149 |
| 19 | 3300050491 | nmdc:mga00v17_274108_c1 | nmdc:mga00v17_274108_c1_207_692 | 149 |
| 20 | 3300050493 | nmdc:mga0k408_603207_c1 | nmdc:mga0k408_603207_c1_128_613 | 149 |
| 21 | 3300006048 | Ga0075363_100124002 | Ga0075363_1001240021 | 151 |
| 22 | 3300050490 | nmdc:mga03n38_76060_c1 | nmdc:mga03n38_76060_c1_810_1295 | 151 |
| 23 | 3300005334 | Ga0068869_100571923 | Ga0068869_1005719232 | 152 |
| 24 | 3300048908 | Ga0496105_0623254 | Ga0496105_0623254_351_824 | 152 |
| 25 | 3300006177 | Ga0075362_10169736 | Ga0075362_101697362 | 157 |
| 26 | 3300050489 | nmdc:mga03683_10698_c1 | nmdc:mga03683_10698_c1_974_1450 | 157 |
| 27 | 3300050489 | nmdc:mga03683_346738_c1 | nmdc:mga03683_346738_c1_59_535 | 157 |
| 28 | 3300005328 | Ga0070676_10393138 | Ga0070676_103931382 | 158 |
| 29 | 3300005347 | Ga0070668_101236339 | Ga0070668_1012363392 | 158 |
| 30 | 3300005356 | Ga0070674_100883085 | Ga0070674_1008830852 | 158 |
| 31 | 3300005445 | Ga0070708_100181252 | Ga0070708_1001812523 | 158 |
| 32 | 3300005459 | Ga0068867_100409284 | Ga0068867_1004092842 | 158 |
| 33 | 3300005468 | Ga0070707_100011550 | Ga0070707_1000115509 | 158 |
| 34 | 3300005548 | Ga0070665_102140687 | Ga0070665_1021406871 | 158 |
| 35 | 3300005844 | Ga0068862_101058162 | Ga0068862_1010581622 | 158 |
| 36 | 3300006186 | Ga0075369_10134750 | Ga0075369_101347502 | 158 |
| 37 | 3300009177 | Ga0105248_10083978 | Ga0105248_100839784 | 158 |
| 38 | 3300025907 | Ga0207645_10127865 | Ga0207645_101278651 | 158 |
| 39 | 3300025922 | Ga0207646_10053931 | Ga0207646_100539312 | 158 |
| 40 | 3300025934 | Ga0207686_10376526 | Ga0207686_103765262 | 158 |
| 41 | 3300025937 | Ga0207669_10642724 | Ga0207669_106427241 | 158 |
| 42 | 3300025941 | Ga0207711_10054032 | Ga0207711_100540324 | 158 |
| 43 | 3300025972 | Ga0207668_10356862 | Ga0207668_103568621 | 158 |
| 44 | 3300025986 | Ga0207658_11002244 | Ga0207658_110022441 | 158 |
| 45 | 3300026067 | Ga0207678_11023488 | Ga0207678_110234881 | 158 |
| 46 | 3300026089 | Ga0207648_10653299 | Ga0207648_106532991 | 158 |
| 47 | 3300028380 | Ga0268265_10777811 | Ga0268265_107778111 | 158 |
| 48 | 3300028381 | Ga0268264_10264660 | Ga0268264_102646602 | 158 |
| 49 | 3300031548 | Ga0307408_100188514 | Ga0307408_1001885142 | 158 |
| 50 | 3300039453 | Ga0436362_0145567 | Ga0436362_0145567_53_535 | 158 |
| 51 | 3300047469 | Ga0495673_0063019 | Ga0495673_0063019_426_902 | 158 |
| 52 | 3300047472 | Ga0495686_0000131 | Ga0495686_0000131_35800_36276 | 158 |
| 53 | 3300048906 | Ga0496103_0278140 | Ga0496103_0278140_102_581 | 158 |
| 54 | 3300048909 | Ga0496106_0196508 | Ga0496106_0196508_426_905 | 158 |
| 55 | 3300048910 | Ga0496107_1065074 | Ga0496107_1065074_55_534 | 158 |
| 56 | 3300048920 | Ga0496117_0059439 | Ga0496117_0059439_1607_2083 | 158 |
| 57 | 3300048921 | Ga0496118_0013943 | Ga0496118_0013943_5368_5844 | 158 |
| 58 | 3300048922 | Ga0496119_0017491 | Ga0496119_0017491_3178_3654 | 158 |
| 59 | 3300049569 | Ga0501032_0147108 | Ga0501032_0147108_687_1163 | 158 |
| 60 | 3300049579 | Ga0501043_0089462 | Ga0501043_0089462_837_1313 | 158 |
| 61 | 3300049581 | Ga0501047_0237495 | Ga0501047_0237495_751_1227 | 158 |
| 62 | 3300005327 | Ga0070658_10034310 | Ga0070658_100343102 | 159 |
| 63 | 3300005328 | Ga0070676_10003900 | Ga0070676_100039006 | 159 |
| 64 | 3300005334 | Ga0068869_100043663 | Ga0068869_1000436632 | 159 |
| 65 | 3300005354 | Ga0070675_100622145 | Ga0070675_1006221452 | 159 |
| 66 | 3300005457 | Ga0070662_100758756 | Ga0070662_1007587562 | 159 |
| 67 | 3300005543 | Ga0070672_100422353 | Ga0070672_1004223532 | 159 |
| 68 | 3300005719 | Ga0068861_101320587 | Ga0068861_1013205871 | 159 |
| 69 | 3300005937 | Ga0081455_10482649 | Ga0081455_104826492 | 159 |
| 70 | 3300006881 | Ga0068865_100455148 | Ga0068865_1004551482 | 159 |
| 71 | 3300009551 | Ga0105238_10608827 | Ga0105238_106088272 | 159 |
| 72 | 3300010375 | Ga0105239_10510003 | Ga0105239_105100032 | 159 |
| 73 | 3300010375 | Ga0105239_10541082 | Ga0105239_105410822 | 159 |
| 74 | 3300014326 | Ga0157380_10342618 | Ga0157380_103426182 | 159 |
| 75 | 3300014968 | Ga0157379_10370037 | Ga0157379_103700371 | 159 |
| 76 | 3300014968 | Ga0157379_10417927 | Ga0157379_104179273 | 159 |
| 77 | 3300025907 | Ga0207645_10010078 | Ga0207645_100100782 | 159 |
| 78 | 3300025936 | Ga0207670_11331945 | Ga0207670_113319451 | 159 |
| 79 | 3300025938 | Ga0207704_10345240 | Ga0207704_103452401 | 159 |
| 80 | 3300025981 | Ga0207640_11102589 | Ga0207640_111025892 | 159 |
| 81 | 3300026089 | Ga0207648_10462900 | Ga0207648_104629002 | 159 |
| 82 | 3300046616 | Ga0495668_0242951 | Ga0495668_0242951_10_504 | 159 |
| 83 | 3300048904 | Ga0496101_0609407 | Ga0496101_0609407_87_572 | 159 |
| 84 | 3300048905 | Ga0496102_0075957 | Ga0496102_0075957_1479_1964 | 159 |
| 85 | 3300048907 | Ga0496104_0024498 | Ga0496104_0024498_1724_2209 | 159 |
| 86 | 3300048912 | Ga0496109_0125585 | Ga0496109_0125585_1409_1894 | 159 |
| 87 | 3300048914 | Ga0496111_0084786 | Ga0496111_0084786_52_537 | 159 |
| 88 | 3300048915 | Ga0496112_0059563 | Ga0496112_0059563_986_1471 | 159 |
| 89 | 3300048917 | Ga0496114_0361235 | Ga0496114_0361235_50_535 | 159 |
| 90 | 3300048918 | Ga0496115_0017042 | Ga0496115_0017042_3213_3698 | 159 |
| 91 | 3300050512 | nmdc:mga0n895_308240_c1 | nmdc:mga0n895_308240_c1_769_1272 | 159 |
| 92 | 3300000546 | LJNas_1011792 | LJNas_10117922 | 160 |
| 93 | 3300003911 | JGI25405J52794_10034275 | JGI25405J52794_100342751 | 160 |
| 94 | 3300004800 | Ga0058861_11445454 | Ga0058861_114454541 | 160 |
| 95 | 3300005328 | Ga0070676_10524868 | Ga0070676_105248681 | 160 |
| 96 | 3300005328 | Ga0070676_10863177 | Ga0070676_108631771 | 160 |
| 97 | 3300005334 | Ga0068869_100429567 | Ga0068869_1004295672 | 160 |
| 98 | 3300005336 | Ga0070680_100012963 | Ga0070680_1000129631 | 160 |
| 99 | 3300005336 | Ga0070680_100042194 | Ga0070680_1000421943 | 160 |
| 100 | 3300005337 | Ga0070682_100008980 | Ga0070682_1000089804 | 160 |
| 101 | 3300005339 | Ga0070660_100039356 | Ga0070660_1000393563 | 160 |
| 102 | 3300005343 | Ga0070687_100244839 | Ga0070687_1002448391 | 160 |
| 103 | 3300005344 | Ga0070661_100462794 | Ga0070661_1004627942 | 160 |
| 104 | 3300005345 | Ga0070692_10375646 | Ga0070692_103756462 | 160 |
| 105 | 3300005347 | Ga0070668_100223682 | Ga0070668_1002236821 | 160 |
| 106 | 3300005347 | Ga0070668_100265860 | Ga0070668_1002658602 | 160 |
| 107 | 3300005365 | Ga0070688_100574285 | Ga0070688_1005742852 | 160 |
| 108 | 3300005366 | Ga0070659_100042196 | Ga0070659_1000421964 | 160 |
| 109 | 3300005366 | Ga0070659_100886943 | Ga0070659_1008869432 | 160 |
| 110 | 3300005367 | Ga0070667_100398586 | Ga0070667_1003985862 | 160 |
| 111 | 3300005406 | Ga0070703_10001032 | Ga0070703_100010328 | 160 |
| 112 | 3300005434 | Ga0070709_10513181 | Ga0070709_105131812 | 160 |
| 113 | 3300005436 | Ga0070713_100127292 | Ga0070713_1001272922 | 160 |
| 114 | 3300005438 | Ga0070701_10210988 | Ga0070701_102109882 | 160 |
| 115 | 3300005439 | Ga0070711_100206967 | Ga0070711_1002069672 | 160 |
| 116 | 3300005439 | Ga0070711_100412875 | Ga0070711_1004128752 | 160 |
| 117 | 3300005440 | Ga0070705_100000057 | Ga0070705_10000005718 | 160 |
| 118 | 3300005440 | Ga0070705_100020481 | Ga0070705_1000204814 | 160 |
| 119 | 3300005441 | Ga0070700_100024128 | Ga0070700_1000241283 | 160 |
| 120 | 3300005441 | Ga0070700_100229525 | Ga0070700_1002295252 | 160 |
| 121 | 3300005441 | Ga0070700_100512875 | Ga0070700_1005128751 | 160 |
| 122 | 3300005441 | Ga0070700_101185888 | Ga0070700_1011858881 | 160 |
| 123 | 3300005444 | Ga0070694_100101889 | Ga0070694_1001018891 | 160 |
| 124 | 3300005445 | Ga0070708_100010655 | Ga0070708_1000106554 | 160 |
| 125 | 3300005455 | Ga0070663_100006259 | Ga0070663_1000062598 | 160 |
| 126 | 3300005455 | Ga0070663_100839884 | Ga0070663_1008398842 | 160 |
| 127 | 3300005457 | Ga0070662_100445574 | Ga0070662_1004455741 | 160 |
| 128 | 3300005457 | Ga0070662_101264619 | Ga0070662_1012646191 | 160 |
| 129 | 3300005458 | Ga0070681_10001360 | Ga0070681_100013608 | 160 |
| 130 | 3300005458 | Ga0070681_10054060 | Ga0070681_100540604 | 160 |
| 131 | 3300005459 | Ga0068867_100717525 | Ga0068867_1007175252 | 160 |
| 132 | 3300005471 | Ga0070698_100172967 | Ga0070698_1001729673 | 160 |
| 133 | 3300005518 | Ga0070699_100000158 | Ga0070699_10000015857 | 160 |
| 134 | 3300005530 | Ga0070679_100053846 | Ga0070679_1000538463 | 160 |
| 135 | 3300005536 | Ga0070697_100142163 | Ga0070697_1001421632 | 160 |
| 136 | 3300005539 | Ga0068853_100003714 | Ga0068853_1000037148 | 160 |
| 137 | 3300005545 | Ga0070695_100000439 | Ga0070695_1000004398 | 160 |
| 138 | 3300005545 | Ga0070695_100073683 | Ga0070695_1000736833 | 160 |
| 139 | 3300005545 | Ga0070695_100352627 | Ga0070695_1003526271 | 160 |
| 140 | 3300005546 | Ga0070696_100009530 | Ga0070696_1000095305 | 160 |
| 141 | 3300005546 | Ga0070696_100012791 | Ga0070696_1000127913 | 160 |
| 142 | 3300005546 | Ga0070696_100042585 | Ga0070696_1000425853 | 160 |
| 143 | 3300005547 | Ga0070693_100003679 | Ga0070693_1000036794 | 160 |
| 144 | 3300005547 | Ga0070693_100866716 | Ga0070693_1008667161 | 160 |
| 145 | 3300005548 | Ga0070665_100319489 | Ga0070665_1003194891 | 160 |
| 146 | 3300005548 | Ga0070665_101437852 | Ga0070665_1014378522 | 160 |
| 147 | 3300005549 | Ga0070704_100000383 | Ga0070704_1000003834 | 160 |
| 148 | 3300005549 | Ga0070704_100066322 | Ga0070704_1000663223 | 160 |
| 149 | 3300005549 | Ga0070704_100833917 | Ga0070704_1008339171 | 160 |
| 150 | 3300005563 | Ga0068855_100272718 | Ga0068855_1002727182 | 160 |
| 151 | 3300005563 | Ga0068855_101251822 | Ga0068855_1012518221 | 160 |
| 152 | 3300005577 | Ga0068857_100017152 | Ga0068857_1000171524 | 160 |
| 153 | 3300005577 | Ga0068857_100063586 | Ga0068857_1000635861 | 160 |
| 154 | 3300005615 | Ga0070702_100048377 | Ga0070702_1000483772 | 160 |
| 155 | 3300005615 | Ga0070702_100061875 | Ga0070702_1000618752 | 160 |
| 156 | 3300005616 | Ga0068852_100109599 | Ga0068852_1001095993 | 160 |
| 157 | 3300005617 | Ga0068859_100004801 | Ga0068859_1000048011 | 160 |
| 158 | 3300005618 | Ga0068864_100215544 | Ga0068864_1002155442 | 160 |
| 159 | 3300005719 | Ga0068861_100135274 | Ga0068861_1001352743 | 160 |
| 160 | 3300005719 | Ga0068861_100156077 | Ga0068861_1001560773 | 160 |
| 161 | 3300005719 | Ga0068861_100197926 | Ga0068861_1001979261 | 160 |
| 162 | 3300005834 | Ga0068851_10061132 | Ga0068851_100611321 | 160 |
| 163 | 3300005840 | Ga0068870_10167215 | Ga0068870_101672152 | 160 |
| 164 | 3300005842 | Ga0068858_100133314 | Ga0068858_1001333143 | 160 |
| 165 | 3300005843 | Ga0068860_100035993 | Ga0068860_1000359934 | 160 |
| 166 | 3300005843 | Ga0068860_100164644 | Ga0068860_1001646443 | 160 |
| 167 | 3300005844 | Ga0068862_100001821 | Ga0068862_10000182111 | 160 |
| 168 | 3300005937 | Ga0081455_10009824 | Ga0081455_100098247 | 160 |
| 169 | 3300005983 | Ga0081540_1000165 | Ga0081540_100016519 | 160 |
| 170 | 3300005983 | Ga0081540_1000873 | Ga0081540_100087322 | 160 |
| 171 | 3300006038 | Ga0075365_10014899 | Ga0075365_100148994 | 160 |
| 172 | 3300006038 | Ga0075365_10047112 | Ga0075365_100471123 | 160 |
| 173 | 3300006038 | Ga0075365_10091608 | Ga0075365_100916083 | 160 |
| 174 | 3300006038 | Ga0075365_10680443 | Ga0075365_106804432 | 160 |
| 175 | 3300006042 | Ga0075368_10008257 | Ga0075368_100082574 | 160 |
| 176 | 3300006048 | Ga0075363_100003941 | Ga0075363_1000039413 | 160 |
| 177 | 3300006048 | Ga0075363_100016578 | Ga0075363_1000165783 | 160 |
| 178 | 3300006048 | Ga0075363_100339105 | Ga0075363_1003391051 | 160 |
| 179 | 3300006051 | Ga0075364_10009087 | Ga0075364_100090877 | 160 |
| 180 | 3300006173 | Ga0070716_100623214 | Ga0070716_1006232142 | 160 |
| 181 | 3300006178 | Ga0075367_10007360 | Ga0075367_100073603 | 160 |
| 182 | 3300006178 | Ga0075367_10129049 | Ga0075367_101290492 | 160 |
| 183 | 3300006353 | Ga0075370_10719393 | Ga0075370_107193931 | 160 |
| 184 | 3300006844 | Ga0075428_100003086 | Ga0075428_1000030862 | 160 |
| 185 | 3300006844 | Ga0075428_100173041 | Ga0075428_1001730412 | 160 |
| 186 | 3300006846 | Ga0075430_100046367 | Ga0075430_1000463672 | 160 |
| 187 | 3300006847 | Ga0075431_100016100 | Ga0075431_1000161002 | 160 |
| 188 | 3300006847 | Ga0075431_100026132 | Ga0075431_1000261325 | 160 |
| 189 | 3300006852 | Ga0075433_10005783 | Ga0075433_100057839 | 160 |
| 190 | 3300006852 | Ga0075433_10727296 | Ga0075433_107272961 | 160 |
| 191 | 3300006871 | Ga0075434_100055224 | Ga0075434_1000552244 | 160 |
| 192 | 3300006871 | Ga0075434_100562246 | Ga0075434_1005622462 | 160 |
| 193 | 3300006881 | Ga0068865_100127167 | Ga0068865_1001271672 | 160 |
| 194 | 3300006931 | Ga0097620_100004801 | Ga0097620_1000048011 | 160 |
| 195 | 3300007076 | Ga0075435_100009318 | Ga0075435_1000093185 | 160 |
| 196 | 3300007265 | Ga0099794_10177815 | Ga0099794_101778152 | 160 |
| 197 | 3300007265 | Ga0099794_10266434 | Ga0099794_102664342 | 160 |
| 198 | 3300007788 | Ga0099795_10325785 | Ga0099795_103257851 | 160 |
| 199 | 3300009094 | Ga0111539_10007284 | Ga0111539_100072847 | 160 |
| 200 | 3300009094 | Ga0111539_10095202 | Ga0111539_100952024 | 160 |
| 201 | 3300009094 | Ga0111539_10190885 | Ga0111539_101908851 | 160 |
| 202 | 3300009094 | Ga0111539_10219011 | Ga0111539_102190112 | 160 |
| 203 | 3300009094 | Ga0111539_12140740 | Ga0111539_121407401 | 160 |
| 204 | 3300009101 | Ga0105247_10455656 | Ga0105247_104556561 | 160 |
| 205 | 3300009147 | Ga0114129_10061159 | Ga0114129_100611596 | 160 |
| 206 | 3300009147 | Ga0114129_10369823 | Ga0114129_103698232 | 160 |
| 207 | 3300009148 | Ga0105243_10236470 | Ga0105243_102364702 | 160 |
| 208 | 3300009148 | Ga0105243_10260798 | Ga0105243_102607982 | 160 |
| 209 | 3300009174 | Ga0105241_10091409 | Ga0105241_100914092 | 160 |
| 210 | 3300009174 | Ga0105241_11272778 | Ga0105241_112727781 | 160 |
| 211 | 3300009545 | Ga0105237_10004832 | Ga0105237_100048321 | 160 |
| 212 | 3300009545 | Ga0105237_11059025 | Ga0105237_110590251 | 160 |
| 213 | 3300009545 | Ga0105237_12089590 | Ga0105237_120895901 | 160 |
| 214 | 3300009553 | Ga0105249_10308927 | Ga0105249_103089271 | 160 |
| 215 | 3300009553 | Ga0105249_10369753 | Ga0105249_103697532 | 160 |
| 216 | 3300010159 | Ga0099796_10164801 | Ga0099796_101648012 | 160 |
| 217 | 3300010375 | Ga0105239_10131194 | Ga0105239_101311943 | 160 |
| 218 | 3300010375 | Ga0105239_10733482 | Ga0105239_107334822 | 160 |
| 219 | 3300011119 | Ga0105246_10294155 | Ga0105246_102941551 | 160 |
| 220 | 3300011119 | Ga0105246_10322668 | Ga0105246_103226682 | 160 |
| 221 | 3300013297 | Ga0157378_11451519 | Ga0157378_114515192 | 160 |
| 222 | 3300013306 | Ga0163162_10567298 | Ga0163162_105672983 | 160 |
| 223 | 3300014745 | Ga0157377_10373783 | Ga0157377_103737832 | 160 |
| 224 | 3300014968 | Ga0157379_10076461 | Ga0157379_100764613 | 160 |
| 225 | 3300014969 | Ga0157376_10116850 | Ga0157376_101168503 | 160 |
| 226 | 3300014969 | Ga0157376_11199974 | Ga0157376_111999741 | 160 |
| 227 | 3300025321 | Ga0207656_10423866 | Ga0207656_104238662 | 160 |
| 228 | 3300025885 | Ga0207653_10001713 | Ga0207653_100017135 | 160 |
| 229 | 3300025904 | Ga0207647_10004485 | Ga0207647_1000448511 | 160 |
| 230 | 3300025909 | Ga0207705_10240566 | Ga0207705_102405663 | 160 |
| 231 | 3300025910 | Ga0207684_11163139 | Ga0207684_111631391 | 160 |
| 232 | 3300025911 | Ga0207654_10344159 | Ga0207654_103441592 | 160 |
| 233 | 3300025912 | Ga0207707_10009970 | Ga0207707_100099704 | 160 |
| 234 | 3300025912 | Ga0207707_10018713 | Ga0207707_100187134 | 160 |
| 235 | 3300025913 | Ga0207695_10368296 | Ga0207695_103682962 | 160 |
| 236 | 3300025914 | Ga0207671_10048996 | Ga0207671_100489964 | 160 |
| 237 | 3300025916 | Ga0207663_10047945 | Ga0207663_100479452 | 160 |
| 238 | 3300025917 | Ga0207660_10002741 | Ga0207660_100027416 | 160 |
| 239 | 3300025917 | Ga0207660_10325505 | Ga0207660_103255051 | 160 |
| 240 | 3300025918 | Ga0207662_10468547 | Ga0207662_104685471 | 160 |
| 241 | 3300025919 | Ga0207657_10051808 | Ga0207657_100518083 | 160 |
| 242 | 3300025920 | Ga0207649_10700715 | Ga0207649_107007152 | 160 |
| 243 | 3300025921 | Ga0207652_10063744 | Ga0207652_100637444 | 160 |
| 244 | 3300025924 | Ga0207694_10050597 | Ga0207694_100505974 | 160 |
| 245 | 3300025926 | Ga0207659_10629448 | Ga0207659_106294482 | 160 |
| 246 | 3300025932 | Ga0207690_10006536 | Ga0207690_100065363 | 160 |
| 247 | 3300025932 | Ga0207690_10314264 | Ga0207690_103142642 | 160 |
| 248 | 3300025933 | Ga0207706_10033999 | Ga0207706_100339992 | 160 |
| 249 | 3300025933 | Ga0207706_10551380 | Ga0207706_105513802 | 160 |
| 250 | 3300025935 | Ga0207709_10318361 | Ga0207709_103183612 | 160 |
| 251 | 3300025937 | Ga0207669_10913578 | Ga0207669_109135781 | 160 |
| 252 | 3300025938 | Ga0207704_10421618 | Ga0207704_104216182 | 160 |
| 253 | 3300025939 | Ga0207665_10555041 | Ga0207665_105550412 | 160 |
| 254 | 3300025942 | Ga0207689_10144453 | Ga0207689_101444533 | 160 |
| 255 | 3300025949 | Ga0207667_10031461 | Ga0207667_100314613 | 160 |
| 256 | 3300025949 | Ga0207667_10863362 | Ga0207667_108633622 | 160 |
| 257 | 3300025961 | Ga0207712_10040945 | Ga0207712_100409452 | 160 |
| 258 | 3300025972 | Ga0207668_10154905 | Ga0207668_101549052 | 160 |
| 259 | 3300025986 | Ga0207658_10369961 | Ga0207658_103699612 | 160 |
| 260 | 3300025986 | Ga0207658_11313798 | Ga0207658_113137981 | 160 |
| 261 | 3300026035 | Ga0207703_10116131 | Ga0207703_101161313 | 160 |
| 262 | 3300026067 | Ga0207678_10000049 | Ga0207678_1000004971 | 160 |
| 263 | 3300026075 | Ga0207708_10100215 | Ga0207708_101002154 | 160 |
| 264 | 3300026075 | Ga0207708_11218246 | Ga0207708_112182462 | 160 |
| 265 | 3300026095 | Ga0207676_10114765 | Ga0207676_101147652 | 160 |
| 266 | 3300026116 | Ga0207674_10002164 | Ga0207674_100021644 | 160 |
| 267 | 3300026118 | Ga0207675_100018399 | Ga0207675_1000183995 | 160 |
| 268 | 3300026118 | Ga0207675_100148176 | Ga0207675_1001481761 | 160 |
| 269 | 3300026118 | Ga0207675_100173564 | Ga0207675_1001735642 | 160 |
| 270 | 3300026142 | Ga0207698_10171092 | Ga0207698_101710923 | 160 |
| 271 | 3300027671 | Ga0209588_1099839 | Ga0209588_10998392 | 160 |
| 272 | 3300027866 | Ga0209813_10004386 | Ga0209813_100043865 | 160 |
| 273 | 3300027866 | Ga0209813_10006413 | Ga0209813_100064132 | 160 |
| 274 | 3300027907 | Ga0207428_10193477 | Ga0207428_101934772 | 160 |
| 275 | 3300028016 | Ga0265354_1000582 | Ga0265354_10005822 | 160 |
| 276 | 3300028017 | Ga0265356_1000339 | Ga0265356_10003397 | 160 |
| 277 | 3300028036 | Ga0265355_1010605 | Ga0265355_10106052 | 160 |
| 278 | 3300028379 | Ga0268266_11183106 | Ga0268266_111831061 | 160 |
| 279 | 3300028380 | Ga0268265_10001771 | Ga0268265_100017715 | 160 |
| 280 | 3300028380 | Ga0268265_10137699 | Ga0268265_101376993 | 160 |
| 281 | 3300028381 | Ga0268264_10020410 | Ga0268264_100204102 | 160 |
| 282 | 3300028381 | Ga0268264_10145477 | Ga0268264_101454772 | 160 |
| 283 | 3300028800 | Ga0265338_10182404 | Ga0265338_101824042 | 160 |
| 284 | 3300030879 | Ga0265765_1005906 | Ga0265765_10059062 | 160 |
| 285 | 3300031090 | Ga0265760_10001220 | Ga0265760_100012208 | 160 |
| 286 | 3300031090 | Ga0265760_10008637 | Ga0265760_100086372 | 160 |
| 287 | 3300031247 | Ga0265340_10056887 | Ga0265340_100568872 | 160 |
| 288 | 3300031247 | Ga0265340_10104127 | Ga0265340_101041272 | 160 |
| 289 | 3300031249 | Ga0265339_10136124 | Ga0265339_101361242 | 160 |
| 290 | 3300031691 | Ga0316579_10182410 | Ga0316579_101824102 | 160 |
| 291 | 3300031727 | Ga0316576_10014299 | Ga0316576_100142994 | 160 |
| 292 | 3300031728 | Ga0316578_10020177 | Ga0316578_100201774 | 160 |
| 293 | 3300031730 | Ga0307516_10000033 | Ga0307516_1000003357 | 160 |
| 294 | 3300031731 | Ga0307405_10157201 | Ga0307405_101572012 | 160 |
| 295 | 3300031901 | Ga0307406_10091551 | Ga0307406_100915512 | 160 |
| 296 | 3300031901 | Ga0307406_10736809 | Ga0307406_107368091 | 160 |
| 297 | 3300032126 | Ga0307415_100623095 | Ga0307415_1006230951 | 160 |
| 298 | 3300033180 | Ga0307510_10455513 | Ga0307510_104555131 | 160 |
| 299 | 3300033545 | Ga0316214_1028342 | Ga0316214_10283421 | 160 |
| 300 | 3300035085 | Ga0373929_0026734 | Ga0373929_0026734_57_542 | 160 |
| 301 | 3300035088 | Ga0373940_0003224 | Ga0373940_0003224_1557_2042 | 160 |
| 302 | 3300035090 | Ga0373949_0077570 | Ga0373949_0077570_249_734 | 160 |
| 303 | 3300035114 | Ga0373939_0000782 | Ga0373939_0000782_6877_7362 | 160 |
| 304 | 3300035115 | Ga0373941_0342056 | Ga0373941_0342056_98_583 | 160 |
| 305 | 3300035117 | Ga0373953_0023411 | Ga0373953_0023411_291_788 | 160 |
| 306 | 3300035118 | Ga0373954_0063711 | Ga0373954_0063711_260_757 | 160 |
| 307 | 3300035172 | Ga0373955_0009949 | Ga0373955_0009949_3741_4238 | 160 |
| 308 | 3300035398 | Ga0316574_0131058 | Ga0316574_0131058_98_586 | 160 |
| 309 | 3300035410 | Ga0373924_0152810 | Ga0373924_0152810_188_685 | 160 |
| 310 | 3300035691 | Ga0373931_0000272 | Ga0373931_0000272_21307_21792 | 160 |
| 311 | 3300035692 | Ga0373935_0220308 | Ga0373935_0220308_68_565 | 160 |
| 312 | 3300035724 | Ga0373933_0161144 | Ga0373933_0161144_857_1354 | 160 |
| 313 | 3300035724 | Ga0373933_0818228 | Ga0373933_0818228_76_558 | 160 |
| 314 | 3300036401 | Ga0373937_0346313 | Ga0373937_0346313_660_1142 | 160 |
| 315 | 3300036401 | Ga0373937_0597626 | Ga0373937_0597626_61_558 | 160 |
| 316 | 3300036712 | Ga0316584_0006667 | Ga0316584_0006667_2659_3147 | 160 |
| 317 | 3300037068 | Ga0373925_0087452 | Ga0373925_0087452_983_1465 | 160 |
| 318 | 3300037312 | Ga0395899_0038776 | Ga0395899_0038776_172_657 | 160 |
| 319 | 3300037418 | Ga0395900_0034029 | Ga0395900_0034029_138_635 | 160 |
| 320 | 3300037418 | Ga0395900_0803843 | Ga0395900_0803843_41_538 | 160 |
| 321 | 3300037466 | Ga0395898_0025574 | Ga0395898_0025574_168_665 | 160 |
| 322 | 3300037466 | Ga0395898_0257832 | Ga0395898_0257832_966_1463 | 160 |
| 323 | 3300037466 | Ga0395898_0462559 | Ga0395898_0462559_448_945 | 160 |
| 324 | 3300038443 | Ga0395901_0237900 | Ga0395901_0237900_633_1130 | 160 |
| 325 | 3300039062 | Ga0400483_055574 | Ga0400483_055574_132_614 | 160 |
| 326 | 3300045051 | Ga0451576_0127783 | Ga0451576_0127783_1792_2274 | 160 |
| 327 | 3300046462 | Ga0495651_0189031 | Ga0495651_0189031_490_987 | 160 |
| 328 | 3300046477 | Ga0495664_0085585 | Ga0495664_0085585_498_995 | 160 |
| 329 | 3300046491 | Ga0495584_0567732 | Ga0495584_0567732_23_508 | 160 |
| 330 | 3300046529 | Ga0495652_0202075 | Ga0495652_0202075_522_1019 | 160 |
| 331 | 3300046536 | Ga0495587_0081590 | Ga0495587_0081590_911_1408 | 160 |
| 332 | 3300046664 | Ga0495659_0159407 | Ga0495659_0159407_179_664 | 160 |
| 333 | 3300046684 | Ga0495669_0536724 | Ga0495669_0536724_51_548 | 160 |
| 334 | 3300047317 | Ga0495604_0357218 | Ga0495604_0357218_441_923 | 160 |
| 335 | 3300047319 | Ga0495674_0819303 | Ga0495674_0819303_194_691 | 160 |
| 336 | 3300047322 | Ga0495680_0477821 | Ga0495680_0477821_301_798 | 160 |
| 337 | 3300047444 | Ga0495675_0341556 | Ga0495675_0341556_213_710 | 160 |
| 338 | 3300048903 | Ga0496100_0132157 | Ga0496100_0132157_56_553 | 160 |
| 339 | 3300048904 | Ga0496101_0195191 | Ga0496101_0195191_824_1321 | 160 |
| 340 | 3300048905 | Ga0496102_0002036 | Ga0496102_0002036_75_560 | 160 |
| 341 | 3300048905 | Ga0496102_0006561 | Ga0496102_0006561_5872_6369 | 160 |
| 342 | 3300048905 | Ga0496102_0138838 | Ga0496102_0138838_1405_1902 | 160 |
| 343 | 3300048905 | Ga0496102_0874884 | Ga0496102_0874884_241_729 | 160 |
| 344 | 3300048906 | Ga0496103_0071483 | Ga0496103_0071483_1199_1696 | 160 |
| 345 | 3300048906 | Ga0496103_0131528 | Ga0496103_0131528_186_671 | 160 |
| 346 | 3300048907 | Ga0496104_0001121 | Ga0496104_0001121_20020_20508 | 160 |
| 347 | 3300048907 | Ga0496104_0009288 | Ga0496104_0009288_4499_4981 | 160 |
| 348 | 3300048907 | Ga0496104_0735204 | Ga0496104_0735204_250_738 | 160 |
| 349 | 3300048908 | Ga0496105_0319961 | Ga0496105_0319961_660_1142 | 160 |
| 350 | 3300048909 | Ga0496106_0003493 | Ga0496106_0003493_11145_11642 | 160 |
| 351 | 3300048909 | Ga0496106_0015956 | Ga0496106_0015956_5010_5495 | 160 |
| 352 | 3300048910 | Ga0496107_0020753 | Ga0496107_0020753_2159_2644 | 160 |
| 353 | 3300048910 | Ga0496107_0052193 | Ga0496107_0052193_236_733 | 160 |
| 354 | 3300048910 | Ga0496107_0759377 | Ga0496107_0759377_142_624 | 160 |
| 355 | 3300048911 | Ga0496108_0049676 | Ga0496108_0049676_2388_2876 | 160 |
| 356 | 3300048912 | Ga0496109_0021712 | Ga0496109_0021712_547_1035 | 160 |
| 357 | 3300048912 | Ga0496109_1343841 | Ga0496109_1343841_38_535 | 160 |
| 358 | 3300048913 | Ga0496110_0054366 | Ga0496110_0054366_2263_2751 | 160 |
| 359 | 3300048913 | Ga0496110_1178727 | Ga0496110_1178727_69_554 | 160 |
| 360 | 3300048914 | Ga0496111_0036443 | Ga0496111_0036443_2376_2864 | 160 |
| 361 | 3300048914 | Ga0496111_0572773 | Ga0496111_0572773_323_811 | 160 |
| 362 | 3300048916 | Ga0496113_0486610 | Ga0496113_0486610_151_639 | 160 |
| 363 | 3300048917 | Ga0496114_0301616 | Ga0496114_0301616_757_1254 | 160 |
| 364 | 3300048917 | Ga0496114_0329131 | Ga0496114_0329131_438_920 | 160 |
| 365 | 3300048918 | Ga0496115_0018108 | Ga0496115_0018108_1730_2227 | 160 |
| 366 | 3300048918 | Ga0496115_0061098 | Ga0496115_0061098_1107_1589 | 160 |
| 367 | 3300048918 | Ga0496115_0329371 | Ga0496115_0329371_11_496 | 160 |
| 368 | 3300049569 | Ga0501032_0254758 | Ga0501032_0254758_607_1104 | 160 |
| 369 | 3300049570 | Ga0501033_0160474 | Ga0501033_0160474_939_1436 | 160 |
| 370 | 3300049570 | Ga0501033_0402335 | Ga0501033_0402335_11_508 | 160 |
| 371 | 3300049571 | Ga0501034_0000014 | Ga0501034_0000014_154335_154832 | 160 |
| 372 | 3300049571 | Ga0501034_0020034 | Ga0501034_0020034_3316_3813 | 160 |
| 373 | 3300049572 | Ga0501036_0193363 | Ga0501036_0193363_558_1106 | 160 |
| 374 | 3300049572 | Ga0501036_0830240 | Ga0501036_0830240_224_721 | 160 |
| 375 | 3300049572 | Ga0501036_0973351 | Ga0501036_0973351_95_592 | 160 |
| 376 | 3300049573 | Ga0501037_0023819 | Ga0501037_0023819_139_621 | 160 |
| 377 | 3300049573 | Ga0501037_0059866 | Ga0501037_0059866_1347_1844 | 160 |
| 378 | 3300049573 | Ga0501037_0533210 | Ga0501037_0533210_211_696 | 160 |
| 379 | 3300049573 | Ga0501037_0618566 | Ga0501037_0618566_200_685 | 160 |
| 380 | 3300049574 | Ga0501038_0160948 | Ga0501038_0160948_135_632 | 160 |
| 381 | 3300049574 | Ga0501038_0701898 | Ga0501038_0701898_189_674 | 160 |
| 382 | 3300049575 | Ga0501039_0000252 | Ga0501039_0000252_15066_15563 | 160 |
| 383 | 3300049575 | Ga0501039_0133245 | Ga0501039_0133245_1133_1618 | 160 |
| 384 | 3300049575 | Ga0501039_0588023 | Ga0501039_0588023_234_731 | 160 |
| 385 | 3300049576 | Ga0501040_0155110 | Ga0501040_0155110_449_946 | 160 |
| 386 | 3300049576 | Ga0501040_0242187 | Ga0501040_0242187_708_1205 | 160 |
| 387 | 3300049577 | Ga0501041_0039799 | Ga0501041_0039799_247_732 | 160 |
| 388 | 3300049577 | Ga0501041_0139359 | Ga0501041_0139359_760_1245 | 160 |
| 389 | 3300049577 | Ga0501041_0402475 | Ga0501041_0402475_59_544 | 160 |
| 390 | 3300049578 | Ga0501042_0443824 | Ga0501042_0443824_137_685 | 160 |
| 391 | 3300049579 | Ga0501043_0417177 | Ga0501043_0417177_227_724 | 160 |
| 392 | 3300049580 | Ga0501046_0016378 | Ga0501046_0016378_607_1104 | 160 |
| 393 | 3300049581 | Ga0501047_0000222 | Ga0501047_0000222_16431_16928 | 160 |
| 394 | 3300049581 | Ga0501047_0097183 | Ga0501047_0097183_2047_2544 | 160 |
| 395 | 3300049581 | Ga0501047_0307512 | Ga0501047_0307512_100_597 | 160 |
| 396 | 3300049582 | Ga0501048_0001086 | Ga0501048_0001086_12058_12555 | 160 |
| 397 | 3300049582 | Ga0501048_0343511 | Ga0501048_0343511_362_859 | 160 |
| 398 | 3300049582 | Ga0501048_0679581 | Ga0501048_0679581_226_711 | 160 |
| 399 | 3300049582 | Ga0501048_0986477 | Ga0501048_0986477_55_540 | 160 |
| 400 | 3300049583 | Ga0501067_0004360 | Ga0501067_0004360_1303_1800 | 160 |
| 401 | 3300049583 | Ga0501067_0015205 | Ga0501067_0015205_2415_2912 | 160 |
| 402 | 3300049583 | Ga0501067_0175698 | Ga0501067_0175698_116_613 | 160 |
| 403 | 3300049584 | Ga0501068_0791705 | Ga0501068_0791705_59_547 | 160 |
| 404 | 3300049585 | Ga0501069_0496889 | Ga0501069_0496889_61_546 | 160 |
| 405 | 3300049586 | Ga0501070_0039587 | Ga0501070_0039587_3083_3580 | 160 |
| 406 | 3300049586 | Ga0501070_0396179 | Ga0501070_0396179_492_977 | 160 |
| 407 | 3300049587 | Ga0501071_0035837 | Ga0501071_0035837_1398_1883 | 160 |
| 408 | 3300049587 | Ga0501071_0278970 | Ga0501071_0278970_510_1058 | 160 |
| 409 | 3300049588 | Ga0501072_0113801 | Ga0501072_0113801_778_1263 | 160 |
| 410 | 3300049588 | Ga0501072_0228292 | Ga0501072_0228292_932_1417 | 160 |
| 411 | 3300049589 | Ga0501073_0036233 | Ga0501073_0036233_525_1010 | 160 |
| 412 | 3300049589 | Ga0501073_0059780 | Ga0501073_0059780_482_979 | 160 |
| 413 | 3300049589 | Ga0501073_0326440 | Ga0501073_0326440_286_783 | 160 |
| 414 | 3300049590 | Ga0501074_0013397 | Ga0501074_0013397_2496_2981 | 160 |
| 415 | 3300049590 | Ga0501074_0458839 | Ga0501074_0458839_296_781 | 160 |
| 416 | 3300049591 | Ga0501075_0362817 | Ga0501075_0362817_190_675 | 160 |
| 417 | 3300049592 | Ga0501076_0005392 | Ga0501076_0005392_3085_3570 | 160 |
| 418 | 3300049592 | Ga0501076_0215397 | Ga0501076_0215397_349_834 | 160 |
| 419 | 3300049592 | Ga0501076_0909014 | Ga0501076_0909014_99_647 | 160 |
| 420 | 3300049593 | Ga0501077_0001336 | Ga0501077_0001336_6399_6884 | 160 |
| 421 | 3300049593 | Ga0501077_0034371 | Ga0501077_0034371_222_707 | 160 |
| 422 | 3300049593 | Ga0501077_0350553 | Ga0501077_0350553_300_785 | 160 |
| 423 | 3300049593 | Ga0501077_0694919 | Ga0501077_0694919_109_594 | 160 |
| 424 | 3300049593 | Ga0501077_0771623 | Ga0501077_0771623_43_540 | 160 |
| 425 | 3300049741 | Ga0501079_0006446 | Ga0501079_0006446_2265_2750 | 160 |
| 426 | 3300049741 | Ga0501079_0126345 | Ga0501079_0126345_1231_1716 | 160 |
| 427 | 3300049742 | Ga0501080_0000907 | Ga0501080_0000907_10335_10832 | 160 |
| 428 | 3300049742 | Ga0501080_0322082 | Ga0501080_0322082_522_1007 | 160 |
| 429 | 3300049743 | Ga0501081_0021006 | Ga0501081_0021006_1224_1709 | 160 |
| 430 | 3300049743 | Ga0501081_0044600 | Ga0501081_0044600_1154_1639 | 160 |
| 431 | 3300049743 | Ga0501081_0175462 | Ga0501081_0175462_771_1268 | 160 |
| 432 | 3300049743 | Ga0501081_0193362 | Ga0501081_0193362_880_1365 | 160 |
| 433 | 3300049822 | Ga0501035_0000034 | Ga0501035_0000034_66065_66562 | 160 |
| 434 | 3300049823 | Ga0501044_0000039 | Ga0501044_0000039_63002_63499 | 160 |
| 435 | 3300049823 | Ga0501044_0001983 | Ga0501044_0001983_3814_4296 | 160 |
| 436 | 3300049823 | Ga0501044_0058601 | Ga0501044_0058601_1617_2114 | 160 |
| 437 | 3300049823 | Ga0501044_0388807 | Ga0501044_0388807_775_1272 | 160 |
| 438 | 3300049824 | Ga0501045_0228731 | Ga0501045_0228731_267_764 | 160 |
| 439 | 3300050490 | nmdc:mga03n38_23089_c1 | nmdc:mga03n38_23089_c1_1784_2272 | 160 |
| 440 | 3300050490 | nmdc:mga03n38_4837_c1 | nmdc:mga03n38_4837_c1_990_1478 | 160 |
| 441 | 3300050490 | nmdc:mga03n38_4918_c2 | nmdc:mga03n38_4918_c2_1022_1510 | 160 |
| 442 | 3300050491 | nmdc:mga00v17_2197_c1 | nmdc:mga00v17_2197_c1_2558_3046 | 160 |
| 443 | 3300050492 | nmdc:mga0yw44_1063425_c1 | nmdc:mga0yw44_1063425_c1_16_516 | 160 |
| 444 | 3300050492 | nmdc:mga0yw44_46136_c1 | nmdc:mga0yw44_46136_c1_764_1252 | 160 |
| 445 | 3300050492 | nmdc:mga0yw44_5020_c1 | nmdc:mga0yw44_5020_c1_1560_2048 | 160 |
| 446 | 3300050494 | nmdc:mga06z11_116676_c1 | nmdc:mga06z11_116676_c1_290_796 | 160 |
| 447 | 3300050494 | nmdc:mga06z11_29564_c1 | nmdc:mga06z11_29564_c1_1117_1605 | 160 |
| 448 | 3300050494 | nmdc:mga06z11_296824_c1 | nmdc:mga06z11_296824_c1_405_893 | 160 |
| 449 | 3300050494 | nmdc:mga06z11_4683_c1 | nmdc:mga06z11_4683_c1_1183_1671 | 160 |
| 450 | 3300050494 | nmdc:mga06z11_70971_c1 | nmdc:mga06z11_70971_c1_249_737 | 160 |
| 451 | 3300050495 | nmdc:mga04h51_119614_c1 | nmdc:mga04h51_119614_c1_80_568 | 160 |
| 452 | 3300050495 | nmdc:mga04h51_190156_c1 | nmdc:mga04h51_190156_c1_255_761 | 160 |
| 453 | 3300050495 | nmdc:mga04h51_7147_c1 | nmdc:mga04h51_7147_c1_1001_1489 | 160 |
| 454 | 3300050496 | nmdc:mga07m45_295981_c1 | nmdc:mga07m45_295981_c1_71_559 | 160 |
| 455 | 3300050496 | nmdc:mga07m45_634680_c1 | nmdc:mga07m45_634680_c1_62_568 | 160 |
| 456 | 3300050507 | nmdc:mga05p37_312242_c1 | nmdc:mga05p37_312242_c1_819_1304 | 160 |
| 457 | 3300050507 | nmdc:mga05p37_332773_c1 | nmdc:mga05p37_332773_c1_702_1187 | 160 |
| 458 | 3300050507 | nmdc:mga05p37_555519_c1 | nmdc:mga05p37_555519_c1_386_874 | 160 |
| 459 | 3300050508 | nmdc:mga09592_110810_c1 | nmdc:mga09592_110810_c1_1697_2185 | 160 |
| 460 | 3300050508 | nmdc:mga09592_729379_c1 | nmdc:mga09592_729379_c1_261_749 | 160 |
| 461 | 3300050509 | nmdc:mga0qj67_5071_c1 | nmdc:mga0qj67_5071_c1_4468_4956 | 160 |
| 462 | 3300050509 | nmdc:mga0qj67_77784_c1 | nmdc:mga0qj67_77784_c1_533_1021 | 160 |
| 463 | 3300050510 | nmdc:mga06r32_117974_c1 | nmdc:mga06r32_117974_c1_432_920 | 160 |
| 464 | 3300050510 | nmdc:mga06r32_17231_c1 | nmdc:mga06r32_17231_c1_2185_2670 | 160 |
| 465 | 3300050510 | nmdc:mga06r32_209279_c1 | nmdc:mga06r32_209279_c1_1301_1786 | 160 |
| 466 | 3300050510 | nmdc:mga06r32_452343_c1 | nmdc:mga06r32_452343_c1_588_1076 | 160 |
| 467 | 3300050510 | nmdc:mga06r32_61975_c1 | nmdc:mga06r32_61975_c1_2445_2933 | 160 |
| 468 | 3300050511 | nmdc:mga08y16_10691_c1 | nmdc:mga08y16_10691_c1_8197_8682 | 160 |
| 469 | 3300050511 | nmdc:mga08y16_1299626_c1 | nmdc:mga08y16_1299626_c1_57_542 | 160 |
| 470 | 3300050511 | nmdc:mga08y16_308291_c1 | nmdc:mga08y16_308291_c1_190_675 | 160 |
| 471 | 3300050511 | nmdc:mga08y16_730271_c1 | nmdc:mga08y16_730271_c1_448_936 | 160 |
| 472 | 3300050511 | nmdc:mga08y16_882464_c1 | nmdc:mga08y16_882464_c1_318_806 | 160 |
| 473 | 3300050512 | nmdc:mga0n895_1273_c1 | nmdc:mga0n895_1273_c1_13792_14277 | 160 |
| 474 | 3300050513 | nmdc:mga0rr50_17097_c1 | nmdc:mga0rr50_17097_c1_2830_3315 | 160 |
| 475 | 3300050515 | nmdc:mga0a205_54545_c1 | nmdc:mga0a205_54545_c1_1160_1645 | 160 |
| 476 | 3300053077 | Ga0495601_0433315 | Ga0495601_0433315_200_682 | 160 |
| 477 | 3300053077 | Ga0495601_0584205 | Ga0495601_0584205_42_539 | 160 |
| 478 | 3300053078 | Ga0495612_0030314 | Ga0495612_0030314_1563_2060 | 160 |
| 479 | 3300053078 | Ga0495612_0282110 | Ga0495612_0282110_189_671 | 160 |
| 480 | 3300053084 | Ga0495595_0165305 | Ga0495595_0165305_562_1059 | 160 |
| 481 | 3300053085 | Ga0495619_0029946 | Ga0495619_0029946_177_674 | 160 |
| 482 | 3300053103 | Ga0500555_056605 | Ga0500555_056605_288_785 | 160 |
| 483 | 3300053153 | Ga0500616_0266934 | Ga0500616_0266934_44_532 | 160 |
| 484 | 3300054114 | Ga0501084_0004508 | Ga0501084_0004508_5166_5651 | 160 |
| 485 | 3300054114 | Ga0501084_0190944 | Ga0501084_0190944_737_1222 | 160 |
| 486 | 3300054114 | Ga0501084_1350900 | Ga0501084_1350900_72_569 | 160 |
| 487 | 3300054114 | Ga0501084_1374492 | Ga0501084_1374492_78_566 | 160 |
| 488 | 3300060353 | Ga0501082_0003580 | Ga0501082_0003580_10544_11029 | 160 |
| 489 | 3300060353 | Ga0501082_0066797 | Ga0501082_0066797_2209_2706 | 160 |
| 490 | 3300060353 | Ga0501082_0076619 | Ga0501082_0076619_1562_2047 | 160 |
| 491 | 3300060353 | Ga0501082_0602029 | Ga0501082_0602029_181_669 | 160 |
| 492 | 3300060353 | Ga0501082_0932897 | Ga0501082_0932897_95_580 | 160 |
| 493 | 3300061734 | Ga0530510_0224243 | Ga0530510_0224243_600_1085 | 160 |
| 494 | 3300061734 | Ga0530510_0317947 | Ga0530510_0317947_77_562 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5k1g-assembly1.cif.gz_A-2 | crystal structure of reduced prx3 from vibrio vulnificus | 0.9837 | 2 | 159 |
| 4f82-assembly1.cif.gz_B | x-ray crystal structure of a putative thioredoxin reductase from burkholderia cenocepacia | 0.9836 | 1 | 160 |
| 5k2j-assembly4.cif.gz_H | crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus | 0.9821 | 2 | 159 |
| 5k2j-assembly6.cif.gz_K | crystal structure of reduced prx3 in complex with h2o2 from vibrio vulnificus | 0.9799 | 2 | 160 |
| 3uma-assembly3.cif.gz_C | crystal structure of a hypothetical peroxiredoxin protein frm sinorhizobium meliloti | 0.9797 | 1 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4f82B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9836 | 1 | 160 | 3.40.30.10 |
| 4f82B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9776 | 1 | 160 | 3.40.30.10 |
| af_Q54N76_3_172_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9643 | 1 | 160 | 3.40.30.10 |
| 3umaA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9616 | 1 | 160 | 3.40.30.10 |
| af_A0A1D6HW14_71_234_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9613 | 6 | 160 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534EDJ2-F1-model_v4 | Glutathione-dependent peroxiredoxin (EC 1.11.1.27) | 1.002 | 1 | 160 |
GO:0005737
GO:0008379 GO:0034599 GO:0042744 GO:0045454 |
| AF-A0A4V1SR03-F1-model_v4 | Glutathione-dependent peroxiredoxin (EC 1.11.1.27) | 1.002 | 39 | 160 |
GO:0005737
GO:0008379 GO:0034599 GO:0042744 GO:0045454 |
| AF-A0A537RAC6-F1-model_v4 | Glutathione-dependent peroxiredoxin (EC 1.11.1.27) | 0.9994 | 1 | 115 |
GO:0005737
GO:0008379 GO:0034599 GO:0042744 GO:0045454 |
| AF-A0A523MNG4-F1-model_v4 | Peroxiredoxin | 0.9977 | 74 | 160 |
GO:0005737
GO:0008379 GO:0034599 GO:0042744 GO:0045454 |
| AF-A0A1Q7TUM0-F1-model_v4 | Glutathione-dependent peroxiredoxin (EC 1.11.1.27) | 0.9967 | 1 | 141 |
GO:0005737
GO:0008379 GO:0034599 GO:0042744 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar