metagRoot

F454592

General Info

Members	Datasets	Scaffolds	Average Seq Length
494	312	415	267

Family's Representative Sequence

Representative Sequence	3300031730\|Ga0307516_10029834\|Ga0307516_100298344
Length	315
Sequence	VNARQFTGFADGLLEAIGVGVEVPGKTLLRDASACFMAGQVTAILGPNGAGKSTLLSLLTGQRAPANGMVRLAGQPLAAHTPGDLARVRACVAQETQVAFDFTVQEVVELGRYPHRRHPSPQESGIVLQAMQATAVDHLAQRALNTLSGGEKARVHLARALAQVWEPVWRKAFFPPGRPKEKTDPSGGREPHEVGERGGSISRWLLLDEPTAALDLQHQHRMLQLVRDWAVGQGVGVVAVLHDLNLALRYSDRCVVLRDGQVVASGASDQVLTPACIEEVWGVRAHAAPAGEGTQRRPQYVFEPGEGDSRGFAGD

Samples

	Sample ID	Description	Type	Environment
1	2508501039	Frankia saprophytica CN3	Isolate	Nodule
2	2510917027	Brevibacillus sp. CF112	Isolate	Rhizosphere
3	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
4	2512564013	Brevibacillus sp. BC25	Isolate	Rhizosphere
5	2524614857	Deinococcus ficus DSM 19119	Isolate	Rhizosphere
6	2547132374	Acidovorax radicis N35	Isolate	Unclassified
7	2593339198	Paenibacillus sp. UNCCL117	Isolate	Unclassified
8	2593339238	Luteibacter sp. UNCMF366Tsu5.1	Isolate	Unclassified
9	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
10	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
11	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
12	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
13	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
14	2643221547	Pseudolabrys sp. Root1462	Isolate	Unclassified
15	2643221591	Devosia sp. Root685	Isolate	Unclassified
16	2643221604	Nocardioides sp. Root190	Isolate	Unclassified
17	2643221609	Acidovorax sp. Root217	Isolate	Unclassified
18	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
19	2643221613	Oerskovia sp. Root22	Isolate	Unclassified
20	2643221629	Devosia sp. Root105	Isolate	Unclassified
21	2643221662	Devosia sp. Root413D1	Isolate	Unclassified
22	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
23	2643221721	Oerskovia sp. Root918	Isolate	Unclassified
24	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
25	2718218334	Luteibacter rhizovicinus LJ96	Isolate	Rhizosphere
26	2721755693	Paenibacillus polymyxa YC0573	Isolate	Rhizosphere
27	2728369359	Paenibacillus polymyxa YC0136	Isolate	Rhizosphere
28	2738541277	Variovorax sp. GV051	Isolate	Unclassified
29	2738541305	Nocardioides sp. CF167	Isolate	Unclassified
30	2738541307	Variovorax sp. GV008	Isolate	Unclassified
31	2738543009	Luteibacter sp. OK325	Isolate	Unclassified
32	2738543012	Acidovorax sp. CF301	Isolate	Unclassified
33	2738543013	Variovorax sp. BT01	Isolate	Unclassified
34	2738543019	Variovorax sp. GV040	Isolate	Unclassified
35	2739367875	Deinococcus ficus CC-FR2-10	Isolate	Unclassified
36	2751185905	Paenibacillus kribbensis 6hRe76	Isolate	Unclassified
37	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
38	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
39	2802428803	Paenibacillus peoriae NMA1017	Isolate	Rhizosphere
40	2816332133	Acidovorax radicis 2721A	Isolate	Unclassified
41	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
42	2837678835	Jiella endophytica CBS5Q-3	Isolate	Unclassified
43	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
44	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
45	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
46	2854911287	Brucella lupini LUP21	Isolate	Unclassified
47	2857460504	Brevibacillus sp. R-74223	Isolate	Unclassified
48	2857472729	Cohnella sp. R-74144	Isolate	Unclassified
49	2864997549	Paenibacillus sp. R-72005	Isolate	Unclassified
50	2884338543	Luteibacter pinisoli MAH-14	Isolate	Rhizosphere
51	2884411467	Dyella sp. AD56	Isolate	Rhizosphere
52	2885198086	Variovorax sp. 679	Isolate	Unclassified
53	2885211737	Variovorax sp. 553	Isolate	Unclassified
54	2889276214	Paenibacillus sp. PvR133	Isolate	Rhizosphere
55	2889295896	Paenibacillus sp. PvR098	Isolate	Rhizosphere
56	2898795034	Rhodobacter sp. SGA-6-6	Isolate	Rhizosphere
57	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
58	2904595352	Paenibacillus sp. 1182	Isolate	Unclassified
59	2915597211	Brevibacillus brevis Ag35	Isolate	Nodule
60	2915606848	Brevibacillus sp. HD1.4A	Isolate	Rhizosphere
61	2915650412	Ochrobactrum sp. CM-21-5	Isolate	Rhizosphere
62	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
63	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
64	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
65	2929183550	Brevibacillus sp. R-71971 Hybrid assembly	Isolate	Unclassified
66	2935890801	Oerskovia enterophila 3230	Isolate	Rhizosphere
67	2939631187	Ottowia thiooxydans 2709	Isolate	Rhizosphere
68	2939702853	Paenibacillus sp. PvR008	Isolate	Rhizosphere
69	2941471342	Luteibacter sp. 621	Isolate	Unclassified
70	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
71	2980125574	Paenibacillus sp. tmac-D7	Isolate	Unclassified
72	2981284811	Paenibacillus sp. PvR052	Isolate	Rhizosphere
73	2981289755	Paenibacillus sp. PvR148	Isolate	Rhizosphere
74	2981980479	Paenibacillus sp. PvR018	Isolate	Rhizosphere
75	2981985349	Paenibacillus sp. PvR053	Isolate	Rhizosphere
76	2996706504	Paenibacillus sp. OT2-17	Isolate	Rhizosphere
77	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
78	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
79	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
80	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
81	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
82	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
83	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
84	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
85	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
86	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
87	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
88	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
89	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
90	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
91	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
92	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
93	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
94	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
95	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
96	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
97	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
98	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
99	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
100	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
101	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
102	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
103	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
104	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
105	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
106	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
107	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
108	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
109	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
110	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
111	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
112	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
113	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
114	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
115	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
116	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
117	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
118	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
119	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
120	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
121	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
122	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
123	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
124	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
125	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
126	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
127	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
128	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
129	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
130	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
131	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
132	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
133	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
134	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
135	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
136	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
137	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
138	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
139	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
140	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
141	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
142	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
143	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
144	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
145	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
146	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
148	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
149	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
150	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
151	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
152	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
153	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
154	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
155	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
171	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
173	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
174	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
175	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
176	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
177	3300030736	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6	Metagenome	Rhizosphere
178	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
179	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
180	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
181	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
182	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
183	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
184	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
185	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
186	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
187	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
188	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
189	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
190	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
191	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
192	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
193	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
194	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
195	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
196	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
197	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
198	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
199	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
200	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
201	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
202	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
203	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
204	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
205	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
206	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
207	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
208	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
209	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
210	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
211	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
212	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
213	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
214	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
215	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
216	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
217	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
218	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
219	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
220	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
221	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
222	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
223	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
224	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
225	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
226	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
227	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
228	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
229	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
230	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
231	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
232	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
233	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
234	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
235	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
236	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
237	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
238	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
239	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
240	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
241	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
242	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
243	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
244	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
245	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
246	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
247	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
248	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
249	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
250	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
251	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
252	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
253	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
254	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
255	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
256	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
257	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
258	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
259	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
261	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
262	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
263	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
264	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
265	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
266	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
267	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
268	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
269	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
270	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
271	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
272	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
273	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
274	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
275	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
276	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
277	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
278	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
279	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
280	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
281	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
282	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
283	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
284	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
285	3300053110	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere	Metagenome	Endosphere
286	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
287	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
288	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
289	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
290	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
291	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
292	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
293	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
294	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
295	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
296	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
297	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
298	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
299	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
300	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
301	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
302	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
303	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
304	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
305	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
306	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
307	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
308	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
309	648028048	Paenibacillus polymyxa E681	Isolate	Rhizosphere
310	8005658619	Rhizobium terrae CC-HIH110	Isolate	Unclassified
311	8045864390	Aurantimonas endophytica KCTC 52296	Isolate	Unclassified
312	8055034563	Leucobacter allii H21R-40	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	83
Metatranscriptomes	0.61
Isolates	16.4

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	22.27
Nodule	1.01
Rhizoplane	2.43
Rhizosphere	51.21
Stem	0
Stem Tuber	0
Unclassified	23.08

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24736J21556_1004701	3300001904	Bacteria	2320
2	JGI24740J21852_10001962	3300001979	Bacteria	9394
3	JGI24739J22299_10000009	3300001989	Bacteria	55784
4	JGI24737J22298_10019820	3300001990	Bacteria	2151
5	JGI25159J45721_1000268	3300002987	Bacteria	24366
6	JGI25151J46595_10002521	3300003187	Bacteria	10882
7	JGI25151J46595_10005672	3300003187	Bacteria	6417
8	JGI25153J46596_10011864	3300003215	Bacteria	3817
9	rootH1_10074450	3300003316	Bacteria	8065
10	rootH1_10074450	3300003323	Bacteria	1933
11	rootL2_10157831	3300003322	Bacteria	4705
12	rootH1_10021282	3300003316	Bacteria	3546
13	rootH1_10021282	3300003323	Bacteria	17411
14	rootH1_10306502	3300003323	Bacteria	2034
15	JGI25160J50197_1000071	3300003354	Bacteria	108301
16	JGI25161J50226_1000030	3300003374	Bacteria	142870
17	Ga0006562J51391_1033731	3300003578	Bacteria	1325
18	Ga0006562J51391_1099714	3300003578	Bacteria	2304
19	Ga0006562J51391_1099715	3300003578	Bacteria	3750
20	Ga0055526_1002275	3300003771	Bacteria	13119
21	Ga0055526_1019322	3300003771	Bacteria	2488
22	Ga0055537_1000282	3300003773	Bacteria	36290
23	Ga0055537_1013935	3300003773	Bacteria	1483
24	Ga0055524_1000006	3300003775	Bacteria	324702
25	Ga0055536_1002768	3300003781	Bacteria	9705
26	Ga0055536_1014545	3300003781	Bacteria	2753
27	Ga0055534_1000624	3300003784	Bacteria	18150
28	Ga0055528_1020068	3300003790	Bacteria	2184
29	Ga0055530_10000295	3300003791	Bacteria	45206
30	Ga0055540_1000005	3300003792	Bacteria	378126
31	Ga0055540_1000733	3300003792	Bacteria	22290
32	Ga0055531_10019263	3300003794	Bacteria	2771
33	Ga0055543_1000269	3300004625	Bacteria	38782
34	Ga0065165_1003436	3300005262	Bacteria	11132
35	Ga0065165_1003639	3300005262	Bacteria	10534
36	Ga0065165_1004300	3300005262	Bacteria	8963
37	Ga0065165_1014112	3300005262	Bacteria	3119
38	Ga0068868_100141202	3300005338	Bacteria	1977
39	Ga0070691_10278038	3300005341	Bacteria	907
40	Ga0070668_100301454	3300005347	Bacteria	1344
41	Ga0070688_100082771	3300005365	Bacteria	2081
42	Ga0070714_100214141	3300005435	Bacteria	1767
43	Ga0070686_100051927	3300005544	Bacteria	2612
44	Ga0068855_100001529	3300005563	Bacteria	29012
45	Ga0068855_100001606	3300005563	Bacteria	28376
46	Ga0070664_100299365	3300005564	Bacteria	1453
47	Ga0068857_100000492	3300005577	Bacteria	28313
48	Ga0068857_100261533	3300005577	Bacteria	1588
49	Ga0068854_100000378	3300005578	Bacteria	28376
50	Ga0068854_100001428	3300005578	Bacteria	14444
51	Ga0068852_100083866	3300005616	Bacteria	2835
52	Ga0068859_100048597	3300005617	Bacteria	4261
53	Ga0068851_10028559	3300005834	Bacteria	2757
54	Ga0068858_100032806	3300005842	Bacteria	4823
55	Ga0068862_100405427	3300005844	Bacteria	1276
56	Ga0081539_10000317	3300005985	Bacteria	107746
57	Ga0075428_100205674	3300006844	Bacteria	2127
58	Ga0075430_100083564	3300006846	Bacteria	2675
59	Ga0075433_10137744	3300006852	Bacteria	2169
60	Ga0075429_100188547	3300006880	Bacteria	1807
61	Ga0075429_100357397	3300006880	Bacteria	1279
62	Ga0097620_100048596	3300006931	Bacteria	4261
63	Ga0079104_1011640	3300006946	Bacteria	2816
64	Ga0075435_100039608	3300007076	Bacteria	3761
65	Ga0105244_10007173	3300009036	Bacteria	7111
66	Ga0105240_10000343	3300009093	Bacteria	87196
67	Ga0105240_10000525	3300009093	Bacteria	70614
68	Ga0105240_10005430	3300009093	Bacteria	19001
69	Ga0105240_10009205	3300009093	Bacteria	14006
70	Ga0105240_10152191	3300009093	Bacteria	2754
71	Ga0111539_10108574	3300009094	Bacteria	3256
72	Ga0111539_10248956	3300009094	Bacteria	2069
73	Ga0114129_10585101	3300009147	Bacteria	1448
74	Ga0105243_10004803	3300009148	Bacteria	10618
75	Ga0105237_10000016	3300009545	Bacteria	256506
76	Ga0105239_10000020	3300010375	Bacteria	264435
77	Ga0105239_10045866	3300010375	Bacteria	4790
78	Ga0105239_10767753	3300010375	Bacteria	1104
79	Ga0105246_10129932	3300011119	Bacteria	1880
80	Ga0157370_10159977	3300013104	Bacteria	2095
81	Ga0157369_10006172	3300013105	Bacteria	13909
82	Ga0163162_10088884	3300013306	Bacteria	3169
83	Ga0157375_10139154	3300013308	Bacteria	2553
84	Ga0182008_10000845	3300014497	Bacteria	21349
85	Ga0163161_10004982	3300017792	Bacteria	9241
86	Ga0163161_10005102	3300017792	Bacteria	9138
87	Ga0213872_10003772	3300021361	Bacteria	8266
88	Ga0209147_104730	3300025229	Bacteria	2184
89	Ga0207425_1001788	3300025245	Bacteria	8333
90	Ga0207425_1002577	3300025245	Bacteria	6297
91	Ga0209129_1005056	3300025258	Bacteria	4843
92	Ga0209565_1000004	3300025263	Bacteria	983150
93	Ga0209565_1000745	3300025263	Bacteria	19237
94	Ga0209673_1000450	3300025273	Bacteria	69939
95	Ga0209130_1000060	3300025284	Bacteria	201501
96	Ga0209130_1000818	3300025284	Bacteria	26223
97	Ga0209130_1006660	3300025284	Bacteria	3704
98	Ga0209675_1000096	3300025291	Bacteria	133284
99	Ga0209675_1000458	3300025291	Bacteria	31329
100	Ga0209675_1003175	3300025291	Bacteria	7983
101	Ga0209675_1013485	3300025291	Bacteria	2550
102	Ga0209676_1000007	3300025292	Bacteria	1029371
103	Ga0209676_1000260	3300025292	Bacteria	111683
104	Ga0209676_1002189	3300025292	Bacteria	14632
105	Ga0209676_1013777	3300025292	Bacteria	3085
106	Ga0209025_1000732	3300025294	Bacteria	55664
107	Ga0209025_1001572	3300025294	Bacteria	28902
108	Ga0209025_1002753	3300025294	Bacteria	17782
109	Ga0209025_1005609	3300025294	Bacteria	10137
110	Ga0209025_1033819	3300025294	Bacteria	2352
111	Ga0209564_1000495	3300025295	Bacteria	65018
112	Ga0209564_1000677	3300025295	Bacteria	50407
113	Ga0209564_1028114	3300025295	Bacteria	1807
114	Ga0209758_1000290	3300025297	Bacteria	98878
115	Ga0209758_1005515	3300025297	Bacteria	9667
116	Ga0209758_1077869	3300025297	Bacteria	1014
117	Ga0209050_1000003	3300025298	Bacteria	1609245
118	Ga0209050_1007902	3300025298	Bacteria	5831
119	Ga0209050_1011008	3300025298	Bacteria	4361
120	Ga0209050_1048899	3300025298	Bacteria	1088
121	Ga0209256_1000001	3300025299	Bacteria	2166974
122	Ga0207426_1000025	3300025302	Bacteria	532921
123	Ga0207426_1001808	3300025302	Bacteria	15871
124	Ga0209051_1000003	3300025303	Bacteria	1609245
125	Ga0209051_1000319	3300025303	Bacteria	72894
126	Ga0209257_1000020	3300025304	Bacteria	773356
127	Ga0209257_1015783	3300025304	Bacteria	3109
128	Ga0209257_1016028	3300025304	Bacteria	3062
129	Ga0209257_1024486	3300025304	Bacteria	2089
130	Ga0207656_10017749	3300025321	Bacteria	2792
131	Ga0207647_10000014	3300025904	Bacteria	143525
132	Ga0207695_10000307	3300025913	Bacteria	118870
133	Ga0207695_10000318	3300025913	Bacteria	116126
134	Ga0207695_10000382	3300025913	Bacteria	100524
135	Ga0207695_10015812	3300025913	Bacteria	8863
136	Ga0207695_10105429	3300025913	Bacteria	2806
137	Ga0207671_10000013	3300025914	Bacteria	478458
138	Ga0207690_10058275	3300025932	Bacteria	2612
139	Ga0207709_10000240	3300025935	Bacteria	68308
140	Ga0207669_10189996	3300025937	Bacteria	1481
141	Ga0207679_10209466	3300025945	Bacteria	1634
142	Ga0207667_10000040	3300025949	Bacteria	275827
143	Ga0207667_10000047	3300025949	Bacteria	240471
144	Ga0207668_10040355	3300025972	Bacteria	3149
145	Ga0207640_10000009	3300025981	Bacteria	283101
146	Ga0207640_10003961	3300025981	Bacteria	7992
147	Ga0207703_10077829	3300026035	Bacteria	2754
148	Ga0207678_10097974	3300026067	Bacteria	2505
149	Ga0207674_10000012	3300026116	Bacteria	193220
150	Ga0207698_10028307	3300026142	Bacteria	3994
151	Ga0207698_10277697	3300026142	Bacteria	1548
152	Ga0207428_10121453	3300027907	Bacteria	2003
153	Ga0268265_10415692	3300028380	Bacteria	1247
154	Ga0307515_10000213	3300028794	Bacteria	142742
155	Ga0307515_10000444	3300028794	Bacteria	99282
156	Ga0307515_10001286	3300028794	Bacteria	56985
157	Ga0307515_10208045	3300028794	Bacteria	1810
158	Ga0307515_10215248	3300028794	Bacteria	1754
159	Ga0307512_10249741	3300030522	Bacteria	885
160	Ga0316177_1109894	3300030731	Bacteria	3472
161	Ga0314311_1045676	3300030733	Bacteria	3821
162	Ga0316178_1066381	3300030735	Bacteria	4541
163	Ga0316180_1006347	3300030736	Bacteria	2125
164	Ga0316181_1054005	3300030744	Bacteria	8038
165	Ga0307513_10000006	3300031456	Bacteria	470848
166	Ga0307513_10000094	3300031456	Bacteria	127685
167	Ga0307513_10070770	3300031456	Bacteria	3644
168	Ga0307513_10109754	3300031456	Bacteria	2756
169	Ga0307513_10113574	3300031456	Bacteria	2696
170	Ga0307408_100016308	3300031548	Bacteria	4956
171	Ga0307408_100037454	3300031548	Bacteria	3416
172	Ga0307514_10000819	3300031649	Bacteria	50536
173	Ga0307514_10152822	3300031649	Bacteria	1545
174	Ga0307516_10029834	3300031730	Bacteria	5510
175	Ga0307405_10006953	3300031731	Bacteria	5617
176	Ga0307405_10267846	3300031731	Bacteria	1279
177	Ga0307405_10446530	3300031731	Bacteria	1024
178	Ga0307405_10616663	3300031731	Bacteria	887
179	Ga0307406_10112403	3300031901	Bacteria	1878
180	Ga0307412_10015584	3300031911	Bacteria	4511
181	Ga0307412_10096986	3300031911	Bacteria	2076
182	Ga0307416_100102756	3300032002	Bacteria	2493
183	Ga0307414_10281882	3300032004	Bacteria	1397
184	Ga0307411_10030151	3300032005	Bacteria	3322
185	Ga0316584_0206960	3300036712	Bacteria	1446
186	Ga0395905_0000707	3300037471	Bacteria	44289
187	Ga0395905_0003258	3300037471	Bacteria	17455
188	Ga0436361_0009230	3300039447	Bacteria	32991
189	Ga0451853_3291156	3300041512	Bacteria	1438
190	Ga0451577_0136615	3300042876	Bacteria	2201
191	Ga0451577_0138094	3300042876	Bacteria	2189
192	Ga0451577_0187875	3300042876	Bacteria	1863
193	Ga0451577_0258505	3300042876	Bacteria	1577
194	Ga0451577_0577506	3300042876	Bacteria	1020
195	Ga0466969_0022255	3300044656	Bacteria	3273
196	Ga0466982_0000002	3300044672	Bacteria	454900
197	Ga0453683_0028649	3300044673	Bacteria	3525
198	Ga0466966_0006312	3300044684	Bacteria	7839
199	Ga0466961_0076535	3300044693	Bacteria	2121
200	Ga0466963_0061236	3300044694	Unclassified	2516
201	Ga0466964_0148067	3300044706	Bacteria	1085
202	Ga0453684_0001048	3300044712	Bacteria	88382
203	Ga0453684_0001308	3300044712	Bacteria	73691
204	Ga0453684_0002592	3300044712	Bacteria	43253
205	Ga0453684_0030969	3300044712	Bacteria	7538
206	Ga0453684_0061490	3300044712	Bacteria	4820
207	Ga0453684_0085259	3300044712	Bacteria	3925
208	Ga0453684_0132041	3300044712	Bacteria	2995
209	Ga0453684_0460811	3300044712	Bacteria	1413
210	Ga0466971_0005493	3300044719	Bacteria	5504
211	Ga0466970_0052111	3300044765	Bacteria	2184
212	Ga0466957_0053102	3300044842	Bacteria	2470
213	Ga0466957_0216499	3300044842	Bacteria	1263
214	Ga0466959_0324609	3300045049	Bacteria	1052
215	Ga0451576_0007484	3300045051	Bacteria	13031
216	Ga0451576_0008790	3300045051	Bacteria	11814
217	Ga0451576_0129292	3300045051	Bacteria	2632
218	Ga0495617_000081	3300046452	Bacteria	74014
219	Ga0495617_000279	3300046452	Bacteria	29542
220	Ga0495638_0000139	3300046460	Bacteria	114810
221	Ga0495638_0024599	3300046460	Bacteria	3925
222	Ga0495638_0088171	3300046460	Bacteria	1873
223	Ga0495638_0104872	3300046460	Bacteria	1686
224	Ga0495638_0154698	3300046460	Bacteria	1327
225	Ga0495650_0001790	3300046471	Bacteria	19409
226	Ga0495584_0000221	3300046491	Bacteria	41153
227	Ga0495585_0001150	3300046492	Bacteria	21583
228	Ga0495607_0000067	3300046501	Bacteria	102663
229	Ga0495606_0002675	3300046507	Bacteria	20216
230	Ga0495606_0003127	3300046507	Bacteria	17968
231	Ga0495610_0004309	3300046512	Bacteria	10568
232	Ga0495616_0000051	3300046513	Bacteria	106797
233	Ga0495616_0001145	3300046513	Bacteria	18718
234	Ga0495616_0017453	3300046513	Bacteria	3958
235	Ga0495620_0000066	3300046515	Bacteria	89405
236	Ga0495620_0000379	3300046515	Bacteria	30302
237	Ga0495631_0000174	3300046518	Bacteria	43807
238	Ga0495631_0000792	3300046518	Bacteria	20201
239	Ga0495632_0000059	3300046519	Bacteria	121437
240	Ga0495632_0003696	3300046519	Bacteria	10726
241	Ga0495632_0008606	3300046519	Bacteria	6236
242	Ga0495637_0017844	3300046520	Bacteria	3298
243	Ga0495643_0172874	3300046522	Bacteria	1055
244	Ga0495648_0022258	3300046524	Bacteria	4367
245	Ga0495654_0008411	3300046530	Bacteria	5702
246	Ga0495609_0004802	3300046538	Bacteria	7289
247	Ga0495621_0038580	3300046539	Bacteria	1667
248	Ga0495668_0000858	3300046616	Bacteria	34275
249	Ga0495668_0141228	3300046616	Bacteria	1318
250	Ga0495668_0212052	3300046616	Bacteria	1060
251	Ga0495611_0000002	3300046648	Bacteria	705677
252	Ga0495611_0000032	3300046648	Bacteria	110000
253	Ga0495625_0000002	3300046660	Bacteria	813323
254	Ga0495625_0003466	3300046660	Bacteria	15709
255	Ga0495625_0094507	3300046660	Bacteria	2063
256	Ga0495625_0185846	3300046660	Bacteria	1379
257	Ga0495625_0378790	3300046660	Bacteria	888
258	Ga0495658_0398428	3300046683	Bacteria	877
259	Ga0495670_0000688	3300046691	Bacteria	16104
260	Ga0495670_0002951	3300046691	Bacteria	8392
261	Ga0495671_0000183	3300046692	Bacteria	55588
262	Ga0495589_0000067	3300046794	Bacteria	99395
263	Ga0495660_0000384	3300046810	Bacteria	38494
264	Ga0495676_0147526	3300047321	Bacteria	1678
265	Ga0495683_0002957	3300047323	Bacteria	10044
266	Ga0495679_000003	3300047446	Bacteria	787868
267	Ga0495673_0000310	3300047469	Bacteria	64112
268	Ga0495673_0001190	3300047469	Bacteria	21831
269	Ga0495673_0167845	3300047469	Bacteria	838
270	Ga0495686_0000024	3300047472	Bacteria	400343
271	Ga0495686_0043040	3300047472	Bacteria	2866
272	Ga0495686_0217161	3300047472	Bacteria	1089
273	Ga0495593_0051047	3300047673	Bacteria	2189
274	Ga0496101_0148853	3300048904	Bacteria	1789
275	Ga0496104_0467935	3300048907	Bacteria	1172
276	Ga0496105_0012639	3300048908	Bacteria	6686
277	Ga0496106_0001098	3300048909	Bacteria	20009
278	Ga0496106_0151571	3300048909	Bacteria	1829
279	Ga0496108_0379885	3300048911	Bacteria	1234
280	Ga0496110_0324582	3300048913	Bacteria	1402
281	Ga0496115_0253542	3300048918	Bacteria	1448
282	Ga0496116_0065094	3300048919	Bacteria	2340
283	Ga0496116_0180451	3300048919	Bacteria	1131
284	Ga0496117_0002398	3300048920	Bacteria	23826
285	Ga0496117_0007987	3300048920	Bacteria	10153
286	Ga0496118_0000224	3300048921	Bacteria	98813
287	Ga0496118_0000268	3300048921	Bacteria	91201
288	Ga0496118_0000423	3300048921	Bacteria	70256
289	Ga0496118_0003065	3300048921	Bacteria	21458
290	Ga0496119_0000139	3300048922	Bacteria	101548
291	Ga0496119_0006518	3300048922	Bacteria	10774
292	Ga0496119_0037767	3300048922	Bacteria	3131
293	Ga0496120_0000185	3300048923	Bacteria	106472
294	Ga0496120_0000862	3300048923	Bacteria	42878
295	Ga0496120_0166289	3300048923	Bacteria	1095
296	Ga0496121_0000096	3300048924	Bacteria	207449
297	Ga0496121_0004043	3300048924	Bacteria	20148
298	Ga0496121_0006635	3300048924	Bacteria	14253
299	Ga0496121_0035835	3300048924	Bacteria	4435
300	Ga0496121_0054084	3300048924	Bacteria	3358
301	Ga0496121_0078676	3300048924	Bacteria	2620
302	Ga0496121_0080936	3300048924	Bacteria	2572
303	Ga0496121_0102701	3300048924	Bacteria	2201
304	Ga0496121_0267272	3300048924	Bacteria	1177
305	Ga0496122_0013167	3300048925	Bacteria	8128
306	Ga0496122_0013938	3300048925	Bacteria	7816
307	Ga0496122_0074821	3300048925	Bacteria	2393
308	Ga0496122_0239561	3300048925	Bacteria	1024
309	Ga0496122_0245947	3300048925	Bacteria	1004
310	Ga0496122_0259227	3300048925	Bacteria	966
311	Ga0496123_0015023	3300048926	Bacteria	6378
312	Ga0496123_0033564	3300048926	Bacteria	3691
313	Ga0496123_0074988	3300048926	Bacteria	2090
314	Ga0496123_0104861	3300048926	Bacteria	1633
315	Ga0496123_0171011	3300048926	Bacteria	1146
316	Ga0496124_0041275	3300048927	Bacteria	3983
317	Ga0496124_0185005	3300048927	Bacteria	1599
318	Ga0496125_0000044	3300048928	Bacteria	296762
319	Ga0496125_0000693	3300048928	Bacteria	55603
320	Ga0496125_0009965	3300048928	Bacteria	9658
321	Ga0496125_0070806	3300048928	Bacteria	2728
322	Ga0496125_0139815	3300048928	Bacteria	1685
323	Ga0496126_0000491	3300048929	Bacteria	77939
324	Ga0496126_0008022	3300048929	Bacteria	11457
325	Ga0496126_0012931	3300048929	Bacteria	8522
326	Ga0496126_0024347	3300048929	Bacteria	5846
327	Ga0496126_0068813	3300048929	Bacteria	3159
328	Ga0496126_0076303	3300048929	Bacteria	2973
329	Ga0495678_000026	3300049459	Bacteria	226978
330	Ga0501031_0090719	3300049568	Bacteria	1993
331	Ga0501032_0005254	3300049569	Bacteria	9634
332	Ga0501032_0101115	3300049569	Bacteria	1910
333	Ga0501033_0021293	3300049570	Bacteria	4891
334	Ga0501033_0036530	3300049570	Bacteria	3681
335	Ga0501033_0049915	3300049570	Bacteria	3105
336	Ga0501033_0347604	3300049570	Bacteria	1039
337	Ga0501033_0427965	3300049570	Bacteria	921
338	Ga0501034_0297566	3300049571	Bacteria	1551
339	Ga0501036_0089499	3300049572	Bacteria	2601
340	Ga0501042_0049041	3300049578	Bacteria	3012
341	Ga0501043_0083012	3300049579	Bacteria	2519
342	Ga0501043_0103345	3300049579	Bacteria	2239
343	Ga0501046_0058630	3300049580	Bacteria	3018
344	Ga0501046_0092124	3300049580	Bacteria	2331
345	Ga0501046_0173282	3300049580	Bacteria	1618
346	Ga0501046_0504835	3300049580	Bacteria	866
347	Ga0501047_0160553	3300049581	Bacteria	2119
348	Ga0501047_0206212	3300049581	Bacteria	1825
349	Ga0501070_0205560	3300049586	Bacteria	1617
350	Ga0501070_0227935	3300049586	Bacteria	1527
351	Ga0501075_0148376	3300049591	Bacteria	1788
352	Ga0501249_072539	3300049679	Bacteria	805
353	Ga0501079_0102382	3300049741	Bacteria	2221
354	Ga0501035_0010956	3300049822	Bacteria	8397
355	Ga0501035_0028901	3300049822	Bacteria	5059
356	Ga0501035_0050100	3300049822	Bacteria	3743
357	Ga0501035_0070440	3300049822	Bacteria	3097
358	Ga0501035_0122805	3300049822	Bacteria	2269
359	Ga0501035_0379328	3300049822	Bacteria	1179
360	Ga0501044_0008051	3300049823	Bacteria	11575
361	Ga0501044_0049869	3300049823	Bacteria	4321
362	Ga0501044_0124637	3300049823	Bacteria	2574
363	Ga0501044_0604123	3300049823	Bacteria	990
364	nmdc:mga00v17_146031_c1	3300050491	Bacteria	1518
365	nmdc:mga0yw44_227711_c1	3300050492	Bacteria	1237
366	nmdc:mga0k408_199246_c1	3300050493	Bacteria	1195
367	nmdc:mga05p37_333732_c1	3300050507	Bacteria	1790
368	nmdc:mga09592_164154_c1	3300050508	Bacteria	1919
369	nmdc:mga08y16_113557_c1	3300050511	Bacteria	2820
370	nmdc:mga08y16_123471_c1	3300050511	Bacteria	2694
371	nmdc:mga0a205_35523_c2	3300050515	Bacteria	4455
372	Ga0500643_000031	3300053087	Bacteria	204488
373	Ga0500643_005386	3300053087	Bacteria	5527
374	Ga0500644_0001269	3300053088	Bacteria	6894
375	Ga0500651_0000024	3300053093	Bacteria	129450
376	Ga0500651_0001597	3300053093	Bacteria	11511
377	Ga0500651_0281581	3300053093	Bacteria	959
378	Ga0500641_0065924	3300053096	Unclassified	1516
379	Ga0500555_005962	3300053103	Bacteria	3455
380	Ga0500571_003124	3300053110	Bacteria	8428
381	Ga0500593_000394	3300053117	Bacteria	17385
382	Ga0500594_0001386	3300053118	Bacteria	5259
383	Ga0500594_0011066	3300053118	Bacteria	2104
384	Ga0500607_017269	3300053121	Bacteria	4119
385	Ga0500608_001315	3300053122	Bacteria	8869
386	Ga0500608_007698	3300053122	Bacteria	4475
387	Ga0500618_002261	3300053125	Bacteria	7488
388	Ga0500642_0001859	3300053130	Bacteria	6097
389	Ga0500652_005292	3300053131	Bacteria	4052
390	Ga0500655_007497	3300053133	Bacteria	1962
391	Ga0500658_0000226	3300053134	Bacteria	26958
392	Ga0500658_0000310	3300053134	Bacteria	21887
393	Ga0500559_0003642	3300053136	Bacteria	7532
394	Ga0500559_0016361	3300053136	Bacteria	3130
395	Ga0500559_0029050	3300053136	Bacteria	2365
396	Ga0500564_006460	3300053138	Bacteria	4889
397	Ga0500568_0000892	3300053139	Bacteria	20766
398	Ga0500573_0128999	3300053140	Bacteria	1402
399	Ga0500616_0000001	3300053153	Bacteria	1986011
400	Ga0500616_0057291	3300053153	Bacteria	2030
401	Ga0500616_0099432	3300053153	Bacteria	1425
402	Ga0500622_0000543	3300053156	Bacteria	34737
403	Ga0500624_011148	3300053157	Bacteria	1306
404	Ga0500633_0011923	3300053160	Bacteria	2383
405	Ga0500634_0002280	3300053161	Bacteria	8009
406	Ga0500636_0099488	3300053177	Bacteria	1655
407	Ga0500625_125116	3300053729	Bacteria	1024
408	Ga0500645_000015	3300053730	Bacteria	150140
409	Ga0500645_000651	3300053730	Bacteria	21912
410	Ga0500645_001759	3300053730	Bacteria	10497
411	Ga0500645_032841	3300053730	Bacteria	1555
412	Ga0466962_0006166	3300061719	Bacteria	5760
413	Ga0530510_0014587	3300061734	Bacteria	5544
414	Ga0530510_0038103	3300061734	Bacteria	3470
415	Ga0530510_0179998	3300061734	Bacteria	1567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300026142	Ga0207698_10277697	Ga0207698_102776972	207
2	3300049581	Ga0501047_0206212	Ga0501047_0206212_18_725	215
3	3300046683	Ga0495658_0398428	Ga0495658_0398428_162_857	217
4	3300049679	Ga0501249_072539	Ga0501249_072539_23_715	217
5	3300048919	Ga0496116_0180451	Ga0496116_0180451_27_716	220
6	3300046660	Ga0495625_0378790	Ga0495625_0378790_118_870	228
7	3300053125	Ga0500618_002261	Ga0500618_002261_4811_5623	231
8	iso_pu_bacteria	2842677519	2842681882	231
9	3300049570	Ga0501033_0347604	Ga0501033_0347604_21_749	234
10	3300047469	Ga0495673_0167845	Ga0495673_0167845_71_784	235
11	iso_pu_bacteria	2898795034	2898798554	235
12	3300007076	Ga0075435_100039608	Ga0075435_1000396084	236
13	3300053122	Ga0500608_001315	Ga0500608_001315_2181_2969	236
14	3300053156	Ga0500622_0000543	Ga0500622_0000543_5806_6594	236
15	iso_pu_bacteria	8045864390	8045868035	236
16	3300044842	Ga0466957_0053102	Ga0466957_0053102_1047_1823	237
17	3300053096	Ga0500641_0065924	Ga0500641_0065924_589_1368	237
18	3300053130	Ga0500642_0001859	Ga0500642_0001859_3835_4614	237
19	3300048924	Ga0496121_0035835	Ga0496121_0035835_1128_1964	238
20	3300050511	nmdc:mga08y16_113557_c1	nmdc:mga08y16_113557_c1_448_1272	238
21	3300003323	rootH1_10306502	rootH1_103065022	239
22	3300048923	Ga0496120_0166289	Ga0496120_0166289_17_778	239
23	iso_pu_bacteria	2510917027	2511179448	239
24	iso_pu_bacteria	2512564013	2512635824	239
25	iso_pu_bacteria	2857460504	2857461600	239
26	iso_pu_bacteria	2857472729	2857477033	239
27	iso_pu_bacteria	2915597211	2915602561	239
28	iso_pu_bacteria	2915606848	2915612020	239
29	iso_pu_bacteria	2929183550	2929187724	239
30	3300042876	Ga0451577_0187875	Ga0451577_0187875_252_1031	240
31	3300050508	nmdc:mga09592_164154_c1	nmdc:mga09592_164154_c1_1086_1844	240
32	iso_pu_bacteria	2643221613	2644080817	240
33	iso_pu_bacteria	2643221721	2644663866	240
34	iso_pu_bacteria	2904541872	2904543958	240
35	iso_pu_bacteria	2935890801	2935893859	240
36	3300036712	Ga0316584_0206960	Ga0316584_0206960_452_1231	241
37	3300045051	Ga0451576_0007484	Ga0451576_0007484_3020_3844	241
38	iso_pu_bacteria	2593339198	2595317518	241
39	iso_pu_bacteria	2864997549	2865001334	241
40	iso_pu_bacteria	2889295896	2889300454	241
41	iso_pu_bacteria	2980125574	2980126216	241
42	iso_pu_bacteria	2981284811	2981287632	241
43	iso_pu_bacteria	2981289755	2981292826	241
44	iso_pu_bacteria	2981980479	2981982960	241
45	iso_pu_bacteria	2981985349	2981987870	241
46	3300044673	Ga0453683_0028649	Ga0453683_0028649_280_1056	242
47	3300044712	Ga0453684_0460811	Ga0453684_0460811_79_855	242
48	3300045051	Ga0451576_0129292	Ga0451576_0129292_792_1577	242
49	3300061734	Ga0530510_0014587	Ga0530510_0014587_461_1234	242
50	iso_pu_bacteria	2738543013	2739252611	242
51	iso_pu_bacteria	2842733646	2842734682	242
52	iso_pu_bacteria	2885198086	2885199241	242
53	iso_pu_bacteria	2885211737	2885212892	242
54	3300042876	Ga0451577_0136615	Ga0451577_0136615_1079_1855	243
55	3300044712	Ga0453684_0085259	Ga0453684_0085259_1795_2571	243
56	iso_pu_bacteria	2524614857	2526062402	243
57	iso_pu_bacteria	2739367875	2740063750	243
58	iso_pu_bacteria	8055034563	8055036357	243
59	iso_pu_bacteria	2599185156	2599332091	244
60	iso_pu_bacteria	2643221547	2643758631	244
61	iso_pu_bacteria	2643221591	2643966072	244
62	iso_pu_bacteria	2643221629	2644166400	244
63	iso_pu_bacteria	2643221662	2644346559	244
64	iso_pu_bacteria	2690316117	2692315182	244
65	iso_pu_bacteria	2791355091	2792620484	244
66	iso_pu_bacteria	2791355092	2792625842	244
67	iso_pu_bacteria	2837678835	2837681807	244
68	iso_pu_bacteria	2854911287	2854916586	244
69	iso_pu_bacteria	2915650412	2915652518	244
70	iso_pu_bacteria	2939631187	2939635753	244
71	3300021361	Ga0213872_10003772	Ga0213872_100037722	245
72	3300039447	Ga0436361_0009230	Ga0436361_0009230_12816_13610	245
73	3300049568	Ga0501031_0090719	Ga0501031_0090719_1117_1896	245
74	3300050492	nmdc:mga0yw44_227711_c1	nmdc:mga0yw44_227711_c1_30_809	245
75	iso_pu_bacteria	2738541305	2738870195	245
76	iso_pu_bacteria	2837651117	2837652816	245
77	3300003322	rootL2_10157831	rootL2_101578313	246
78	3300003323	rootH1_10021282	rootH1_100212825	246
79	3300005338	Ga0068868_100141202	Ga0068868_1001412022	246
80	3300005347	Ga0070668_100301454	Ga0070668_1003014542	246
81	3300005365	Ga0070688_100082771	Ga0070688_1000827712	246
82	3300005435	Ga0070714_100214141	Ga0070714_1002141411	246
83	3300005544	Ga0070686_100051927	Ga0070686_1000519272	246
84	3300005617	Ga0068859_100048597	Ga0068859_1000485974	246
85	3300006844	Ga0075428_100205674	Ga0075428_1002056742	246
86	3300006931	Ga0097620_100048596	Ga0097620_1000485962	246
87	3300009094	Ga0111539_10108574	Ga0111539_101085743	246
88	3300014497	Ga0182008_10000845	Ga0182008_100008453	246
89	3300025972	Ga0207668_10040355	Ga0207668_100403552	246
90	3300027907	Ga0207428_10121453	Ga0207428_101214532	246
91	3300028794	Ga0307515_10001286	Ga0307515_1000128632	246
92	3300031456	Ga0307513_10109754	Ga0307513_101097543	246
93	3300031456	Ga0307513_10113574	Ga0307513_101135742	246
94	3300048929	Ga0496126_0024347	Ga0496126_0024347_106_921	246
95	3300050507	nmdc:mga05p37_333732_c1	nmdc:mga05p37_333732_c1_349_1173	246
96	3300050511	nmdc:mga08y16_123471_c1	nmdc:mga08y16_123471_c1_1003_1827	246
97	3300053118	Ga0500594_0011066	Ga0500594_0011066_1153_1932	246
98	3300053136	Ga0500559_0003642	Ga0500559_0003642_6273_7052	246
99	3300053136	Ga0500559_0016361	Ga0500559_0016361_1227_2087	246
100	3300053140	Ga0500573_0128999	Ga0500573_0128999_152_931	246
101	3300053729	Ga0500625_125116	Ga0500625_125116_21_803	246
102	iso_pu_bacteria	2643221604	2644036222	246
103	iso_pu_bacteria	2939631187	2939636076	246
104	iso_pu_bacteria	2939702853	2939704565	246
105	iso_pu_bacteria	2945984333	2945984585	246
106	iso_pu_bacteria	8005658619	8005662209	246
107	3300042876	Ga0451577_0577506	Ga0451577_0577506_89_898	247
108	3300046616	Ga0495668_0000858	Ga0495668_0000858_2458_3267	247
109	iso_pu_bacteria	2508501039	2508674681	247
110	iso_pu_bacteria	2721755693	2723602884	247
111	iso_pu_bacteria	2728369359	2730138870	247
112	iso_pu_bacteria	2751185905	2753809591	247
113	iso_pu_bacteria	2802428803	2802436573	247
114	iso_pu_bacteria	2842922631	2842924446	247
115	iso_pu_bacteria	2889276214	2889278847	247
116	iso_pu_bacteria	2904595352	2904598562	247
117	iso_pu_bacteria	2996706504	2996708104	247
118	iso_pu_bacteria	648028048	648169215	247
119	3300006846	Ga0075430_100083564	Ga0075430_1000835643	248
120	3300006880	Ga0075429_100188547	Ga0075429_1001885472	248
121	3300010375	Ga0105239_10767753	Ga0105239_107677532	248
122	3300025932	Ga0207690_10058275	Ga0207690_100582753	248
123	3300025937	Ga0207669_10189996	Ga0207669_101899962	248
124	3300026067	Ga0207678_10097974	Ga0207678_100979743	248
125	3300028794	Ga0307515_10000444	Ga0307515_100004446	248
126	3300028794	Ga0307515_10208045	Ga0307515_102080452	248
127	3300028794	Ga0307515_10215248	Ga0307515_102152482	248
128	3300031649	Ga0307514_10152822	Ga0307514_101528222	248
129	3300031901	Ga0307406_10112403	Ga0307406_101124032	248
130	3300037471	Ga0395905_0000707	Ga0395905_0000707_8810_9595	248
131	3300037471	Ga0395905_0003258	Ga0395905_0003258_12760_13548	248
132	3300042876	Ga0451577_0258505	Ga0451577_0258505_209_1036	248
133	3300044712	Ga0453684_0001048	Ga0453684_0001048_10080_10880	248
134	3300044712	Ga0453684_0002592	Ga0453684_0002592_8125_8925	248
135	3300044712	Ga0453684_0061490	Ga0453684_0061490_2587_3408	248
136	3300044712	Ga0453684_0132041	Ga0453684_0132041_1171_1998	248
137	3300045051	Ga0451576_0008790	Ga0451576_0008790_1692_2519	248
138	3300048913	Ga0496110_0324582	Ga0496110_0324582_168_980	248
139	3300048925	Ga0496122_0013167	Ga0496122_0013167_7263_8063	248
140	3300048928	Ga0496125_0139815	Ga0496125_0139815_387_1181	248
141	3300048929	Ga0496126_0076303	Ga0496126_0076303_1281_2099	248
142	3300049569	Ga0501032_0005254	Ga0501032_0005254_3735_4526	248
143	3300049569	Ga0501032_0101115	Ga0501032_0101115_699_1490	248
144	3300049570	Ga0501033_0021293	Ga0501033_0021293_2045_2836	248
145	3300049570	Ga0501033_0036530	Ga0501033_0036530_2573_3364	248
146	3300049570	Ga0501033_0049915	Ga0501033_0049915_1877_2680	248
147	3300049570	Ga0501033_0427965	Ga0501033_0427965_35_823	248
148	3300049571	Ga0501034_0297566	Ga0501034_0297566_93_929	248
149	3300049572	Ga0501036_0089499	Ga0501036_0089499_1736_2539	248
150	3300049578	Ga0501042_0049041	Ga0501042_0049041_661_1479	248
151	3300049579	Ga0501043_0083012	Ga0501043_0083012_440_1231	248
152	3300049579	Ga0501043_0103345	Ga0501043_0103345_1215_2018	248
153	3300049580	Ga0501046_0058630	Ga0501046_0058630_2005_2796	248
154	3300049580	Ga0501046_0092124	Ga0501046_0092124_869_1672	248
155	3300049580	Ga0501046_0504835	Ga0501046_0504835_12_827	248
156	3300049581	Ga0501047_0160553	Ga0501047_0160553_1133_1924	248
157	3300049586	Ga0501070_0205560	Ga0501070_0205560_684_1475	248
158	3300049591	Ga0501075_0148376	Ga0501075_0148376_382_1200	248
159	3300049741	Ga0501079_0102382	Ga0501079_0102382_1267_2085	248
160	3300049822	Ga0501035_0028901	Ga0501035_0028901_3708_4511	248
161	3300049822	Ga0501035_0050100	Ga0501035_0050100_1855_2646	248
162	3300049822	Ga0501035_0070440	Ga0501035_0070440_1861_2652	248
163	3300049822	Ga0501035_0379328	Ga0501035_0379328_364_1155	248
164	3300049823	Ga0501044_0049869	Ga0501044_0049869_2934_3725	248
165	3300049823	Ga0501044_0124637	Ga0501044_0124637_21_812	248
166	3300049823	Ga0501044_0604123	Ga0501044_0604123_166_954	248
167	3300053093	Ga0500651_0281581	Ga0500651_0281581_89_877	248
168	3300053136	Ga0500559_0029050	Ga0500559_0029050_38_826	248
169	3300053157	Ga0500624_011148	Ga0500624_011148_33_857	248
170	3300061734	Ga0530510_0038103	Ga0530510_0038103_1063_1878	248
171	3300061734	Ga0530510_0179998	Ga0530510_0179998_661_1461	248
172	iso_pu_bacteria	2547132374	2548500190	248
173	iso_pu_bacteria	2643221609	2644059950	248
174	iso_pu_bacteria	2643221611	2644074432	248
175	iso_pu_bacteria	2643221717	2644644493	248
176	iso_pu_bacteria	2738543012	2739241480	248
177	iso_pu_bacteria	2816332133	2816473644	248
178	3300005844	Ga0068862_100405427	Ga0068862_1004054272	249
179	3300005985	Ga0081539_10000317	Ga0081539_10000317133	249
180	3300006852	Ga0075433_10137744	Ga0075433_101377442	249
181	3300006880	Ga0075429_100357397	Ga0075429_1003573972	249
182	3300009094	Ga0111539_10248956	Ga0111539_102489562	249
183	3300009147	Ga0114129_10585101	Ga0114129_105851012	249
184	3300011119	Ga0105246_10129932	Ga0105246_101299321	249
185	3300013308	Ga0157375_10139154	Ga0157375_101391542	249
186	3300025284	Ga0209130_1006660	Ga0209130_10066601	249
187	3300025291	Ga0209675_1000458	Ga0209675_100045819	249
188	3300025292	Ga0209676_1002189	Ga0209676_10021897	249
189	3300025304	Ga0209257_1016028	Ga0209257_10160282	249
190	3300028380	Ga0268265_10415692	Ga0268265_104156921	249
191	3300028794	Ga0307515_10000213	Ga0307515_1000021355	249
192	3300030522	Ga0307512_10249741	Ga0307512_102497411	249
193	3300031456	Ga0307513_10070770	Ga0307513_100707703	249
194	3300031649	Ga0307514_10000819	Ga0307514_1000081924	249
195	3300031911	Ga0307412_10096986	Ga0307412_100969862	249
196	3300032004	Ga0307414_10281882	Ga0307414_102818822	249
197	3300044693	Ga0466961_0076535	Ga0466961_0076535_1171_1983	249
198	3300044694	Ga0466963_0061236	Ga0466963_0061236_1268_2080	249
199	3300045049	Ga0466959_0324609	Ga0466959_0324609_162_974	249
200	3300046460	Ga0495638_0104872	Ga0495638_0104872_540_1367	249
201	3300046460	Ga0495638_0154698	Ga0495638_0154698_132_920	249
202	3300048907	Ga0496104_0467935	Ga0496104_0467935_174_986	249
203	3300048927	Ga0496124_0041275	Ga0496124_0041275_1109_1951	249
204	3300049580	Ga0501046_0173282	Ga0501046_0173282_563_1372	249
205	3300049586	Ga0501070_0227935	Ga0501070_0227935_357_1166	249
206	3300049822	Ga0501035_0122805	Ga0501035_0122805_19_828	249
207	3300050515	nmdc:mga0a205_35523_c2	nmdc:mga0a205_35523_c2_690_1529	249
208	3300053088	Ga0500644_0001269	Ga0500644_0001269_5980_6795	249
209	3300053093	Ga0500651_0001597	Ga0500651_0001597_9386_10213	249
210	3300053131	Ga0500652_005292	Ga0500652_005292_1744_2571	249
211	3300053133	Ga0500655_007497	Ga0500655_007497_1030_1857	249
212	3300053153	Ga0500616_0000001	Ga0500616_0000001_823065_823892	249
213	3300053730	Ga0500645_000015	Ga0500645_000015_48547_49374	249
214	iso_pu_bacteria	2599185214	2599624081	249
215	iso_pu_bacteria	2599185226	2599672092	249
216	iso_pu_bacteria	2599185227	2599681825	249
217	iso_pu_bacteria	2599185229	2599693839	249
218	iso_pu_bacteria	2738541277	2738719895	249
219	iso_pu_bacteria	2738541307	2738879693	249
220	iso_pu_bacteria	2738543019	2739279094	249
221	iso_pu_bacteria	2928070936	2928076764	249
222	iso_pu_bacteria	2928084124	2928090487	249
223	iso_pu_bacteria	2929160207	2929162483	249
224	3300003578	Ga0006562J51391_1033731	Ga0006562J51391_10337312	250
225	3300042876	Ga0451577_0138094	Ga0451577_0138094_342_1202	250
226	3300044712	Ga0453684_0001308	Ga0453684_0001308_37950_38816	250
227	3300044712	Ga0453684_0030969	Ga0453684_0030969_3084_3944	250
228	3300046539	Ga0495621_0038580	Ga0495621_0038580_646_1443	250
229	3300048922	Ga0496119_0037767	Ga0496119_0037767_980_1813	250
230	3300048924	Ga0496121_0078676	Ga0496121_0078676_747_1580	250
231	3300048924	Ga0496121_0080936	Ga0496121_0080936_577_1374	250
232	3300048925	Ga0496122_0013938	Ga0496122_0013938_879_1712	250
233	3300048926	Ga0496123_0015023	Ga0496123_0015023_1641_2474	250
234	3300048926	Ga0496123_0171011	Ga0496123_0171011_56_853	250
235	3300048927	Ga0496124_0185005	Ga0496124_0185005_706_1539	250
236	3300048928	Ga0496125_0000693	Ga0496125_0000693_48659_49492	250
237	3300048929	Ga0496126_0068813	Ga0496126_0068813_1199_2032	250
238	3300053118	Ga0500594_0001386	Ga0500594_0001386_3057_3854	250
239	3300053153	Ga0500616_0099432	Ga0500616_0099432_160_1047	250
240	iso_pu_bacteria	2718218334	2721025604	250
241	iso_pu_bacteria	2738543009	2739225878	250
242	3300009036	Ga0105244_10007173	Ga0105244_100071732	251
243	3300017792	Ga0163161_10005102	Ga0163161_100051023	251
244	3300046460	Ga0495638_0088171	Ga0495638_0088171_964_1770	251
245	3300046513	Ga0495616_0001145	Ga0495616_0001145_17142_17948	251
246	3300046518	Ga0495631_0000792	Ga0495631_0000792_2000_2806	251
247	3300046519	Ga0495632_0000059	Ga0495632_0000059_65478_66236	251
248	3300046530	Ga0495654_0008411	Ga0495654_0008411_176_982	251
249	3300046616	Ga0495668_0212052	Ga0495668_0212052_44_850	251
250	3300046660	Ga0495625_0185846	Ga0495625_0185846_484_1290	251
251	3300048925	Ga0496122_0239561	Ga0496122_0239561_17_823	251
252	3300053134	Ga0500658_0000226	Ga0500658_0000226_4164_4970	251
253	3300053139	Ga0500568_0000892	Ga0500568_0000892_11160_11966	251
254	3300053153	Ga0500616_0057291	Ga0500616_0057291_1138_1944	251
255	iso_pu_bacteria	2511231002	2511245708	251
256	3300003187	JGI25151J46595_10005672	JGI25151J46595_100056725	252
257	3300003781	Ga0055536_1002768	Ga0055536_10027683	252
258	3300003781	Ga0055536_1014545	Ga0055536_10145451	252
259	3300003792	Ga0055540_1000733	Ga0055540_100073321	252
260	3300009148	Ga0105243_10004803	Ga0105243_100048037	252
261	3300025291	Ga0209675_1003175	Ga0209675_10031752	252
262	3300025292	Ga0209676_1000260	Ga0209676_100026066	252
263	3300025294	Ga0209025_1000732	Ga0209025_10007322	252
264	3300025294	Ga0209025_1033819	Ga0209025_10338192	252
265	3300025298	Ga0209050_1048899	Ga0209050_10488992	252
266	3300025303	Ga0209051_1000319	Ga0209051_100031926	252
267	3300025304	Ga0209257_1015783	Ga0209257_10157832	252
268	3300025935	Ga0207709_10000240	Ga0207709_1000024066	252
269	3300030731	Ga0316177_1109894	Ga0316177_11098942	252
270	3300030733	Ga0314311_1045676	Ga0314311_10456763	252
271	3300030735	Ga0316178_1066381	Ga0316178_10663813	252
272	3300030736	Ga0316180_1006347	Ga0316180_10063472	252
273	3300030744	Ga0316181_1054005	Ga0316181_10540055	252
274	3300031548	Ga0307408_100037454	Ga0307408_1000374543	252
275	3300031731	Ga0307405_10006953	Ga0307405_100069533	252
276	3300031731	Ga0307405_10267846	Ga0307405_102678462	252
277	3300031731	Ga0307405_10446530	Ga0307405_104465302	252
278	3300031731	Ga0307405_10616663	Ga0307405_106166632	252
279	3300031911	Ga0307412_10015584	Ga0307412_100155845	252
280	3300032002	Ga0307416_100102756	Ga0307416_1001027562	252
281	3300032005	Ga0307411_10030151	Ga0307411_100301512	252
282	3300047321	Ga0495676_0147526	Ga0495676_0147526_485_1297	252
283	3300047472	Ga0495686_0000024	Ga0495686_0000024_85807_86565	252
284	3300047673	Ga0495593_0051047	Ga0495593_0051047_1272_2084	252
285	3300048904	Ga0496101_0148853	Ga0496101_0148853_445_1260	252
286	3300048919	Ga0496116_0065094	Ga0496116_0065094_1115_1933	252
287	3300048921	Ga0496118_0000423	Ga0496118_0000423_59829_60587	252
288	3300048925	Ga0496122_0074821	Ga0496122_0074821_104_904	252
289	3300048926	Ga0496123_0104861	Ga0496123_0104861_138_938	252
290	3300048928	Ga0496125_0070806	Ga0496125_0070806_322_1122	252
291	3300053087	Ga0500643_005386	Ga0500643_005386_4591_5403	252
292	3300053093	Ga0500651_0000024	Ga0500651_0000024_126270_127082	252
293	3300053110	Ga0500571_003124	Ga0500571_003124_7154_7966	252
294	3300053121	Ga0500607_017269	Ga0500607_017269_177_983	252
295	3300053122	Ga0500608_007698	Ga0500608_007698_3560_4372	252
296	3300053134	Ga0500658_0000310	Ga0500658_0000310_2166_2978	252
297	3300053138	Ga0500564_006460	Ga0500564_006460_3960_4772	252
298	3300053161	Ga0500634_0002280	Ga0500634_0002280_549_1361	252
299	3300053177	Ga0500636_0099488	Ga0500636_0099488_424_1236	252
300	iso_pu_bacteria	2593339238	2595447577	252
301	iso_pu_bacteria	2884338543	2884338940	252
302	iso_pu_bacteria	2941471342	2941475659	252
303	3300046460	Ga0495638_0024599	Ga0495638_0024599_1956_2723	253
304	3300046471	Ga0495650_0001790	Ga0495650_0001790_3203_3970	253
305	3300046491	Ga0495584_0000221	Ga0495584_0000221_29849_30616	253
306	3300046492	Ga0495585_0001150	Ga0495585_0001150_13998_14765	253
307	3300046507	Ga0495606_0002675	Ga0495606_0002675_12800_13567	253
308	3300046512	Ga0495610_0004309	Ga0495610_0004309_5454_6221	253
309	3300046513	Ga0495616_0000051	Ga0495616_0000051_14343_15110	253
310	3300046515	Ga0495620_0000379	Ga0495620_0000379_13451_14218	253
311	3300046518	Ga0495631_0000174	Ga0495631_0000174_29393_30160	253
312	3300046519	Ga0495632_0003696	Ga0495632_0003696_6358_7125	253
313	3300046519	Ga0495632_0008606	Ga0495632_0008606_3298_4065	253
314	3300046522	Ga0495643_0172874	Ga0495643_0172874_219_986	253
315	3300046524	Ga0495648_0022258	Ga0495648_0022258_2636_3403	253
316	3300046648	Ga0495611_0000032	Ga0495611_0000032_14181_14948	253
317	3300046660	Ga0495625_0094507	Ga0495625_0094507_317_1084	253
318	3300046691	Ga0495670_0002951	Ga0495670_0002951_4037_4804	253
319	3300047323	Ga0495683_0002957	Ga0495683_0002957_992_1759	253
320	3300047469	Ga0495673_0000310	Ga0495673_0000310_8799_9566	253
321	3300047472	Ga0495686_0043040	Ga0495686_0043040_1460_2227	253
322	3300048924	Ga0496121_0004043	Ga0496121_0004043_6995_7762	253
323	3300053160	Ga0500633_0011923	Ga0500633_0011923_724_1491	253
324	3300002987	JGI25159J45721_1000268	JGI25159J45721_10002689	254
325	3300003187	JGI25151J46595_10002521	JGI25151J46595_100025216	254
326	3300003354	JGI25160J50197_1000071	JGI25160J50197_100007117	254
327	3300003374	JGI25161J50226_1000030	JGI25161J50226_100003070	254
328	3300003771	Ga0055526_1002275	Ga0055526_10022758	254
329	3300003771	Ga0055526_1019322	Ga0055526_10193222	254
330	3300003773	Ga0055537_1000282	Ga0055537_100028232	254
331	3300003773	Ga0055537_1013935	Ga0055537_10139352	254
332	3300003775	Ga0055524_1000006	Ga0055524_1000006225	254
333	3300003784	Ga0055534_1000624	Ga0055534_10006247	254
334	3300003790	Ga0055528_1020068	Ga0055528_10200682	254
335	3300003791	Ga0055530_10000295	Ga0055530_1000029530	254
336	3300003792	Ga0055540_1000005	Ga0055540_100000588	254
337	3300003794	Ga0055531_10019263	Ga0055531_100192633	254
338	3300004625	Ga0055543_1000269	Ga0055543_100026910	254
339	3300005262	Ga0065165_1003436	Ga0065165_100343610	254
340	3300005262	Ga0065165_1004300	Ga0065165_10043002	254
341	3300005262	Ga0065165_1014112	Ga0065165_10141122	254
342	3300006946	Ga0079104_1011640	Ga0079104_10116402	254
343	3300013104	Ga0157370_10159977	Ga0157370_101599772	254
344	3300013306	Ga0163162_10088884	Ga0163162_100888842	254
345	3300017792	Ga0163161_10004982	Ga0163161_100049824	254
346	3300025245	Ga0207425_1001788	Ga0207425_10017882	254
347	3300025245	Ga0207425_1002577	Ga0207425_10025772	254
348	3300025258	Ga0209129_1005056	Ga0209129_10050564	254
349	3300025263	Ga0209565_1000004	Ga0209565_100000463	254
350	3300025263	Ga0209565_1000745	Ga0209565_10007458	254
351	3300025273	Ga0209673_1000450	Ga0209673_100045042	254
352	3300025284	Ga0209130_1000060	Ga0209130_1000060114	254
353	3300025284	Ga0209130_1000818	Ga0209130_100081813	254
354	3300025291	Ga0209675_1000096	Ga0209675_100009688	254
355	3300025291	Ga0209675_1013485	Ga0209675_10134852	254
356	3300025292	Ga0209676_1000007	Ga0209676_1000007609	254
357	3300025292	Ga0209676_1013777	Ga0209676_10137771	254
358	3300025294	Ga0209025_1001572	Ga0209025_10015726	254
359	3300025294	Ga0209025_1002753	Ga0209025_10027538	254
360	3300025294	Ga0209025_1005609	Ga0209025_10056096	254
361	3300025295	Ga0209564_1000495	Ga0209564_100049555	254
362	3300025295	Ga0209564_1000677	Ga0209564_100067714	254
363	3300025295	Ga0209564_1028114	Ga0209564_10281142	254
364	3300025297	Ga0209758_1005515	Ga0209758_10055152	254
365	3300025298	Ga0209050_1000003	Ga0209050_1000003899	254
366	3300025298	Ga0209050_1007902	Ga0209050_10079027	254
367	3300025298	Ga0209050_1011008	Ga0209050_10110084	254
368	3300025299	Ga0209256_1000001	Ga0209256_1000001905	254
369	3300025302	Ga0207426_1000025	Ga0207426_100002535	254
370	3300025302	Ga0207426_1001808	Ga0207426_10018088	254
371	3300025303	Ga0209051_1000003	Ga0209051_1000003899	254
372	3300025304	Ga0209257_1000020	Ga0209257_1000020609	254
373	3300025304	Ga0209257_1024486	Ga0209257_10244862	254
374	3300031456	Ga0307513_10000094	Ga0307513_10000094104	254
375	3300031548	Ga0307408_100016308	Ga0307408_1000163086	254
376	3300031730	Ga0307516_10029834	Ga0307516_100298344	254
377	3300041512	Ga0451853_3291156	Ga0451853_3291156_572_1423	254
378	3300046452	Ga0495617_000081	Ga0495617_000081_60356_61126	254
379	3300046452	Ga0495617_000279	Ga0495617_000279_25810_26580	254
380	3300046460	Ga0495638_0000139	Ga0495638_0000139_113568_114338	254
381	3300046501	Ga0495607_0000067	Ga0495607_0000067_35338_36108	254
382	3300046507	Ga0495606_0003127	Ga0495606_0003127_2544_3314	254
383	3300046513	Ga0495616_0017453	Ga0495616_0017453_1234_2004	254
384	3300046515	Ga0495620_0000066	Ga0495620_0000066_77546_78316	254
385	3300046520	Ga0495637_0017844	Ga0495637_0017844_633_1403	254
386	3300046538	Ga0495609_0004802	Ga0495609_0004802_2676_3446	254
387	3300046616	Ga0495668_0141228	Ga0495668_0141228_344_1114	254
388	3300046648	Ga0495611_0000002	Ga0495611_0000002_613666_614436	254
389	3300046660	Ga0495625_0000002	Ga0495625_0000002_618151_618921	254
390	3300046660	Ga0495625_0003466	Ga0495625_0003466_3878_4648	254
391	3300046691	Ga0495670_0000688	Ga0495670_0000688_14464_15234	254
392	3300046692	Ga0495671_0000183	Ga0495671_0000183_26413_27183	254
393	3300046794	Ga0495589_0000067	Ga0495589_0000067_87941_88711	254
394	3300046810	Ga0495660_0000384	Ga0495660_0000384_20396_21166	254
395	3300047446	Ga0495679_000003	Ga0495679_000003_181513_182283	254
396	3300047469	Ga0495673_0001190	Ga0495673_0001190_15814_16584	254
397	3300047472	Ga0495686_0217161	Ga0495686_0217161_216_986	254
398	3300048909	Ga0496106_0001098	Ga0496106_0001098_3373_4143	254
399	3300048924	Ga0496121_0054084	Ga0496121_0054084_1302_2072	254
400	3300048924	Ga0496121_0267272	Ga0496121_0267272_215_985	254
401	3300049459	Ga0495678_000026	Ga0495678_000026_66121_66891	254
402	3300050491	nmdc:mga00v17_146031_c1	nmdc:mga00v17_146031_c1_93_932	254
403	3300050493	nmdc:mga0k408_199246_c1	nmdc:mga0k408_199246_c1_88_927	254
404	3300053087	Ga0500643_000031	Ga0500643_000031_106472_107242	254
405	3300053103	Ga0500555_005962	Ga0500555_005962_1123_1893	254
406	3300053117	Ga0500593_000394	Ga0500593_000394_8370_9221	254
407	3300053730	Ga0500645_000651	Ga0500645_000651_14292_15143	254
408	3300053730	Ga0500645_001759	Ga0500645_001759_2948_3811	254
409	3300053730	Ga0500645_032841	Ga0500645_032841_192_1043	254
410	iso_pu_bacteria	2884411467	2884412932	254
411	3300005577	Ga0068857_100261533	Ga0068857_1002615332	255
412	3300009093	Ga0105240_10000343	Ga0105240_1000034328	255
413	3300009093	Ga0105240_10000525	Ga0105240_1000052530	255
414	3300010375	Ga0105239_10000020	Ga0105239_10000020176	255
415	3300025913	Ga0207695_10000318	Ga0207695_1000031863	255
416	3300025913	Ga0207695_10000382	Ga0207695_1000038272	255
417	3300048908	Ga0496105_0012639	Ga0496105_0012639_4316_5143	255
418	3300048918	Ga0496115_0253542	Ga0496115_0253542_358_1185	255
419	3300048920	Ga0496117_0002398	Ga0496117_0002398_5740_6567	255
420	3300048921	Ga0496118_0000224	Ga0496118_0000224_55307_56134	255
421	3300048921	Ga0496118_0003065	Ga0496118_0003065_5383_6210	255
422	3300048922	Ga0496119_0000139	Ga0496119_0000139_37892_38719	255
423	3300048922	Ga0496119_0006518	Ga0496119_0006518_9180_10007	255
424	3300048923	Ga0496120_0000185	Ga0496120_0000185_53683_54510	255
425	3300048923	Ga0496120_0000862	Ga0496120_0000862_29558_30385	255
426	3300048924	Ga0496121_0102701	Ga0496121_0102701_209_1036	255
427	3300048929	Ga0496126_0000491	Ga0496126_0000491_65738_66565	255
428	3300048929	Ga0496126_0012931	Ga0496126_0012931_82_909	255
429	3300001904	JGI24736J21556_1004701	JGI24736J21556_10047012	256
430	3300001979	JGI24740J21852_10001962	JGI24740J21852_100019623	256
431	3300001989	JGI24739J22299_10000009	JGI24739J22299_1000000927	256
432	3300001990	JGI24737J22298_10019820	JGI24737J22298_100198202	256
433	3300003215	JGI25153J46596_10011864	JGI25153J46596_100118643	256
434	3300003316	rootH1_10074450	rootH1_100744505	256
435	3300003578	Ga0006562J51391_1099714	Ga0006562J51391_10997142	256
436	3300003578	Ga0006562J51391_1099715	Ga0006562J51391_10997154	256
437	3300005262	Ga0065165_1003639	Ga0065165_10036394	256
438	3300005341	Ga0070691_10278038	Ga0070691_102780381	256
439	3300005563	Ga0068855_100001529	Ga0068855_10000152911	256
440	3300005563	Ga0068855_100001606	Ga0068855_10000160610	256
441	3300005564	Ga0070664_100299365	Ga0070664_1002993652	256
442	3300005577	Ga0068857_100000492	Ga0068857_10000049217	256
443	3300005578	Ga0068854_100000378	Ga0068854_10000037810	256
444	3300005578	Ga0068854_100001428	Ga0068854_10000142811	256
445	3300005616	Ga0068852_100083866	Ga0068852_1000838663	256
446	3300005834	Ga0068851_10028559	Ga0068851_100285593	256
447	3300005842	Ga0068858_100032806	Ga0068858_1000328063	256
448	3300009093	Ga0105240_10005430	Ga0105240_1000543010	256
449	3300009093	Ga0105240_10009205	Ga0105240_100092058	256
450	3300009093	Ga0105240_10152191	Ga0105240_101521912	256
451	3300009545	Ga0105237_10000016	Ga0105237_1000001617	256
452	3300010375	Ga0105239_10045866	Ga0105239_100458662	256
453	3300013105	Ga0157369_10006172	Ga0157369_100061724	256
454	3300025229	Ga0209147_104730	Ga0209147_1047302	256
455	3300025297	Ga0209758_1000290	Ga0209758_100029018	256
456	3300025297	Ga0209758_1077869	Ga0209758_10778692	256
457	3300025321	Ga0207656_10017749	Ga0207656_100177493	256
458	3300025904	Ga0207647_10000014	Ga0207647_1000001472	256
459	3300025913	Ga0207695_10000307	Ga0207695_1000030784	256
460	3300025913	Ga0207695_10015812	Ga0207695_100158126	256
461	3300025913	Ga0207695_10105429	Ga0207695_101054293	256
462	3300025914	Ga0207671_10000013	Ga0207671_10000013109	256
463	3300025945	Ga0207679_10209466	Ga0207679_102094662	256
464	3300025949	Ga0207667_10000040	Ga0207667_1000004095	256
465	3300025949	Ga0207667_10000047	Ga0207667_1000004757	256
466	3300025981	Ga0207640_10000009	Ga0207640_1000000996	256
467	3300025981	Ga0207640_10003961	Ga0207640_100039613	256
468	3300026035	Ga0207703_10077829	Ga0207703_100778292	256
469	3300026116	Ga0207674_10000012	Ga0207674_1000001223	256
470	3300026142	Ga0207698_10028307	Ga0207698_100283072	256
471	3300031456	Ga0307513_10000006	Ga0307513_10000006147	256
472	3300044656	Ga0466969_0022255	Ga0466969_0022255_930_1751	256
473	3300044672	Ga0466982_0000002	Ga0466982_0000002_211076_211897	256
474	3300044684	Ga0466966_0006312	Ga0466966_0006312_6091_6912	256
475	3300044706	Ga0466964_0148067	Ga0466964_0148067_145_966	256
476	3300044719	Ga0466971_0005493	Ga0466971_0005493_2244_3065	256
477	3300044765	Ga0466970_0052111	Ga0466970_0052111_1159_1980	256
478	3300044842	Ga0466957_0216499	Ga0466957_0216499_183_1004	256
479	3300048909	Ga0496106_0151571	Ga0496106_0151571_1021_1791	256
480	3300048911	Ga0496108_0379885	Ga0496108_0379885_219_989	256
481	3300048920	Ga0496117_0007987	Ga0496117_0007987_1041_1811	256
482	3300048921	Ga0496118_0000268	Ga0496118_0000268_8594_9364	256
483	3300048924	Ga0496121_0000096	Ga0496121_0000096_145411_146181	256
484	3300048924	Ga0496121_0006635	Ga0496121_0006635_13030_13851	256
485	3300048925	Ga0496122_0245947	Ga0496122_0245947_132_902	256
486	3300048925	Ga0496122_0259227	Ga0496122_0259227_132_902	256
487	3300048926	Ga0496123_0033564	Ga0496123_0033564_1154_1924	256
488	3300048926	Ga0496123_0074988	Ga0496123_0074988_601_1371	256
489	3300048928	Ga0496125_0000044	Ga0496125_0000044_140811_141632	256
490	3300048928	Ga0496125_0009965	Ga0496125_0009965_7597_8367	256
491	3300048929	Ga0496126_0008022	Ga0496126_0008022_5169_5939	256
492	3300049822	Ga0501035_0010956	Ga0501035_0010956_5162_5980	256
493	3300049823	Ga0501044_0008051	Ga0501044_0008051_3187_4005	256
494	3300061719	Ga0466962_0006166	Ga0466962_0006166_2353_3174	256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

29

166

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5b58-assembly1.cif.gz_C	inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia	0.9526	9	256
4g1u-assembly1.cif.gz_D	x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis	0.9396	8	256
5b57-assembly1.cif.gz_C	inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia	0.927	9	256
5b58-assembly1.cif.gz_D	inward-facing conformation of abc heme importer bhuuv in complex with periplasmic heme binding protein bhut from burkholderia cenocepacia	0.9265	9	256
5b57-assembly1.cif.gz_D	inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia	0.9262	9	256

ID	Description	Score	Start	End	Superfamily
af_Q2G072_1_252_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9584	9	248	3.40.50.300
4g1uC00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9393	7	256	3.40.50.300
af_Q58283_1_248_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9367	9	245	3.40.50.300
af_P15031_2_251_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9358	9	251	3.40.50.300
af_O33189_10_251_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.929	1	231	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A7W9ZE67-F1-model_v4	Iron complex transport system ATP-binding protein	0.9669	9	256	GO:0005524 GO:0016887
AF-A0A653LTZ0-F1-model_v4	Hemin import ATP-binding protein HmuV (Modular protein) (EC 3.6.3.-)	0.9622	9	248	GO:0005524 GO:0016020 GO:0016887
AF-A0A0Q8NL85-F1-model_v4	Iron ABC transporter	0.9609	9	247	GO:0005524 GO:0016887
AF-A0A7W0CJP9-F1-model_v4	Iron complex transport system ATP-binding protein	0.9568	9	256	GO:0005524 GO:0016887
AF-A0A2M9LCL9-F1-model_v4	Heme ABC transporter ATP-binding protein	0.9546	5	248	GO:0005524 GO:0016887

Feature Viewer

pLDDT	pTM	Quality
91.78	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F454592

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00005

ABC_tran

ABC transporter

29

166

0.94

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map