F454520

General Info

Members Datasets Scaffolds Average Seq Length
494 256 492 415

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10045491|Ga0070676_100454912
Length 460
Sequence VKSSLLQKYGFHTSRFAPGSLDCAFGSARDDSGELGNCQVALGHSSSLMPPETRQLEAPDPLARTMEAQAESTPDDDLIGEKMIINMGPSHPATHGVLRLVLELDGELVTKATPDIGYLHRGDEKIAENMQYNQFIPYTDRLDYLAPLSNNVAYALAVEKLMGWELPPRGKAIRVICCETARISSHLLGLGAMALDXXXXTVFLYTFTEREKLYNLFELLTGARFTTSYTRVGGQIRDLPETFIPQLETFLDDEIDRLLTRNKIFVDRTRDVGIIPKDRAIAYAISGPNLRGSGVEHDLRRRHPYLDYEQYDFEIPIGSVGDCYDRYLIRLEEMRQSVRILRQVIDKLPSGPINVADWKNMLPPKSHVMTKMEELIHHFIVVTEGLDAPPGEIYFGAENPKGELGFYINSKGGGVPHRLKIRAPSFVNLSILPELLPGCMMSDIVAILGSLDFVMGECDR

Samples

Sample ID Description Type Environment
1 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
2 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
145 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
146 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
188 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
189 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
250 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
251 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
252 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
254 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
255 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.44
Nodule 0
Rhizoplane 5.06
Rhizosphere 87.85
Stem 0
Stem Tuber 0
Unclassified 3.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000068 3300000545 Bacteria 19320
2 JGI24743J22301_10000329 3300001991 Bacteria 5229
3 JGI24033J26618_1000106 3300002155 Bacteria 11589
4 JGI25406J46586_10000013 3300003203 Bacteria 101544
5 rootH2_10033813 3300003320 Bacteria 11456
6 rootH1_10007259 3300003323 Bacteria 61283
7 Ga0065704_10080302 3300005289 Bacteria 3973
8 Ga0065712_10016516 3300005290 Bacteria 1668
9 Ga0065712_10086619 3300005290 Bacteria 2614
10 Ga0065715_10002255 3300005293 Bacteria 9300
11 Ga0065715_10103715 3300005293 Bacteria 3013
12 Ga0065707_10009940 3300005295 Bacteria 4662
13 Ga0065707_10012258 3300005295 Bacteria 2217
14 Ga0070658_10013851 3300005327 Bacteria 6472
15 Ga0070658_10069841 3300005327 Unclassified 2874
16 Ga0070676_10003035 3300005328 Bacteria 8673
17 Ga0070676_10026624 3300005328 Bacteria 3274
18 Ga0070676_10040767 3300005328 Bacteria 2690
19 Ga0070676_10045491 3300005328 Bacteria 2557
20 Ga0070690_100004401 3300005330 Bacteria 7815
21 Ga0070690_100077480 3300005330 Bacteria 2170
22 Ga0070670_100024011 3300005331 Bacteria 5245
23 Ga0068869_100076282 3300005334 Bacteria 2492
24 Ga0068869_100215965 3300005334 Unclassified 1518
25 Ga0070666_10003065 3300005335 Bacteria 10148
26 Ga0068868_100038840 3300005338 Bacteria 3695
27 Ga0068868_100082695 3300005338 Bacteria 2575
28 Ga0070660_100101060 3300005339 Bacteria 2285
29 Ga0070689_100046425 3300005340 Bacteria 3348
30 Ga0070661_100000369 3300005344 Bacteria 35464
31 Ga0070661_100026268 3300005344 Bacteria 4187
32 Ga0070668_100002522 3300005347 Bacteria 13475
33 Ga0070668_100145846 3300005347 Bacteria 1911
34 Ga0070669_100040723 3300005353 Bacteria 3377
35 Ga0070675_100000891 3300005354 Bacteria 21212
36 Ga0070675_100005953 3300005354 Bacteria 9340
37 Ga0070675_100010952 3300005354 Bacteria 7097
38 Ga0070675_100022081 3300005354 Bacteria 5085
39 Ga0070671_100004298 3300005355 Bacteria 11276
40 Ga0070671_100014044 3300005355 Bacteria 6466
41 Ga0070671_100017861 3300005355 Bacteria 5751
42 Ga0070671_100034454 3300005355 Bacteria 4191
43 Ga0070671_100058142 3300005355 Bacteria 3219
44 Ga0070674_100047406 3300005356 Bacteria 2944
45 Ga0070673_100024145 3300005364 Bacteria 4453
46 Ga0070673_100043430 3300005364 Bacteria 3474
47 Ga0070688_100066861 3300005365 Unclassified 2288
48 Ga0070659_100119041 3300005366 Bacteria 2137
49 Ga0070667_100054771 3300005367 Bacteria 3368
50 Ga0070667_100094854 3300005367 Unclassified 2571
51 Ga0070709_10028965 3300005434 Bacteria 3307
52 Ga0070709_10202384 3300005434 Unclassified 1407
53 Ga0070714_100073075 3300005435 Unclassified 2970
54 Ga0070714_100099276 3300005435 Unclassified 2562
55 Ga0070713_100009669 3300005436 Bacteria 6922
56 Ga0070710_10179991 3300005437 Bacteria 1323
57 Ga0070711_100003143 3300005439 Bacteria 9578
58 Ga0070711_100071138 3300005439 Unclassified 2451
59 Ga0070705_100021634 3300005440 Bacteria 3424
60 Ga0070708_100028393 3300005445 Bacteria 4814
61 Ga0070708_100045276 3300005445 Bacteria 3875
62 Ga0070708_100059764 3300005445 Bacteria 3399
63 Ga0070708_100061724 3300005445 Unclassified 3349
64 Ga0070708_100093116 3300005445 Bacteria 2746
65 Ga0070708_100134905 3300005445 Unclassified 2286
66 Ga0070708_100257360 3300005445 Bacteria 1640
67 Ga0070708_100259219 3300005445 Bacteria 1634
68 Ga0070678_100008408 3300005456 Bacteria 6180
69 Ga0070678_100017923 3300005456 Bacteria 4574
70 Ga0070681_10054796 3300005458 Bacteria 3973
71 Ga0068867_100000185 3300005459 Bacteria 41276
72 Ga0068867_100030593 3300005459 Bacteria 3883
73 Ga0070706_100000069 3300005467 Bacteria 119582
74 Ga0070706_100000926 3300005467 Bacteria 32082
75 Ga0070706_100002974 3300005467 Bacteria 16804
76 Ga0070706_100005124 3300005467 Bacteria 12503
77 Ga0070706_100007104 3300005467 Bacteria 10538
78 Ga0070706_100015254 3300005467 Bacteria 7093
79 Ga0070706_100024268 3300005467 Bacteria 5582
80 Ga0070706_100041794 3300005467 Bacteria 4234
81 Ga0070707_100000320 3300005468 Bacteria 47282
82 Ga0070707_100002974 3300005468 Bacteria 16079
83 Ga0070707_100017381 3300005468 Bacteria 6761
84 Ga0070707_100112890 3300005468 Bacteria 2636
85 Ga0070707_100121711 3300005468 Unclassified 2534
86 Ga0070707_100147707 3300005468 Bacteria 2288
87 Ga0070707_100200978 3300005468 Bacteria 1943
88 Ga0070707_100260116 3300005468 Unclassified 1688
89 Ga0070698_100003081 3300005471 Bacteria 18380
90 Ga0070698_100003870 3300005471 Bacteria 16460
91 Ga0070698_100007372 3300005471 Bacteria 11908
92 Ga0070698_100118422 3300005471 Bacteria 2609
93 Ga0070698_100135949 3300005471 Unclassified 2412
94 Ga0070699_100008606 3300005518 Bacteria 8843
95 Ga0070699_100041151 3300005518 Bacteria 4000
96 Ga0070699_100063490 3300005518 Bacteria 3202
97 Ga0070699_100108214 3300005518 Bacteria 2439
98 Ga0070679_100108372 3300005530 Bacteria 2764
99 Ga0070684_100043225 3300005535 Bacteria 3890
100 Ga0070697_100003834 3300005536 Bacteria 11543
101 Ga0070697_100004265 3300005536 Bacteria 10958
102 Ga0070697_100013710 3300005536 Bacteria 6359
103 Ga0070697_100021639 3300005536 Bacteria 5097
104 Ga0070697_100068399 3300005536 Bacteria 2907
105 Ga0070697_100077424 3300005536 Bacteria 2736
106 Ga0070697_100081843 3300005536 Bacteria 2660
107 Ga0070697_100099642 3300005536 Unclassified 2412
108 Ga0070697_100119583 3300005536 Bacteria 2202
109 Ga0068853_100000030 3300005539 Bacteria 120216
110 Ga0070672_100001836 3300005543 Bacteria 13243
111 Ga0070672_100021386 3300005543 Bacteria 4732
112 Ga0070686_100013098 3300005544 Bacteria 4734
113 Ga0070686_100029976 3300005544 Bacteria 3315
114 Ga0070696_100086590 3300005546 Bacteria 2224
115 Ga0070665_100025643 3300005548 Bacteria 5938
116 Ga0070665_100047688 3300005548 Bacteria 4299
117 Ga0070665_100067498 3300005548 Bacteria 3586
118 Ga0070665_100071087 3300005548 Bacteria 3486
119 Ga0070665_100251670 3300005548 Bacteria 1767
120 Ga0070704_100002637 3300005549 Bacteria 10123
121 Ga0068855_100013297 3300005563 Bacteria 9927
122 Ga0070664_100001814 3300005564 Bacteria 17123
123 Ga0070664_100121472 3300005564 Unclassified 2288
124 Ga0068856_100002700 3300005614 Bacteria 18189
125 Ga0068858_100015790 3300005842 Bacteria 7103
126 Ga0068858_100093258 3300005842 Bacteria 2803
127 Ga0068860_100011659 3300005843 Bacteria 8664
128 Ga0068860_100032990 3300005843 Bacteria 4971
129 Ga0081455_10004180 3300005937 Bacteria 16271
130 Ga0081455_10004940 3300005937 Bacteria 14739
131 Ga0081455_10023727 3300005937 Bacteria 5702
132 Ga0081455_10081992 3300005937 Unclassified 2640
133 Ga0081455_10154238 3300005937 Bacteria 1768
134 Ga0081540_1000016 3300005983 Bacteria 165370
135 Ga0081540_1036952 3300005983 Bacteria 2596
136 Ga0081539_10000098 3300005985 Bacteria 202400
137 Ga0081539_10000955 3300005985 Bacteria 54174
138 Ga0070717_10001933 3300006028 Bacteria 14469
139 Ga0070717_10071769 3300006028 Bacteria 2889
140 Ga0070717_10165182 3300006028 Bacteria 1922
141 Ga0070717_10279143 3300006028 Bacteria 1481
142 Ga0070715_10005093 3300006163 Bacteria 4361
143 Ga0070716_100090423 3300006173 Unclassified 1851
144 Ga0070712_100002118 3300006175 Bacteria 12201
145 Ga0070712_100063632 3300006175 Bacteria 2613
146 Ga0070712_100089193 3300006175 Bacteria 2255
147 Ga0070712_100131736 3300006175 Bacteria 1896
148 Ga0075362_10001174 3300006177 Bacteria 8195
149 Ga0075362_10054396 3300006177 Bacteria 1799
150 Ga0097621_100020709 3300006237 Bacteria 5072
151 Ga0097621_100105006 3300006237 Bacteria 2381
152 Ga0068871_100076047 3300006358 Unclassified 2773
153 Ga0075436_100035821 3300006914 Bacteria 3423
154 Ga0105240_10000136 3300009093 Bacteria 150544
155 Ga0105240_10238161 3300009093 Bacteria 2111
156 Ga0111539_10445879 3300009094 Bacteria 1507
157 Ga0105245_10012949 3300009098 Bacteria 7271
158 Ga0105247_10123224 3300009101 Bacteria 1682
159 Ga0114129_10082513 3300009147 Unclassified 4466
160 Ga0105243_10000215 3300009148 Bacteria 67339
161 Ga0105242_10191113 3300009176 Bacteria 1813
162 Ga0105237_10005548 3300009545 Bacteria 14227
163 Ga0105237_10040370 3300009545 Bacteria 4706
164 Ga0105249_10234159 3300009553 Unclassified 1812
165 Ga0105239_10044386 3300010375 Bacteria 4873
166 Ga0105239_10118909 3300010375 Bacteria 2933
167 Ga0105239_10258487 3300010375 Bacteria 1957
168 Ga0157373_10002796 3300013100 Bacteria 13205
169 Ga0157370_10001167 3300013104 Bacteria 32715
170 Ga0157369_10016805 3300013105 Bacteria 8224
171 Ga0157374_10009558 3300013296 Bacteria 8328
172 Ga0157374_10030056 3300013296 Bacteria 4930
173 Ga0157374_10059062 3300013296 Bacteria 3585
174 Ga0157374_10079321 3300013296 Bacteria 3111
175 Ga0157374_10111870 3300013296 Unclassified 2627
176 Ga0157378_10077636 3300013297 Unclassified 2994
177 Ga0157378_10084856 3300013297 Bacteria 2868
178 Ga0157378_10146156 3300013297 Bacteria 2199
179 Ga0157378_10161874 3300013297 Bacteria 2093
180 Ga0163162_10015880 3300013306 Bacteria 7358
181 Ga0163162_10021337 3300013306 Bacteria 6377
182 Ga0163162_10052072 3300013306 Bacteria 4110
183 Ga0163162_10267092 3300013306 Bacteria 1842
184 Ga0157372_10035658 3300013307 Bacteria 5477
185 Ga0157375_10035719 3300013308 Bacteria 4747
186 Ga0157375_10166813 3300013308 Unclassified 2347
187 Ga0157375_10458693 3300013308 Bacteria 1440
188 Ga0182008_10026904 3300014497 Bacteria 2916
189 Ga0157377_10008191 3300014745 Bacteria 5086
190 Ga0157379_10003506 3300014968 Bacteria 13290
191 Ga0157376_10003200 3300014969 Bacteria 11266
192 Ga0157376_10020035 3300014969 Bacteria 5166
193 Ga0157376_10022731 3300014969 Bacteria 4894
194 Ga0157376_10073951 3300014969 Bacteria 2904
195 Ga0157376_10169911 3300014969 Bacteria 1984
196 Ga0163161_10003451 3300017792 Bacteria 11076
197 Ga0163161_10061978 3300017792 Bacteria 2724
198 Ga0213872_10004933 3300021361 Bacteria 6938
199 Ga0213874_10010881 3300021377 Bacteria 2290
200 Ga0213876_10000509 3300021384 Bacteria 30219
201 Ga0213876_10006756 3300021384 Bacteria 6263
202 Ga0213876_10009709 3300021384 Bacteria 5179
203 Ga0213876_10039756 3300021384 Bacteria 2485
204 Ga0207673_1001182 3300025290 Bacteria 2814
205 Ga0207697_10000528 3300025315 Bacteria 21563
206 Ga0207697_10000755 3300025315 Bacteria 18305
207 Ga0207697_10000828 3300025315 Bacteria 17552
208 Ga0207697_10002774 3300025315 Bacteria 8935
209 Ga0207697_10002978 3300025315 Bacteria 8550
210 Ga0207697_10003896 3300025315 Bacteria 7276
211 Ga0207697_10007759 3300025315 Bacteria 4755
212 Ga0207697_10008857 3300025315 Bacteria 4376
213 Ga0207682_10037151 3300025893 Bacteria 1973
214 Ga0207692_10085593 3300025898 Bacteria 1696
215 Ga0207688_10002382 3300025901 Bacteria 10118
216 Ga0207688_10023527 3300025901 Unclassified 3374
217 Ga0207680_10133524 3300025903 Unclassified 1638
218 Ga0207685_10039738 3300025905 Bacteria 1748
219 Ga0207699_10002797 3300025906 Bacteria 8245
220 Ga0207699_10044922 3300025906 Bacteria 2575
221 Ga0207645_10001169 3300025907 Bacteria 21649
222 Ga0207645_10003105 3300025907 Bacteria 12725
223 Ga0207645_10031700 3300025907 Bacteria 3400
224 Ga0207645_10047284 3300025907 Bacteria 2748
225 Ga0207705_10002614 3300025909 Bacteria 13822
226 Ga0207705_10004257 3300025909 Bacteria 10837
227 Ga0207705_10208854 3300025909 Unclassified 1481
228 Ga0207684_10000243 3300025910 Bacteria 81628
229 Ga0207684_10002307 3300025910 Bacteria 19400
230 Ga0207684_10006784 3300025910 Bacteria 10384
231 Ga0207684_10007277 3300025910 Bacteria 9989
232 Ga0207684_10019071 3300025910 Bacteria 5868
233 Ga0207684_10027082 3300025910 Bacteria 4889
234 Ga0207684_10037917 3300025910 Bacteria 4090
235 Ga0207695_10000226 3300025913 Bacteria 150570
236 Ga0207671_10005415 3300025914 Bacteria 11757
237 Ga0207693_10001887 3300025915 Bacteria 18332
238 Ga0207693_10026293 3300025915 Bacteria 4607
239 Ga0207693_10139392 3300025915 Bacteria 1907
240 Ga0207693_10158725 3300025915 Unclassified 1779
241 Ga0207663_10003509 3300025916 Bacteria 7688
242 Ga0207663_10020906 3300025916 Unclassified 3715
243 Ga0207662_10001034 3300025918 Bacteria 13038
244 Ga0207662_10037502 3300025918 Bacteria 2837
245 Ga0207657_10064551 3300025919 Bacteria 3125
246 Ga0207649_10001476 3300025920 Bacteria 13799
247 Ga0207649_10094068 3300025920 Bacteria 1968
248 Ga0207649_10182912 3300025920 Bacteria 1468
249 Ga0207646_10001661 3300025922 Bacteria 27159
250 Ga0207646_10004459 3300025922 Bacteria 15181
251 Ga0207646_10050005 3300025922 Bacteria 3742
252 Ga0207646_10053354 3300025922 Unclassified 3616
253 Ga0207646_10067848 3300025922 Bacteria 3184
254 Ga0207646_10114813 3300025922 Bacteria 2418
255 Ga0207646_10121209 3300025922 Bacteria 2349
256 Ga0207646_10122929 3300025922 Unclassified 2333
257 Ga0207646_10147364 3300025922 Bacteria 2121
258 Ga0207646_10171851 3300025922 Bacteria 1957
259 Ga0207646_10305454 3300025922 Bacteria 1437
260 Ga0207681_10025541 3300025923 Bacteria 3800
261 Ga0207681_10150074 3300025923 Bacteria 1745
262 Ga0207650_10055373 3300025925 Bacteria 2944
263 Ga0207650_10158249 3300025925 Bacteria 1793
264 Ga0207659_10083396 3300025926 Bacteria 2369
265 Ga0207659_10171794 3300025926 Bacteria 1710
266 Ga0207687_10022367 3300025927 Bacteria 4206
267 Ga0207664_10190790 3300025929 Bacteria 1764
268 Ga0207644_10022621 3300025931 Bacteria 4297
269 Ga0207644_10030638 3300025931 Bacteria 3743
270 Ga0207644_10064533 3300025931 Bacteria 2661
271 Ga0207644_10126140 3300025931 Unclassified 1954
272 Ga0207706_10007846 3300025933 Bacteria 9850
273 Ga0207686_10197362 3300025934 Bacteria 1439
274 Ga0207670_10035523 3300025936 Bacteria 3233
275 Ga0207669_10032992 3300025937 Bacteria 2915
276 Ga0207669_10058985 3300025937 Bacteria 2345
277 Ga0207665_10004484 3300025939 Bacteria 9267
278 Ga0207665_10005625 3300025939 Bacteria 8356
279 Ga0207691_10000821 3300025940 Bacteria 30956
280 Ga0207691_10001137 3300025940 Bacteria 26402
281 Ga0207691_10164222 3300025940 Bacteria 1946
282 Ga0207679_10002277 3300025945 Bacteria 11841
283 Ga0207679_10046413 3300025945 Bacteria 3149
284 Ga0207667_10024668 3300025949 Bacteria 6597
285 Ga0207651_10033985 3300025960 Bacteria 3296
286 Ga0207712_10007043 3300025961 Bacteria 7095
287 Ga0207668_10016276 3300025972 Bacteria 4638
288 Ga0207668_10072458 3300025972 Bacteria 2465
289 Ga0207668_10139824 3300025972 Bacteria 1860
290 Ga0207677_10051402 3300026023 Unclassified 2794
291 Ga0207677_10241983 3300026023 Bacteria 1460
292 Ga0207703_10002944 3300026035 Bacteria 14473
293 Ga0207703_10074833 3300026035 Unclassified 2805
294 Ga0207703_10185636 3300026035 Bacteria 1838
295 Ga0207639_10000012 3300026041 Bacteria 344067
296 Ga0207678_10004377 3300026067 Bacteria 12701
297 Ga0207678_10111265 3300026067 Bacteria 2336
298 Ga0207708_10010462 3300026075 Bacteria 6887
299 Ga0207708_10139967 3300026075 Bacteria 1897
300 Ga0207702_10002696 3300026078 Bacteria 16668
301 Ga0207648_10000569 3300026089 Bacteria 41398
302 Ga0207648_10050962 3300026089 Bacteria 3619
303 Ga0207676_10079581 3300026095 Bacteria 2658
304 Ga0207683_10002463 3300026121 Bacteria 16141
305 Ga0207683_10010988 3300026121 Bacteria 7719
306 Ga0207683_10014130 3300026121 Bacteria 6804
307 Ga0207683_10048241 3300026121 Bacteria 3729
308 Ga0268266_10261911 3300028379 Bacteria 1603
309 Ga0268264_10000554 3300028381 Bacteria 46390
310 Ga0268264_10020523 3300028381 Bacteria 5398
311 Ga0265337_1000140 3300028556 Bacteria 36107
312 Ga0265337_1001274 3300028556 Bacteria 12670
313 Ga0265319_1000007 3300028563 Bacteria 217194
314 Ga0265336_10000819 3300028666 Bacteria 16328
315 Ga0265338_10000075 3300028800 Bacteria 180334
316 Ga0265338_10000425 3300028800 Bacteria 75565
317 Ga0265338_10001555 3300028800 Bacteria 37061
318 Ga0265338_10004123 3300028800 Bacteria 19904
319 Ga0265338_10009242 3300028800 Bacteria 11797
320 Ga0265338_10107502 3300028800 Bacteria 2256
321 Ga0265324_10000515 3300029957 Bacteria 26598
322 Ga0265324_10035393 3300029957 Bacteria 1738
323 Ga0265320_10016271 3300031240 Bacteria 4173
324 Ga0265320_10027037 3300031240 Bacteria 2996
325 Ga0265329_10000517 3300031242 Bacteria 19923
326 Ga0265340_10027009 3300031247 Bacteria 2896
327 Ga0265339_10025907 3300031249 Bacteria 3361
328 Ga0265327_10000443 3300031251 Bacteria 75159
329 Ga0265316_10138608 3300031344 Bacteria 1829
330 Ga0265316_10166006 3300031344 Bacteria 1649
331 Ga0307408_100000034 3300031548 Bacteria 208605
332 Ga0307408_100000807 3300031548 Bacteria 25077
333 Ga0265313_10001008 3300031595 Bacteria 27543
334 Ga0265314_10000148 3300031711 Bacteria 105207
335 Ga0265314_10063850 3300031711 Bacteria 2496
336 Ga0265342_10035434 3300031712 Bacteria 3055
337 Ga0265342_10097090 3300031712 Bacteria 1683
338 Ga0307406_10000144 3300031901 Bacteria 42174
339 Ga0307406_10149078 3300031901 Bacteria 1666
340 Ga0307407_10000050 3300031903 Bacteria 55701
341 Ga0307412_10000320 3300031911 Bacteria 30277
342 Ga0307414_10000006 3300032004 Bacteria 451918
343 Ga0307414_10047737 3300032004 Bacteria 2949
344 Ga0373926_0030811 3300035083 Bacteria 1891
345 Ga0373944_0013346 3300035089 Bacteria 2277
346 Ga0373945_0017127 3300035116 Unclassified 2452
347 Ga0373953_0006138 3300035117 Bacteria 3944
348 Ga0373943_0013244 3300035170 Bacteria 3723
349 Ga0373943_0078977 3300035170 Bacteria 1683
350 Ga0373946_0034028 3300035171 Unclassified 2055
351 Ga0316574_0039907 3300035398 Bacteria 2889
352 Ga0373931_0028739 3300035691 Bacteria 2850
353 Ga0373931_0089433 3300035691 Unclassified 1713
354 Ga0373935_0038418 3300035692 Bacteria 2998
355 Ga0373927_0030514 3300035695 Bacteria 3517
356 Ga0373927_0122426 3300035695 Bacteria 1698
357 Ga0373927_0179733 3300035695 Bacteria 1388
358 Ga0373933_0023960 3300035724 Bacteria 3493
359 Ga0373947_0025573 3300035725 Unclassified 3444
360 Ga0373947_0086809 3300035725 Bacteria 1945
361 Ga0373937_0009974 3300036401 Bacteria 8282
362 Ga0373937_0116308 3300036401 Bacteria 2490
363 Ga0373925_0093411 3300037068 Unclassified 2302
364 Ga0395899_0000032 3300037312 Bacteria 312705
365 Ga0395899_0144005 3300037312 Bacteria 1694
366 Ga0395900_0006262 3300037418 Bacteria 12415
367 Ga0395900_0068709 3300037418 Bacteria 3641
368 Ga0395900_0513719 3300037418 Bacteria 1147
369 Ga0395898_0000012 3300037466 Bacteria 480882
370 Ga0395898_0056572 3300037466 Unclassified 3823
371 Ga0436364_0145232 3300037853 Bacteria 2002
372 Ga0436364_0203114 3300037853 Bacteria 1614
373 Ga0436364_0615567 3300037853 Bacteria 3001
374 Ga0395901_0000761 3300038443 Bacteria 36134
375 Ga0395901_0030396 3300038443 Bacteria 5565
376 Ga0395901_0225206 3300038443 Bacteria 1959
377 Ga0436365_0404897 3300039437 Bacteria 4086
378 Ga0436365_0426196 3300039437 Bacteria 6292
379 Ga0436365_0728609 3300039437 Bacteria 41731
380 Ga0436365_1382701 3300039437 Bacteria 65037
381 Ga0436360_0155208 3300039438 Bacteria 5355
382 Ga0436361_0049207 3300039447 Bacteria 2210
383 Ga0436361_0260497 3300039447 Bacteria 7303
384 Ga0436361_0945231 3300039447 Bacteria 1905
385 Ga0436361_1188532 3300039447 Unclassified 4046
386 Ga0436363_0519400 3300039450 Bacteria 15266
387 Ga0436362_1107174 3300039453 Bacteria 5105
388 Ga0436362_1190931 3300039453 Bacteria 2048
389 Ga0450888_004663 3300042126 Bacteria 1439
390 Ga0450890_000022 3300042127 Bacteria 44942
391 Ga0450892_001845 3300042130 Bacteria 1911
392 Ga0451577_0000994 3300042876 Bacteria 41267
393 Ga0451577_0047100 3300042876 Bacteria 3855
394 Ga0466965_0014072 3300044683 Bacteria 3784
395 Ga0453684_0117852 3300044712 Bacteria 3212
396 Ga0466971_0000005 3300044719 Bacteria 137073
397 Ga0466957_0001370 3300044842 Bacteria 12718
398 Ga0451576_0115680 3300045051 Bacteria 2792
399 Ga0451576_0234055 3300045051 Bacteria 1918
400 Ga0451576_0280268 3300045051 Bacteria 1743
401 Ga0451576_0390371 3300045051 Bacteria 1459
402 Ga0495592_0017527 3300046454 Bacteria 5441
403 Ga0495592_0046298 3300046454 Bacteria 3243
404 Ga0495629_0110671 3300046459 Unclassified 1915
405 Ga0495651_0016105 3300046462 Bacteria 5790
406 Ga0495582_0051410 3300046473 Bacteria 2272
407 Ga0495608_0106316 3300046511 Bacteria 1806
408 Ga0495628_0039870 3300046516 Unclassified 3755
409 Ga0495630_0017041 3300046517 Bacteria 5318
410 Ga0495630_0051924 3300046517 Bacteria 3069
411 Ga0495586_0010419 3300046535 Bacteria 4941
412 Ga0495645_0098528 3300046543 Unclassified 2080
413 Ga0495657_0120959 3300046675 Bacteria 1649
414 Ga0495657_0164646 3300046675 Unclassified 1370
415 Ga0495623_0006825 3300046679 Bacteria 7424
416 Ga0495646_0009034 3300046680 Bacteria 6320
417 Ga0495669_0022130 3300046684 Bacteria 2761
418 Ga0495604_0026038 3300047317 Bacteria 4658
419 Ga0495674_0057563 3300047319 Bacteria 3402
420 Ga0495674_0158166 3300047319 Bacteria 1897
421 Ga0495676_0137870 3300047321 Bacteria 1752
422 Ga0495675_0020276 3300047444 Bacteria 4227
423 Ga0495675_0028062 3300047444 Unclassified 3588
424 Ga0495684_0083781 3300047471 Unclassified 2418
425 Ga0495684_0094502 3300047471 Bacteria 2264
426 Ga0495602_0013044 3300048088 Bacteria 8500
427 Ga0496100_0013402 3300048903 Bacteria 4727
428 Ga0496100_0040256 3300048903 Unclassified 2972
429 Ga0496101_0003338 3300048904 Bacteria 9995
430 Ga0496101_0052559 3300048904 Unclassified 2938
431 Ga0496102_0042775 3300048905 Bacteria 4106
432 Ga0496102_0055172 3300048905 Unclassified 3624
433 Ga0496104_0016347 3300048907 Bacteria 6739
434 Ga0496104_0056855 3300048907 Unclassified 3701
435 Ga0496104_0324328 3300048907 Unclassified 1453
436 Ga0496105_0124968 3300048908 Unclassified 2121
437 Ga0496109_0002216 3300048912 Bacteria 16122
438 Ga0496110_0063400 3300048913 Unclassified 3266
439 Ga0496111_0140014 3300048914 Unclassified 1793
440 Ga0496112_0013618 3300048915 Bacteria 7516
441 Ga0496112_0017764 3300048915 Bacteria 6694
442 Ga0496112_0018273 3300048915 Bacteria 6600
443 Ga0496112_0076364 3300048915 Unclassified 3313
444 Ga0496112_0463355 3300048915 Bacteria 1205
445 Ga0496113_0225443 3300048916 Unclassified 1494
446 Ga0496114_0002417 3300048917 Bacteria 14242
447 Ga0496114_0076837 3300048917 Bacteria 2814
448 Ga0496115_0008394 3300048918 Bacteria 7644
449 Ga0496115_0010916 3300048918 Bacteria 6799
450 Ga0496115_0015467 3300048918 Bacteria 5788
451 Ga0496125_0000110 3300048928 Bacteria 192693
452 Ga0496125_0106994 3300048928 Bacteria 2039
453 Ga0501031_0000592 3300049568 Bacteria 21373
454 Ga0501032_0000551 3300049569 Bacteria 30346
455 Ga0501033_0000015 3300049570 Bacteria 218502
456 Ga0501033_0000306 3300049570 Bacteria 46261
457 Ga0501034_0130028 3300049571 Bacteria 2502
458 Ga0501037_0000019 3300049573 Bacteria 155790
459 Ga0501038_0000208 3300049574 Bacteria 50125
460 Ga0501038_0010993 3300049574 Bacteria 8265
461 Ga0501039_0003018 3300049575 Bacteria 12588
462 Ga0501043_0002981 3300049579 Bacteria 14096
463 Ga0501043_0003274 3300049579 Bacteria 13351
464 Ga0501047_0099573 3300049581 Bacteria 2786
465 Ga0501047_0243020 3300049581 Bacteria 1650
466 Ga0501067_0087055 3300049583 Bacteria 1733
467 Ga0501080_0026952 3300049742 Bacteria 5343
468 Ga0501080_0033158 3300049742 Bacteria 4820
469 Ga0501035_0000004 3300049822 Bacteria 403650
470 Ga0501044_0015602 3300049823 Bacteria 8184
471 nmdc:mga03683_110_c1 3300050489 Bacteria 27984
472 nmdc:mga0k408_393_c1 3300050493 Bacteria 21508
473 nmdc:mga0k408_47773_c1 3300050493 Bacteria 2474
474 nmdc:mga0k408_525_c1 3300050493 Bacteria 21099
475 nmdc:mga05p37_294091_c1 3300050507 Unclassified 1932
476 nmdc:mga06r32_232987_c1 3300050510 Bacteria 1829
477 nmdc:mga08y16_221511_c1 3300050511 Bacteria 1958
478 nmdc:mga08y16_328972_c1 3300050511 Bacteria 1572
479 nmdc:mga08x19_10517_c1 3300050514 Bacteria 5558
480 Ga0495612_0056246 3300053078 Unclassified 1623
481 Ga0500643_026898 3300053087 Bacteria 1795
482 Ga0500650_0042235 3300053098 Bacteria 2107
483 Ga0500555_000014 3300053103 Bacteria 233611
484 Ga0500555_000147 3300053103 Bacteria 33648
485 Ga0500556_0000090 3300053104 Bacteria 84279
486 Ga0500556_0002124 3300053104 Bacteria 6742
487 Ga0500642_0023232 3300053130 Bacteria 2486
488 Ga0500658_0039623 3300053134 Bacteria 1884
489 Ga0500559_0001585 3300053136 Bacteria 12703
490 Ga0500559_0045011 3300053136 Bacteria 1931
491 Ga0500636_0075362 3300053177 Bacteria 1952
492 Ga0466962_0000062 3300061719 Bacteria 44039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0513719 Ga0395900_0513719_27_1127 344
2 3300050510 nmdc:mga06r32_232987_c1 nmdc:mga06r32_232987_c1_29_1168 348
3 3300025972 Ga0207668_10072458 Ga0207668_100724582 350
4 3300028563 Ga0265319_1000007 Ga0265319_100000795 360
5 3300028800 Ga0265338_10107502 Ga0265338_101075023 360
6 3300031240 Ga0265320_10027037 Ga0265320_100270374 360
7 3300031595 Ga0265313_10001008 Ga0265313_1000100824 360
8 3300005614 Ga0068856_100002700 Ga0068856_1000027009 362
9 3300026078 Ga0207702_10002696 Ga0207702_100026967 362
10 3300028800 Ga0265338_10004123 Ga0265338_100041239 362
11 3300028800 Ga0265338_10009242 Ga0265338_100092429 362
12 3300048908 Ga0496105_0124968 Ga0496105_0124968_11_1165 362
13 3300048915 Ga0496112_0463355 Ga0496112_0463355_11_1165 362
14 3300031242 Ga0265329_10000517 Ga0265329_1000051710 364
15 3300031344 Ga0265316_10138608 Ga0265316_101386082 364
16 3300031711 Ga0265314_10000148 Ga0265314_1000014850 364
17 3300048928 Ga0496125_0106994 Ga0496125_0106994_555_1721 366
18 3300025972 Ga0207668_10139824 Ga0207668_101398242 367
19 3300005985 Ga0081539_10000955 Ga0081539_1000095514 379
20 3300025922 Ga0207646_10122929 Ga0207646_101229292 379
21 3300035695 Ga0373927_0179733 Ga0373927_0179733_19_1230 380
22 3300037312 Ga0395899_0144005 Ga0395899_0144005_441_1649 380
23 3300042126 Ga0450888_004663 Ga0450888_004663_67_1317 381
24 3300013308 Ga0157375_10458693 Ga0157375_104586932 382
25 3300031247 Ga0265340_10027009 Ga0265340_100270092 382
26 3300028556 Ga0265337_1001274 Ga0265337_10012744 383
27 3300005467 Ga0070706_100000069 Ga0070706_10000006941 384
28 3300005471 Ga0070698_100135949 Ga0070698_1001359493 384
29 3300025910 Ga0207684_10000243 Ga0207684_1000024341 384
30 3300026041 Ga0207639_10000012 Ga0207639_1000001289 384
31 3300044712 Ga0453684_0117852 Ga0453684_0117852_1350_2633 384
32 3300005334 Ga0068869_100076282 Ga0068869_1000762822 385
33 3300005564 Ga0070664_100001814 Ga0070664_1000018146 385
34 3300025920 Ga0207649_10094068 Ga0207649_100940682 385
35 3300025945 Ga0207679_10002277 Ga0207679_100022776 385
36 3300031251 Ga0265327_10000443 Ga0265327_1000044332 385
37 3300031548 Ga0307408_100000034 Ga0307408_10000003411 385
38 3300031903 Ga0307407_10000050 Ga0307407_1000005028 385
39 3300031911 Ga0307412_10000320 Ga0307412_1000032029 385
40 3300035089 Ga0373944_0013346 Ga0373944_0013346_882_2192 385
41 3300042127 Ga0450890_000022 Ga0450890_000022_3634_4893 385
42 3300042130 Ga0450892_001845 Ga0450892_001845_46_1305 385
43 3300005459 Ga0068867_100000185 Ga0068867_10000018516 386
44 3300009148 Ga0105243_10000215 Ga0105243_1000021523 386
45 3300014745 Ga0157377_10008191 Ga0157377_100081915 386
46 3300014969 Ga0157376_10020035 Ga0157376_100200352 386
47 3300026089 Ga0207648_10000569 Ga0207648_1000056916 386
48 3300005328 Ga0070676_10040767 Ga0070676_100407674 387
49 3300006358 Ga0068871_100076047 Ga0068871_1000760472 387
50 3300025315 Ga0207697_10003896 Ga0207697_100038964 387
51 3300025907 Ga0207645_10031700 Ga0207645_100317004 387
52 3300025937 Ga0207669_10058985 Ga0207669_100589853 387
53 3300025945 Ga0207679_10046413 Ga0207679_100464133 387
54 3300029957 Ga0265324_10035393 Ga0265324_100353932 387
55 3300031712 Ga0265342_10035434 Ga0265342_100354345 387
56 3300003323 rootH1_10007259 rootH1_100072598 388
57 3300037312 Ga0395899_0000032 Ga0395899_0000032_121748_122995 388
58 3300037466 Ga0395898_0000012 Ga0395898_0000012_87204_88451 388
59 3300044842 Ga0466957_0001370 Ga0466957_0001370_8238_9485 388
60 3300053098 Ga0500650_0042235 Ga0500650_0042235_149_1411 388
61 3300053177 Ga0500636_0075362 Ga0500636_0075362_247_1509 388
62 3300005328 Ga0070676_10026624 Ga0070676_100266244 389
63 3300005331 Ga0070670_100024011 Ga0070670_1000240114 389
64 3300005340 Ga0070689_100046425 Ga0070689_1000464254 389
65 3300005353 Ga0070669_100040723 Ga0070669_1000407233 389
66 3300005354 Ga0070675_100005953 Ga0070675_1000059534 389
67 3300005355 Ga0070671_100017861 Ga0070671_1000178614 389
68 3300005367 Ga0070667_100054771 Ga0070667_1000547714 389
69 3300005456 Ga0070678_100008408 Ga0070678_1000084083 389
70 3300005468 Ga0070707_100147707 Ga0070707_1001477072 389
71 3300005543 Ga0070672_100021386 Ga0070672_1000213865 389
72 3300005548 Ga0070665_100071087 Ga0070665_1000710873 389
73 3300025315 Ga0207697_10007759 Ga0207697_100077594 389
74 3300025901 Ga0207688_10002382 Ga0207688_100023824 389
75 3300025907 Ga0207645_10047284 Ga0207645_100472843 389
76 3300025923 Ga0207681_10025541 Ga0207681_100255414 389
77 3300025926 Ga0207659_10083396 Ga0207659_100833962 389
78 3300025936 Ga0207670_10035523 Ga0207670_100355232 389
79 3300025937 Ga0207669_10032992 Ga0207669_100329924 389
80 3300025940 Ga0207691_10001137 Ga0207691_100011372 389
81 3300026121 Ga0207683_10010988 Ga0207683_100109886 389
82 iso_pu_bacteria 2786546517 2787435142 389
83 iso_pu_bacteria 2786546548 2787508511 389
84 3300013307 Ga0157372_10035658 Ga0157372_100356584 390
85 3300014969 Ga0157376_10169911 Ga0157376_101699113 390
86 3300005330 Ga0070690_100004401 Ga0070690_1000044014 391
87 3300005355 Ga0070671_100058142 Ga0070671_1000581422 391
88 3300005364 Ga0070673_100024145 Ga0070673_1000241454 391
89 3300005445 Ga0070708_100257360 Ga0070708_1002573602 391
90 3300005467 Ga0070706_100007104 Ga0070706_1000071044 391
91 3300005518 Ga0070699_100063490 Ga0070699_1000634901 391
92 3300005536 Ga0070697_100081843 Ga0070697_1000818434 391
93 3300005937 Ga0081455_10023727 Ga0081455_100237274 391
94 3300009093 Ga0105240_10238161 Ga0105240_102381612 391
95 3300009545 Ga0105237_10005548 Ga0105237_1000554813 391
96 3300025910 Ga0207684_10006784 Ga0207684_100067841 391
97 3300025914 Ga0207671_10005415 Ga0207671_1000541510 391
98 3300025931 Ga0207644_10022621 Ga0207644_100226213 391
99 3300028556 Ga0265337_1000140 Ga0265337_100014022 391
100 3300028666 Ga0265336_10000819 Ga0265336_100008196 391
101 3300028800 Ga0265338_10000075 Ga0265338_1000007560 391
102 3300028800 Ga0265338_10000425 Ga0265338_1000042535 391
103 3300028800 Ga0265338_10001555 Ga0265338_1000155516 391
104 3300029957 Ga0265324_10000515 Ga0265324_1000051522 391
105 3300031240 Ga0265320_10016271 Ga0265320_100162714 391
106 3300031249 Ga0265339_10025907 Ga0265339_100259073 391
107 3300031344 Ga0265316_10166006 Ga0265316_101660062 391
108 3300031712 Ga0265342_10097090 Ga0265342_100970901 391
109 3300042876 Ga0451577_0047100 Ga0451577_0047100_1440_2711 391
110 3300045051 Ga0451576_0234055 Ga0451576_0234055_314_1585 391
111 3300049571 Ga0501034_0130028 Ga0501034_0130028_803_2074 391
112 3300049581 Ga0501047_0099573 Ga0501047_0099573_840_2111 391
113 3300053087 Ga0500643_026898 Ga0500643_026898_209_1450 391
114 3300053103 Ga0500555_000014 Ga0500555_000014_62150_63391 391
115 3300005335 Ga0070666_10003065 Ga0070666_100030654 392
116 3300013297 Ga0157378_10084856 Ga0157378_100848564 392
117 3300025898 Ga0207692_10085593 Ga0207692_100855932 392
118 3300025901 Ga0207688_10023527 Ga0207688_100235274 392
119 3300025915 Ga0207693_10026293 Ga0207693_100262935 392
120 3300025929 Ga0207664_10190790 Ga0207664_101907901 392
121 3300025934 Ga0207686_10197362 Ga0207686_101973621 392
122 3300026067 Ga0207678_10111265 Ga0207678_101112653 392
123 3300026075 Ga0207708_10139967 Ga0207708_101399672 392
124 3300026089 Ga0207648_10050962 Ga0207648_100509624 392
125 3300031548 Ga0307408_100000807 Ga0307408_1000008075 392
126 3300031901 Ga0307406_10000144 Ga0307406_100001448 392
127 3300031901 Ga0307406_10149078 Ga0307406_101490782 392
128 3300032004 Ga0307414_10000006 Ga0307414_1000000677 392
129 3300053136 Ga0500559_0001585 Ga0500559_0001585_2055_3305 392
130 3300001991 JGI24743J22301_10000329 JGI24743J22301_100003293 393
131 3300002155 JGI24033J26618_1000106 JGI24033J26618_10001066 393
132 3300005344 Ga0070661_100000369 Ga0070661_10000036927 393
133 3300005347 Ga0070668_100145846 Ga0070668_1001458462 393
134 3300005366 Ga0070659_100119041 Ga0070659_1001190412 393
135 3300005539 Ga0068853_100000030 Ga0068853_10000003021 393
136 3300006237 Ga0097621_100105006 Ga0097621_1001050062 393
137 3300013296 Ga0157374_10009558 Ga0157374_100095587 393
138 3300021384 Ga0213876_10009709 Ga0213876_100097093 393
139 3300025920 Ga0207649_10001476 Ga0207649_1000147612 393
140 3300031711 Ga0265314_10063850 Ga0265314_100638502 393
141 3300037418 Ga0395900_0068709 Ga0395900_0068709_1135_2403 393
142 3300038443 Ga0395901_0030396 Ga0395901_0030396_74_1342 393
143 3300044683 Ga0466965_0014072 Ga0466965_0014072_2014_3261 393
144 3300044719 Ga0466971_0000005 Ga0466971_0000005_13401_14648 393
145 3300048928 Ga0496125_0000110 Ga0496125_0000110_79682_80929 393
146 3300049568 Ga0501031_0000592 Ga0501031_0000592_8040_9287 393
147 3300049569 Ga0501032_0000551 Ga0501032_0000551_4978_6225 393
148 3300049570 Ga0501033_0000015 Ga0501033_0000015_14614_15861 393
149 3300049570 Ga0501033_0000306 Ga0501033_0000306_7506_8753 393
150 3300049573 Ga0501037_0000019 Ga0501037_0000019_10599_11846 393
151 3300049574 Ga0501038_0000208 Ga0501038_0000208_48074_49321 393
152 3300049574 Ga0501038_0010993 Ga0501038_0010993_4460_5707 393
153 3300049575 Ga0501039_0003018 Ga0501039_0003018_19_1266 393
154 3300049579 Ga0501043_0002981 Ga0501043_0002981_9412_10659 393
155 3300049579 Ga0501043_0003274 Ga0501043_0003274_2968_4215 393
156 3300049581 Ga0501047_0243020 Ga0501047_0243020_292_1539 393
157 3300049583 Ga0501067_0087055 Ga0501067_0087055_357_1604 393
158 3300049742 Ga0501080_0026952 Ga0501080_0026952_2043_3290 393
159 3300049822 Ga0501035_0000004 Ga0501035_0000004_114599_115846 393
160 3300049823 Ga0501044_0015602 Ga0501044_0015602_5270_6517 393
161 3300053104 Ga0500556_0002124 Ga0500556_0002124_157_1404 393
162 3300061719 Ga0466962_0000062 Ga0466962_0000062_27991_29238 393
163 3300003320 rootH2_10033813 rootH2_100338136 394
164 3300005290 Ga0065712_10016516 Ga0065712_100165162 394
165 3300005295 Ga0065707_10012258 Ga0065707_100122581 394
166 3300005434 Ga0070709_10028965 Ga0070709_100289652 394
167 3300005436 Ga0070713_100009669 Ga0070713_1000096693 394
168 3300005439 Ga0070711_100003143 Ga0070711_1000031432 394
169 3300005445 Ga0070708_100061724 Ga0070708_1000617244 394
170 3300005445 Ga0070708_100134905 Ga0070708_1001349053 394
171 3300005456 Ga0070678_100017923 Ga0070678_1000179232 394
172 3300005518 Ga0070699_100008606 Ga0070699_1000086064 394
173 3300005536 Ga0070697_100068399 Ga0070697_1000683994 394
174 3300005536 Ga0070697_100119583 Ga0070697_1001195833 394
175 3300005842 Ga0068858_100015790 Ga0068858_1000157906 394
176 3300005842 Ga0068858_100093258 Ga0068858_1000932583 394
177 3300006175 Ga0070712_100002118 Ga0070712_1000021182 394
178 3300006175 Ga0070712_100089193 Ga0070712_1000891932 394
179 3300006175 Ga0070712_100131736 Ga0070712_1001317362 394
180 3300013296 Ga0157374_10111870 Ga0157374_101118702 394
181 3300013306 Ga0163162_10052072 Ga0163162_100520725 394
182 3300021377 Ga0213874_10010881 Ga0213874_100108812 394
183 3300021384 Ga0213876_10000509 Ga0213876_1000050911 394
184 3300021384 Ga0213876_10006756 Ga0213876_100067564 394
185 3300025906 Ga0207699_10044922 Ga0207699_100449224 394
186 3300025915 Ga0207693_10001887 Ga0207693_1000188715 394
187 3300025916 Ga0207663_10020906 Ga0207663_100209064 394
188 3300025922 Ga0207646_10305454 Ga0207646_103054542 394
189 3300025931 Ga0207644_10126140 Ga0207644_101261402 394
190 3300026035 Ga0207703_10002944 Ga0207703_1000294411 394
191 3300026121 Ga0207683_10014130 Ga0207683_100141305 394
192 3300035116 Ga0373945_0017127 Ga0373945_0017127_938_2209 394
193 3300035171 Ga0373946_0034028 Ga0373946_0034028_550_1821 394
194 3300035695 Ga0373927_0030514 Ga0373927_0030514_58_1329 394
195 3300037853 Ga0436364_0145232 Ga0436364_0145232_144_1394 394
196 3300037853 Ga0436364_0203114 Ga0436364_0203114_256_1530 394
197 3300037853 Ga0436364_0615567 Ga0436364_0615567_1408_2658 394
198 3300039437 Ga0436365_0728609 Ga0436365_0728609_2937_4187 394
199 3300039437 Ga0436365_1382701 Ga0436365_1382701_34973_36223 394
200 3300039438 Ga0436360_0155208 Ga0436360_0155208_2955_4205 394
201 3300039447 Ga0436361_0049207 Ga0436361_0049207_738_1988 394
202 3300039447 Ga0436361_1188532 Ga0436361_1188532_1606_2856 394
203 3300039450 Ga0436363_0519400 Ga0436363_0519400_7262_8512 394
204 3300039453 Ga0436362_1107174 Ga0436362_1107174_3476_4726 394
205 3300046684 Ga0495669_0022130 Ga0495669_0022130_1115_2386 394
206 3300048907 Ga0496104_0324328 Ga0496104_0324328_127_1398 394
207 3300048915 Ga0496112_0013618 Ga0496112_0013618_1283_2554 394
208 3300005328 Ga0070676_10045491 Ga0070676_100454912 395
209 3300005334 Ga0068869_100215965 Ga0068869_1002159651 395
210 3300005354 Ga0070675_100022081 Ga0070675_1000220811 395
211 3300005355 Ga0070671_100004298 Ga0070671_1000042984 395
212 3300005367 Ga0070667_100094854 Ga0070667_1000948542 395
213 3300005445 Ga0070708_100093116 Ga0070708_1000931164 395
214 3300005467 Ga0070706_100002974 Ga0070706_10000297416 395
215 3300005467 Ga0070706_100015254 Ga0070706_1000152544 395
216 3300005468 Ga0070707_100121711 Ga0070707_1001217111 395
217 3300005471 Ga0070698_100007372 Ga0070698_1000073724 395
218 3300005544 Ga0070686_100013098 Ga0070686_1000130983 395
219 3300005548 Ga0070665_100067498 Ga0070665_1000674984 395
220 3300005843 Ga0068860_100032990 Ga0068860_1000329905 395
221 3300006175 Ga0070712_100063632 Ga0070712_1000636323 395
222 3300006177 Ga0075362_10001174 Ga0075362_100011745 395
223 3300006237 Ga0097621_100020709 Ga0097621_1000207093 395
224 3300009098 Ga0105245_10012949 Ga0105245_100129492 395
225 3300009553 Ga0105249_10234159 Ga0105249_102341591 395
226 3300010375 Ga0105239_10044386 Ga0105239_100443862 395
227 3300013100 Ga0157373_10002796 Ga0157373_100027968 395
228 3300013104 Ga0157370_10001167 Ga0157370_1000116721 395
229 3300013296 Ga0157374_10030056 Ga0157374_100300562 395
230 3300013296 Ga0157374_10079321 Ga0157374_100793214 395
231 3300013297 Ga0157378_10161874 Ga0157378_101618741 395
232 3300013306 Ga0163162_10015880 Ga0163162_100158801 395
233 3300013308 Ga0157375_10035719 Ga0157375_100357193 395
234 3300013308 Ga0157375_10166813 Ga0157375_101668133 395
235 3300021361 Ga0213872_10004933 Ga0213872_100049335 395
236 3300025315 Ga0207697_10000828 Ga0207697_1000082816 395
237 3300025907 Ga0207645_10001169 Ga0207645_100011691 395
238 3300025909 Ga0207705_10002614 Ga0207705_100026147 395
239 3300025910 Ga0207684_10027082 Ga0207684_100270822 395
240 3300025918 Ga0207662_10001034 Ga0207662_100010341 395
241 3300025922 Ga0207646_10050005 Ga0207646_100500052 395
242 3300025922 Ga0207646_10147364 Ga0207646_101473643 395
243 3300025925 Ga0207650_10055373 Ga0207650_100553734 395
244 3300025933 Ga0207706_10007846 Ga0207706_100078465 395
245 3300026023 Ga0207677_10051402 Ga0207677_100514022 395
246 3300026035 Ga0207703_10185636 Ga0207703_101856363 395
247 3300039447 Ga0436361_0260497 Ga0436361_0260497_2921_4216 395
248 3300039447 Ga0436361_0945231 Ga0436361_0945231_585_1880 395
249 3300039453 Ga0436362_1190931 Ga0436362_1190931_135_1430 395
250 3300045051 Ga0451576_0115680 Ga0451576_0115680_399_1694 395
251 3300045051 Ga0451576_0280268 Ga0451576_0280268_187_1482 395
252 3300045051 Ga0451576_0390371 Ga0451576_0390371_115_1410 395
253 3300046517 Ga0495630_0017041 Ga0495630_0017041_3954_5249 395
254 3300048918 Ga0496115_0008394 Ga0496115_0008394_1876_3132 395
255 3300050489 nmdc:mga03683_110_c1 nmdc:mga03683_110_c1_23810_25063 395
256 3300050493 nmdc:mga0k408_393_c1 nmdc:mga0k408_393_c1_13739_14992 395
257 3300050493 nmdc:mga0k408_525_c1 nmdc:mga0k408_525_c1_4914_6167 395
258 3300050511 nmdc:mga08y16_221511_c1 nmdc:mga08y16_221511_c1_60_1355 395
259 3300053103 Ga0500555_000147 Ga0500555_000147_13393_14646 395
260 3300053104 Ga0500556_0000090 Ga0500556_0000090_74911_76164 395
261 3300053130 Ga0500642_0023232 Ga0500642_0023232_1016_2269 395
262 3300053134 Ga0500658_0039623 Ga0500658_0039623_401_1654 395
263 3300000545 CNXas_1000068 CNXas_100006816 396
264 3300003203 JGI25406J46586_10000013 JGI25406J46586_1000001339 396
265 3300005289 Ga0065704_10080302 Ga0065704_100803022 396
266 3300005290 Ga0065712_10086619 Ga0065712_100866193 396
267 3300005293 Ga0065715_10002255 Ga0065715_100022556 396
268 3300005293 Ga0065715_10103715 Ga0065715_101037153 396
269 3300005295 Ga0065707_10009940 Ga0065707_100099404 396
270 3300005327 Ga0070658_10013851 Ga0070658_100138516 396
271 3300005327 Ga0070658_10069841 Ga0070658_100698414 396
272 3300005328 Ga0070676_10003035 Ga0070676_100030357 396
273 3300005330 Ga0070690_100077480 Ga0070690_1000774803 396
274 3300005338 Ga0068868_100038840 Ga0068868_1000388404 396
275 3300005338 Ga0068868_100082695 Ga0068868_1000826953 396
276 3300005339 Ga0070660_100101060 Ga0070660_1001010601 396
277 3300005344 Ga0070661_100026268 Ga0070661_1000262683 396
278 3300005347 Ga0070668_100002522 Ga0070668_10000252212 396
279 3300005354 Ga0070675_100000891 Ga0070675_1000008916 396
280 3300005354 Ga0070675_100010952 Ga0070675_1000109523 396
281 3300005355 Ga0070671_100014044 Ga0070671_1000140445 396
282 3300005355 Ga0070671_100034454 Ga0070671_1000344544 396
283 3300005356 Ga0070674_100047406 Ga0070674_1000474064 396
284 3300005364 Ga0070673_100043430 Ga0070673_1000434303 396
285 3300005365 Ga0070688_100066861 Ga0070688_1000668612 396
286 3300005434 Ga0070709_10202384 Ga0070709_102023841 396
287 3300005435 Ga0070714_100073075 Ga0070714_1000730753 396
288 3300005435 Ga0070714_100099276 Ga0070714_1000992762 396
289 3300005437 Ga0070710_10179991 Ga0070710_101799911 396
290 3300005439 Ga0070711_100071138 Ga0070711_1000711382 396
291 3300005440 Ga0070705_100021634 Ga0070705_1000216342 396
292 3300005445 Ga0070708_100028393 Ga0070708_1000283932 396
293 3300005445 Ga0070708_100045276 Ga0070708_1000452763 396
294 3300005445 Ga0070708_100059764 Ga0070708_1000597642 396
295 3300005445 Ga0070708_100259219 Ga0070708_1002592192 396
296 3300005458 Ga0070681_10054796 Ga0070681_100547963 396
297 3300005459 Ga0068867_100030593 Ga0068867_1000305934 396
298 3300005467 Ga0070706_100000926 Ga0070706_1000009266 396
299 3300005467 Ga0070706_100005124 Ga0070706_1000051247 396
300 3300005467 Ga0070706_100024268 Ga0070706_1000242684 396
301 3300005467 Ga0070706_100041794 Ga0070706_1000417942 396
302 3300005468 Ga0070707_100000320 Ga0070707_1000003207 396
303 3300005468 Ga0070707_100002974 Ga0070707_1000029743 396
304 3300005468 Ga0070707_100017381 Ga0070707_1000173814 396
305 3300005468 Ga0070707_100112890 Ga0070707_1001128903 396
306 3300005468 Ga0070707_100200978 Ga0070707_1002009782 396
307 3300005468 Ga0070707_100260116 Ga0070707_1002601161 396
308 3300005471 Ga0070698_100003081 Ga0070698_10000308115 396
309 3300005471 Ga0070698_100003870 Ga0070698_1000038704 396
310 3300005471 Ga0070698_100118422 Ga0070698_1001184223 396
311 3300005518 Ga0070699_100041151 Ga0070699_1000411512 396
312 3300005518 Ga0070699_100108214 Ga0070699_1001082143 396
313 3300005530 Ga0070679_100108372 Ga0070679_1001083721 396
314 3300005535 Ga0070684_100043225 Ga0070684_1000432253 396
315 3300005536 Ga0070697_100003834 Ga0070697_10000383410 396
316 3300005536 Ga0070697_100004265 Ga0070697_10000426511 396
317 3300005536 Ga0070697_100013710 Ga0070697_1000137105 396
318 3300005536 Ga0070697_100021639 Ga0070697_1000216392 396
319 3300005536 Ga0070697_100077424 Ga0070697_1000774243 396
320 3300005536 Ga0070697_100099642 Ga0070697_1000996422 396
321 3300005543 Ga0070672_100001836 Ga0070672_1000018361 396
322 3300005544 Ga0070686_100029976 Ga0070686_1000299763 396
323 3300005546 Ga0070696_100086590 Ga0070696_1000865903 396
324 3300005548 Ga0070665_100025643 Ga0070665_1000256433 396
325 3300005548 Ga0070665_100047688 Ga0070665_1000476883 396
326 3300005548 Ga0070665_100251670 Ga0070665_1002516702 396
327 3300005549 Ga0070704_100002637 Ga0070704_1000026377 396
328 3300005563 Ga0068855_100013297 Ga0068855_1000132977 396
329 3300005564 Ga0070664_100121472 Ga0070664_1001214722 396
330 3300005843 Ga0068860_100011659 Ga0068860_1000116592 396
331 3300005937 Ga0081455_10004180 Ga0081455_1000418014 396
332 3300005937 Ga0081455_10004940 Ga0081455_100049403 396
333 3300005937 Ga0081455_10081992 Ga0081455_100819923 396
334 3300005937 Ga0081455_10154238 Ga0081455_101542383 396
335 3300005983 Ga0081540_1000016 Ga0081540_100001665 396
336 3300005983 Ga0081540_1036952 Ga0081540_10369521 396
337 3300005985 Ga0081539_10000098 Ga0081539_10000098134 396
338 3300006028 Ga0070717_10001933 Ga0070717_1000193311 396
339 3300006028 Ga0070717_10071769 Ga0070717_100717693 396
340 3300006028 Ga0070717_10165182 Ga0070717_101651822 396
341 3300006028 Ga0070717_10279143 Ga0070717_102791431 396
342 3300006163 Ga0070715_10005093 Ga0070715_100050934 396
343 3300006173 Ga0070716_100090423 Ga0070716_1000904231 396
344 3300006177 Ga0075362_10054396 Ga0075362_100543962 396
345 3300006914 Ga0075436_100035821 Ga0075436_1000358213 396
346 3300009093 Ga0105240_10000136 Ga0105240_1000013630 396
347 3300009094 Ga0111539_10445879 Ga0111539_104458791 396
348 3300009101 Ga0105247_10123224 Ga0105247_101232242 396
349 3300009147 Ga0114129_10082513 Ga0114129_100825135 396
350 3300009176 Ga0105242_10191113 Ga0105242_101911131 396
351 3300009545 Ga0105237_10040370 Ga0105237_100403703 396
352 3300010375 Ga0105239_10118909 Ga0105239_101189091 396
353 3300010375 Ga0105239_10258487 Ga0105239_102584871 396
354 3300013105 Ga0157369_10016805 Ga0157369_100168054 396
355 3300013296 Ga0157374_10059062 Ga0157374_100590622 396
356 3300013297 Ga0157378_10077636 Ga0157378_100776362 396
357 3300013297 Ga0157378_10146156 Ga0157378_101461562 396
358 3300013306 Ga0163162_10021337 Ga0163162_100213374 396
359 3300013306 Ga0163162_10267092 Ga0163162_102670922 396
360 3300014497 Ga0182008_10026904 Ga0182008_100269043 396
361 3300014968 Ga0157379_10003506 Ga0157379_1000350616 396
362 3300014969 Ga0157376_10003200 Ga0157376_100032005 396
363 3300014969 Ga0157376_10022731 Ga0157376_100227313 396
364 3300014969 Ga0157376_10073951 Ga0157376_100739512 396
365 3300017792 Ga0163161_10003451 Ga0163161_100034519 396
366 3300017792 Ga0163161_10061978 Ga0163161_100619782 396
367 3300021384 Ga0213876_10039756 Ga0213876_100397562 396
368 3300025290 Ga0207673_1001182 Ga0207673_10011824 396
369 3300025315 Ga0207697_10000528 Ga0207697_1000052819 396
370 3300025315 Ga0207697_10000755 Ga0207697_1000075514 396
371 3300025315 Ga0207697_10002774 Ga0207697_100027746 396
372 3300025315 Ga0207697_10002978 Ga0207697_100029784 396
373 3300025315 Ga0207697_10008857 Ga0207697_100088574 396
374 3300025893 Ga0207682_10037151 Ga0207682_100371513 396
375 3300025903 Ga0207680_10133524 Ga0207680_101335241 396
376 3300025905 Ga0207685_10039738 Ga0207685_100397381 396
377 3300025906 Ga0207699_10002797 Ga0207699_100027977 396
378 3300025907 Ga0207645_10003105 Ga0207645_1000310512 396
379 3300025909 Ga0207705_10004257 Ga0207705_1000425712 396
380 3300025909 Ga0207705_10208854 Ga0207705_102088542 396
381 3300025910 Ga0207684_10002307 Ga0207684_1000230720 396
382 3300025910 Ga0207684_10007277 Ga0207684_100072776 396
383 3300025910 Ga0207684_10019071 Ga0207684_100190712 396
384 3300025910 Ga0207684_10037917 Ga0207684_100379173 396
385 3300025913 Ga0207695_10000226 Ga0207695_1000022629 396
386 3300025915 Ga0207693_10139392 Ga0207693_101393922 396
387 3300025915 Ga0207693_10158725 Ga0207693_101587251 396
388 3300025916 Ga0207663_10003509 Ga0207663_100035092 396
389 3300025918 Ga0207662_10037502 Ga0207662_100375022 396
390 3300025919 Ga0207657_10064551 Ga0207657_100645511 396
391 3300025920 Ga0207649_10182912 Ga0207649_101829122 396
392 3300025922 Ga0207646_10001661 Ga0207646_100016613 396
393 3300025922 Ga0207646_10004459 Ga0207646_100044594 396
394 3300025922 Ga0207646_10053354 Ga0207646_100533541 396
395 3300025922 Ga0207646_10067848 Ga0207646_100678482 396
396 3300025922 Ga0207646_10114813 Ga0207646_101148132 396
397 3300025922 Ga0207646_10121209 Ga0207646_101212092 396
398 3300025922 Ga0207646_10171851 Ga0207646_101718513 396
399 3300025923 Ga0207681_10150074 Ga0207681_101500741 396
400 3300025925 Ga0207650_10158249 Ga0207650_101582492 396
401 3300025926 Ga0207659_10171794 Ga0207659_101717942 396
402 3300025927 Ga0207687_10022367 Ga0207687_100223673 396
403 3300025931 Ga0207644_10030638 Ga0207644_100306384 396
404 3300025931 Ga0207644_10064533 Ga0207644_100645331 396
405 3300025939 Ga0207665_10004484 Ga0207665_100044844 396
406 3300025939 Ga0207665_10005625 Ga0207665_100056254 396
407 3300025940 Ga0207691_10000821 Ga0207691_1000082114 396
408 3300025940 Ga0207691_10164222 Ga0207691_101642222 396
409 3300025949 Ga0207667_10024668 Ga0207667_100246686 396
410 3300025960 Ga0207651_10033985 Ga0207651_100339854 396
411 3300025961 Ga0207712_10007043 Ga0207712_100070438 396
412 3300025972 Ga0207668_10016276 Ga0207668_100162761 396
413 3300026023 Ga0207677_10241983 Ga0207677_102419832 396
414 3300026035 Ga0207703_10074833 Ga0207703_100748333 396
415 3300026067 Ga0207678_10004377 Ga0207678_1000437715 396
416 3300026075 Ga0207708_10010462 Ga0207708_100104625 396
417 3300026095 Ga0207676_10079581 Ga0207676_100795812 396
418 3300026121 Ga0207683_10002463 Ga0207683_1000246313 396
419 3300026121 Ga0207683_10048241 Ga0207683_100482413 396
420 3300028379 Ga0268266_10261911 Ga0268266_102619111 396
421 3300028381 Ga0268264_10000554 Ga0268264_1000055413 396
422 3300028381 Ga0268264_10020523 Ga0268264_100205232 396
423 3300032004 Ga0307414_10047737 Ga0307414_100477372 396
424 3300035083 Ga0373926_0030811 Ga0373926_0030811_536_1807 396
425 3300035117 Ga0373953_0006138 Ga0373953_0006138_1013_2272 396
426 3300035170 Ga0373943_0013244 Ga0373943_0013244_755_2026 396
427 3300035170 Ga0373943_0078977 Ga0373943_0078977_102_1358 396
428 3300035398 Ga0316574_0039907 Ga0316574_0039907_184_1440 396
429 3300035691 Ga0373931_0028739 Ga0373931_0028739_1204_2475 396
430 3300035691 Ga0373931_0089433 Ga0373931_0089433_378_1634 396
431 3300035692 Ga0373935_0038418 Ga0373935_0038418_1110_2366 396
432 3300035695 Ga0373927_0122426 Ga0373927_0122426_244_1515 396
433 3300035724 Ga0373933_0023960 Ga0373933_0023960_625_1884 396
434 3300035725 Ga0373947_0025573 Ga0373947_0025573_1212_2471 396
435 3300035725 Ga0373947_0086809 Ga0373947_0086809_39_1310 396
436 3300036401 Ga0373937_0009974 Ga0373937_0009974_875_2134 396
437 3300036401 Ga0373937_0116308 Ga0373937_0116308_899_2155 396
438 3300037068 Ga0373925_0093411 Ga0373925_0093411_465_1736 396
439 3300037418 Ga0395900_0006262 Ga0395900_0006262_4195_5451 396
440 3300037466 Ga0395898_0056572 Ga0395898_0056572_146_1402 396
441 3300038443 Ga0395901_0000761 Ga0395901_0000761_88_1344 396
442 3300038443 Ga0395901_0225206 Ga0395901_0225206_184_1440 396
443 3300039437 Ga0436365_0404897 Ga0436365_0404897_1554_2852 396
444 3300039437 Ga0436365_0426196 Ga0436365_0426196_971_2230 396
445 3300042876 Ga0451577_0000994 Ga0451577_0000994_13053_14312 396
446 3300046454 Ga0495592_0017527 Ga0495592_0017527_1612_2871 396
447 3300046454 Ga0495592_0046298 Ga0495592_0046298_92_1348 396
448 3300046459 Ga0495629_0110671 Ga0495629_0110671_150_1409 396
449 3300046462 Ga0495651_0016105 Ga0495651_0016105_493_1749 396
450 3300046473 Ga0495582_0051410 Ga0495582_0051410_204_1463 396
451 3300046511 Ga0495608_0106316 Ga0495608_0106316_276_1532 396
452 3300046516 Ga0495628_0039870 Ga0495628_0039870_597_1856 396
453 3300046517 Ga0495630_0051924 Ga0495630_0051924_1394_2653 396
454 3300046535 Ga0495586_0010419 Ga0495586_0010419_1132_2391 396
455 3300046543 Ga0495645_0098528 Ga0495645_0098528_527_1786 396
456 3300046675 Ga0495657_0120959 Ga0495657_0120959_224_1483 396
457 3300046675 Ga0495657_0164646 Ga0495657_0164646_89_1327 396
458 3300046679 Ga0495623_0006825 Ga0495623_0006825_558_1817 396
459 3300046680 Ga0495646_0009034 Ga0495646_0009034_1774_3033 396
460 3300047317 Ga0495604_0026038 Ga0495604_0026038_2609_3868 396
461 3300047319 Ga0495674_0057563 Ga0495674_0057563_248_1507 396
462 3300047319 Ga0495674_0158166 Ga0495674_0158166_428_1684 396
463 3300047321 Ga0495676_0137870 Ga0495676_0137870_82_1341 396
464 3300047444 Ga0495675_0020276 Ga0495675_0020276_374_1630 396
465 3300047444 Ga0495675_0028062 Ga0495675_0028062_1734_2993 396
466 3300047471 Ga0495684_0083781 Ga0495684_0083781_1038_2297 396
467 3300047471 Ga0495684_0094502 Ga0495684_0094502_366_1622 396
468 3300048088 Ga0495602_0013044 Ga0495602_0013044_7126_8385 396
469 3300048903 Ga0496100_0013402 Ga0496100_0013402_3251_4522 396
470 3300048903 Ga0496100_0040256 Ga0496100_0040256_718_1989 396
471 3300048904 Ga0496101_0003338 Ga0496101_0003338_6532_7803 396
472 3300048904 Ga0496101_0052559 Ga0496101_0052559_1323_2594 396
473 3300048905 Ga0496102_0042775 Ga0496102_0042775_942_2213 396
474 3300048905 Ga0496102_0055172 Ga0496102_0055172_797_2068 396
475 3300048907 Ga0496104_0016347 Ga0496104_0016347_1155_2426 396
476 3300048907 Ga0496104_0056855 Ga0496104_0056855_986_2257 396
477 3300048912 Ga0496109_0002216 Ga0496109_0002216_465_1721 396
478 3300048913 Ga0496110_0063400 Ga0496110_0063400_1082_2353 396
479 3300048914 Ga0496111_0140014 Ga0496111_0140014_310_1581 396
480 3300048915 Ga0496112_0017764 Ga0496112_0017764_1075_2334 396
481 3300048915 Ga0496112_0018273 Ga0496112_0018273_2276_3547 396
482 3300048915 Ga0496112_0076364 Ga0496112_0076364_1200_2471 396
483 3300048916 Ga0496113_0225443 Ga0496113_0225443_213_1472 396
484 3300048917 Ga0496114_0002417 Ga0496114_0002417_3688_4959 396
485 3300048917 Ga0496114_0076837 Ga0496114_0076837_473_1732 396
486 3300048918 Ga0496115_0010916 Ga0496115_0010916_3634_4905 396
487 3300048918 Ga0496115_0015467 Ga0496115_0015467_1179_2450 396
488 3300049742 Ga0501080_0033158 Ga0501080_0033158_247_1506 396
489 3300050493 nmdc:mga0k408_47773_c1 nmdc:mga0k408_47773_c1_1084_2340 396
490 3300050507 nmdc:mga05p37_294091_c1 nmdc:mga05p37_294091_c1_574_1833 396
491 3300050511 nmdc:mga08y16_328972_c1 nmdc:mga08y16_328972_c1_114_1373 396
492 3300050514 nmdc:mga08x19_10517_c1 nmdc:mga08x19_10517_c1_1297_2583 396
493 3300053078 Ga0495612_0056246 Ga0495612_0056246_350_1609 396
494 3300053136 Ga0500559_0045011 Ga0500559_0045011_327_1586 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00346

Complex1_49kDa

Respiratory-chain NADH dehydrogenase, 49 Kd subunit

196

460

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a24-assembly1.cif.gz_G assembly intermediate of the plant mitochondrial complex i 0.7331 35 393
8esz-assembly1.cif.gz_S2 structure of mitochondrial complex i from drosophila melanogaster, helix-locked state 0.7308 30 396
7ar7-assembly1.cif.gz_D cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.725 35 396
6zkg-assembly1.cif.gz_4 complex i with nadh, closed 0.7249 35 396
6zjl-assembly1.cif.gz_4 respiratory complex i from thermus thermophilus, nad+ dataset, major state 0.7233 35 396
ID Description Score Start End Superfamily
af_P33599_211_596_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.7171 35 396 1.10.645.10
af_P9WJH5_38_440_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.7111 35 396 1.10.645.10
af_Q23883_16_406_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.6868 35 396 1.10.645.10
af_P56753_10_393_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.6796 35 396 1.10.645.10
af_P33599_211_596_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.6752 35 396 1.10.645.10
ID Description Score Start End GO Terms
AF-F3GMQ3-F1-model_v4 Bifunctional NADH:ubiquinone oxidoreductase subunit C/D (EC 1.6.99.5) 0.933 197 300 GO:0005886
GO:0016651
GO:0048038
GO:0051287
AF-A0A0V0GN71-F1-model_v4 Putative ovule protein 0.9251 194 298 GO:0005739
GO:0006120
GO:0016651
GO:0048038
GO:0051287
AF-A0A0V0GN71-F1-model_v4 Putative ovule protein 0.908 194 298 GO:0005739
GO:0006120
GO:0016651
GO:0048038
GO:0051287
AF-F3GMQ3-F1-model_v4 Bifunctional NADH:ubiquinone oxidoreductase subunit C/D (EC 1.6.99.5) 0.8997 197 300 GO:0005886
GO:0016651
GO:0048038
GO:0051287
AF-A0A5Q0UUT2-F1-model_v4 NADH-plastoquinone oxidoreductase subunit 7 0.8595 104 300 GO:0009535
GO:0016651
GO:0048038
GO:0051287

Feature Viewer

pLDDT pTM Quality
64.11 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map