F454483
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 493 | 309 | 986 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300048908|Ga0496105_0236916|Ga0496105_0236916_57_1121 |
| Length | 354 |
| Sequence | VSFSAVSGFSRRSLCICFEQAHARRFGGGLDPMKTTFLEFEQPIAELEAKIEELRFVQDDSALDISEEIARLQKKSQGLTKEVYSKLSAWQISQVARHPQRPYALDYMQNLFSGFEELHGDRAFGDDAAIIGGLARFNEQSVMVIGHQKGRDTKDKIYRNFGMPKPEGYRKALRLMKLAEKFGVPVFTFIDTPGAYPGVGAEERGQSEAIGRNLYVMAELRVPVVCTIIGEGGSGGALAIAVGDALLMLQYATYSVISPEGCASILWKSADFAAEAAETLGITATRLKTLGVIDKIVSEPVGGAHRDHDAMMQSLRKALQDAWRQLQGQSIDDLLRTRFERLMAYGKFKEVAAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 74 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 96 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 154 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 161 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 173 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 179 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 184 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 188 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 189 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 190 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 191 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 228 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 229 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 230 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 231 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 232 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 271 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 273 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 274 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 276 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 277 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 278 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 279 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 280 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 281 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 282 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 283 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 284 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 285 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 286 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 287 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 288 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 289 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 290 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 291 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 292 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 293 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 294 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 295 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 296 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 297 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 298 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 299 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 300 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 301 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 302 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 303 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 304 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 305 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 306 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 307 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 308 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 309 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.1 |
| Metatranscriptomes | 0 |
| Isolates | 6.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.65 |
| Nodule | 0.2 |
| Rhizoplane | 3.04 |
| Rhizosphere | 89.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496105_0236916 | 3300048908 | Bacteria | 1482 |
| 2 | JGI24740J21852_10024741 | 3300001979 | Bacteria | 2033 |
| 3 | JGI24735J21928_10014670 | 3300002067 | Bacteria | 2453 |
| 4 | rootH1_10027341 | 3300003316 | Bacteria | 3341 |
| 5 | Ga0055527_1001098 | 3300003760 | Bacteria | 6309 |
| 6 | Ga0055542_1002480 | 3300003762 | Bacteria | 6031 |
| 7 | Ga0055529_1001459 | 3300003763 | Bacteria | 7228 |
| 8 | Ga0055528_1001201 | 3300003790 | Bacteria | 16658 |
| 9 | Ga0055541_1009042 | 3300003841 | Bacteria | 1559 |
| 10 | Ga0058692_1015196 | 3300003856 | Bacteria | 1743 |
| 11 | Ga0065712_10007940 | 3300005290 | Bacteria | 3057 |
| 12 | Ga0070658_10055142 | 3300005327 | Bacteria | 3229 |
| 13 | Ga0070670_100037241 | 3300005331 | Bacteria | 4185 |
| 14 | Ga0070677_10005223 | 3300005333 | Bacteria | 4272 |
| 15 | Ga0068869_100028115 | 3300005334 | Bacteria | 3926 |
| 16 | Ga0068869_100079986 | 3300005334 | Bacteria | 2437 |
| 17 | Ga0070666_10102639 | 3300005335 | Bacteria | 1972 |
| 18 | Ga0070666_10366611 | 3300005335 | Bacteria | 1032 |
| 19 | Ga0068868_100086829 | 3300005338 | Bacteria | 2515 |
| 20 | Ga0068868_100119648 | 3300005338 | Bacteria | 2147 |
| 21 | Ga0068868_100133257 | 3300005338 | Bacteria | 2035 |
| 22 | Ga0068868_100312833 | 3300005338 | Bacteria | 1336 |
| 23 | Ga0070660_100000046 | 3300005339 | Bacteria | 70459 |
| 24 | Ga0070689_100060566 | 3300005340 | Bacteria | 2943 |
| 25 | Ga0070691_10049535 | 3300005341 | Bacteria | 2002 |
| 26 | Ga0070687_100072846 | 3300005343 | Bacteria | 1850 |
| 27 | Ga0070692_10174851 | 3300005345 | Bacteria | 1240 |
| 28 | Ga0070668_100024741 | 3300005347 | Bacteria | 4551 |
| 29 | Ga0070675_100129963 | 3300005354 | Bacteria | 2145 |
| 30 | Ga0070674_100410554 | 3300005356 | Bacteria | 1109 |
| 31 | Ga0070688_100067852 | 3300005365 | Bacteria | 2273 |
| 32 | Ga0070659_100000137 | 3300005366 | Bacteria | 56527 |
| 33 | Ga0070667_100063285 | 3300005367 | Bacteria | 3134 |
| 34 | Ga0070714_100005890 | 3300005435 | Bacteria | 9406 |
| 35 | Ga0070705_100038820 | 3300005440 | Bacteria | 2697 |
| 36 | Ga0070700_100005116 | 3300005441 | Bacteria | 6921 |
| 37 | Ga0070694_100029123 | 3300005444 | Bacteria | 3601 |
| 38 | Ga0070694_100037669 | 3300005444 | Bacteria | 3208 |
| 39 | Ga0070708_100384757 | 3300005445 | Bacteria | 1323 |
| 40 | Ga0070663_100001427 | 3300005455 | Bacteria | 13081 |
| 41 | Ga0070678_100008111 | 3300005456 | Bacteria | 6274 |
| 42 | Ga0070678_100098663 | 3300005456 | Bacteria | 2259 |
| 43 | Ga0070662_100007689 | 3300005457 | Bacteria | 6992 |
| 44 | Ga0070662_100046290 | 3300005457 | Bacteria | 3126 |
| 45 | Ga0070681_10006689 | 3300005458 | Bacteria | 11214 |
| 46 | Ga0070681_10006857 | 3300005458 | Bacteria | 11083 |
| 47 | Ga0070681_10232919 | 3300005458 | Bacteria | 1756 |
| 48 | Ga0068867_100195640 | 3300005459 | Bacteria | 1616 |
| 49 | Ga0070706_100303208 | 3300005467 | Bacteria | 1490 |
| 50 | Ga0070707_100016314 | 3300005468 | Bacteria | 6972 |
| 51 | Ga0070699_100120196 | 3300005518 | Bacteria | 2310 |
| 52 | Ga0070697_100096085 | 3300005536 | Bacteria | 2458 |
| 53 | Ga0068853_100041483 | 3300005539 | Bacteria | 3931 |
| 54 | Ga0070672_100026599 | 3300005543 | Bacteria | 4307 |
| 55 | Ga0070672_100354552 | 3300005543 | Bacteria | 1251 |
| 56 | Ga0070695_100218565 | 3300005545 | Bacteria | 1372 |
| 57 | Ga0070696_100000392 | 3300005546 | Bacteria | 27022 |
| 58 | Ga0070696_100177919 | 3300005546 | Bacteria | 1576 |
| 59 | Ga0070665_100025061 | 3300005548 | Bacteria | 6012 |
| 60 | Ga0070704_100008150 | 3300005549 | Bacteria | 6266 |
| 61 | Ga0070704_100029116 | 3300005549 | Bacteria | 3683 |
| 62 | Ga0070704_100048797 | 3300005549 | Bacteria | 2965 |
| 63 | Ga0068855_100124279 | 3300005563 | Bacteria | 2951 |
| 64 | Ga0068855_100133240 | 3300005563 | Bacteria | 2836 |
| 65 | Ga0068855_100134113 | 3300005563 | Bacteria | 2826 |
| 66 | Ga0070664_100006972 | 3300005564 | Bacteria | 9111 |
| 67 | Ga0068857_100067605 | 3300005577 | Bacteria | 3180 |
| 68 | Ga0068854_100069230 | 3300005578 | Bacteria | 2575 |
| 69 | Ga0068852_100011917 | 3300005616 | Bacteria | 6575 |
| 70 | Ga0068852_100421879 | 3300005616 | Bacteria | 1316 |
| 71 | Ga0068859_100458203 | 3300005617 | Bacteria | 1371 |
| 72 | Ga0068864_100105097 | 3300005618 | Bacteria | 2509 |
| 73 | Ga0068866_10006618 | 3300005718 | Bacteria | 4833 |
| 74 | Ga0068861_100048896 | 3300005719 | Bacteria | 3199 |
| 75 | Ga0068851_10017524 | 3300005834 | Bacteria | 3441 |
| 76 | Ga0068870_10031022 | 3300005840 | Bacteria | 2705 |
| 77 | Ga0068870_10038295 | 3300005840 | Bacteria | 2475 |
| 78 | Ga0068863_100211346 | 3300005841 | Bacteria | 1868 |
| 79 | Ga0068858_100430768 | 3300005842 | Bacteria | 1269 |
| 80 | Ga0068860_100056721 | 3300005843 | Bacteria | 3723 |
| 81 | Ga0068860_100174635 | 3300005843 | Bacteria | 2076 |
| 82 | Ga0068860_100453029 | 3300005843 | Bacteria | 1276 |
| 83 | Ga0068862_100056646 | 3300005844 | Bacteria | 3359 |
| 84 | Ga0097621_100015777 | 3300006237 | Bacteria | 5694 |
| 85 | Ga0068871_100037578 | 3300006358 | Bacteria | 3862 |
| 86 | Ga0068871_100243878 | 3300006358 | Bacteria | 1563 |
| 87 | Ga0075428_100000521 | 3300006844 | Bacteria | 39098 |
| 88 | Ga0075430_100225192 | 3300006846 | Bacteria | 1555 |
| 89 | Ga0075434_100103676 | 3300006871 | Bacteria | 2853 |
| 90 | Ga0075429_100020657 | 3300006880 | Bacteria | 5716 |
| 91 | Ga0075429_100033574 | 3300006880 | Bacteria | 4459 |
| 92 | Ga0068865_100015250 | 3300006881 | Bacteria | 4898 |
| 93 | Ga0068865_100042743 | 3300006881 | Bacteria | 3092 |
| 94 | Ga0075436_100064759 | 3300006914 | Bacteria | 2527 |
| 95 | Ga0097620_100458277 | 3300006931 | Bacteria | 1371 |
| 96 | Ga0099795_10005599 | 3300007788 | Bacteria | 3358 |
| 97 | Ga0105250_10015742 | 3300009092 | Bacteria | 3094 |
| 98 | Ga0105240_10026104 | 3300009093 | Bacteria | 7669 |
| 99 | Ga0105240_10030439 | 3300009093 | Bacteria | 7016 |
| 100 | Ga0105240_10054014 | 3300009093 | Bacteria | 5037 |
| 101 | Ga0105240_10290029 | 3300009093 | Bacteria | 1876 |
| 102 | Ga0111539_10001172 | 3300009094 | Bacteria | 34757 |
| 103 | Ga0111539_10009312 | 3300009094 | Bacteria | 12402 |
| 104 | Ga0111539_10030266 | 3300009094 | Bacteria | 6582 |
| 105 | Ga0111539_10282558 | 3300009094 | Bacteria | 1931 |
| 106 | Ga0105245_10185012 | 3300009098 | Bacteria | 1993 |
| 107 | Ga0105247_10192616 | 3300009101 | Bacteria | 1366 |
| 108 | Ga0105243_10009687 | 3300009148 | Bacteria | 7336 |
| 109 | Ga0105241_10090874 | 3300009174 | Bacteria | 2408 |
| 110 | Ga0105241_10095198 | 3300009174 | Bacteria | 2357 |
| 111 | Ga0105242_10047633 | 3300009176 | Bacteria | 3481 |
| 112 | Ga0105242_10171044 | 3300009176 | Bacteria | 1910 |
| 113 | Ga0105248_10026883 | 3300009177 | Bacteria | 6400 |
| 114 | Ga0105238_10004384 | 3300009551 | Bacteria | 14000 |
| 115 | Ga0099796_10013535 | 3300010159 | Bacteria | 2333 |
| 116 | Ga0105239_10029223 | 3300010375 | Bacteria | 6061 |
| 117 | Ga0157370_10008713 | 3300013104 | Bacteria | 10913 |
| 118 | Ga0157374_10001207 | 3300013296 | Bacteria | 22110 |
| 119 | Ga0157374_10029174 | 3300013296 | Bacteria | 4992 |
| 120 | Ga0157374_10090792 | 3300013296 | Bacteria | 2912 |
| 121 | Ga0157378_10029477 | 3300013297 | Bacteria | 4845 |
| 122 | Ga0157378_10052531 | 3300013297 | Bacteria | 3626 |
| 123 | Ga0157378_10385666 | 3300013297 | Bacteria | 1377 |
| 124 | Ga0163162_10067895 | 3300013306 | Bacteria | 3616 |
| 125 | Ga0163162_10086769 | 3300013306 | Bacteria | 3207 |
| 126 | Ga0157375_10016421 | 3300013308 | Bacteria | 6652 |
| 127 | Ga0157375_10135495 | 3300013308 | Bacteria | 2586 |
| 128 | Ga0163163_10008865 | 3300014325 | Bacteria | 8956 |
| 129 | Ga0157380_10568800 | 3300014326 | Bacteria | 1115 |
| 130 | Ga0157377_10027064 | 3300014745 | Bacteria | 3075 |
| 131 | Ga0157376_10033893 | 3300014969 | Bacteria | 4117 |
| 132 | Ga0157376_10045702 | 3300014969 | Bacteria | 3607 |
| 133 | Ga0157376_10202493 | 3300014969 | Bacteria | 1827 |
| 134 | Ga0213872_10001354 | 3300021361 | Bacteria | 16160 |
| 135 | Ga0213872_10002022 | 3300021361 | Bacteria | 12319 |
| 136 | Ga0213872_10012179 | 3300021361 | Bacteria | 4055 |
| 137 | Ga0209566_102185 | 3300025225 | Bacteria | 3906 |
| 138 | Ga0209672_100014 | 3300025228 | Bacteria | 546252 |
| 139 | Ga0209672_100023 | 3300025228 | Bacteria | 371758 |
| 140 | Ga0209147_100127 | 3300025229 | Bacteria | 123986 |
| 141 | Ga0209147_100171 | 3300025229 | Bacteria | 86726 |
| 142 | Ga0209147_100586 | 3300025229 | Bacteria | 20183 |
| 143 | Ga0209258_100134 | 3300025242 | Bacteria | 174683 |
| 144 | Ga0209258_100183 | 3300025242 | Bacteria | 136466 |
| 145 | Ga0209148_1000035 | 3300025254 | Bacteria | 548413 |
| 146 | Ga0209759_1003294 | 3300025256 | Bacteria | 6505 |
| 147 | Ga0209455_1000072 | 3300025272 | Bacteria | 293074 |
| 148 | Ga0209673_1000140 | 3300025273 | Bacteria | 157575 |
| 149 | Ga0209564_1004595 | 3300025295 | Bacteria | 8335 |
| 150 | Ga0207656_10010393 | 3300025321 | Bacteria | 3486 |
| 151 | Ga0207696_1025786 | 3300025711 | Bacteria | 1827 |
| 152 | Ga0207642_10004347 | 3300025899 | Bacteria | 4569 |
| 153 | Ga0207688_10004916 | 3300025901 | Bacteria | 7275 |
| 154 | Ga0207647_10002161 | 3300025904 | Bacteria | 14993 |
| 155 | Ga0207645_10042327 | 3300025907 | Bacteria | 2914 |
| 156 | Ga0207645_10179902 | 3300025907 | Bacteria | 1387 |
| 157 | Ga0207643_10004473 | 3300025908 | Bacteria | 7515 |
| 158 | Ga0207643_10027142 | 3300025908 | Bacteria | 3173 |
| 159 | Ga0207707_10067332 | 3300025912 | Bacteria | 3119 |
| 160 | Ga0207695_10002788 | 3300025913 | Bacteria | 25437 |
| 161 | Ga0207695_10050102 | 3300025913 | Bacteria | 4396 |
| 162 | Ga0207671_10010223 | 3300025914 | Bacteria | 7767 |
| 163 | Ga0207662_10017037 | 3300025918 | Bacteria | 4105 |
| 164 | Ga0207662_10096097 | 3300025918 | Bacteria | 1830 |
| 165 | Ga0207657_10004086 | 3300025919 | Bacteria | 15489 |
| 166 | Ga0207649_10035897 | 3300025920 | Bacteria | 2982 |
| 167 | Ga0207646_10042955 | 3300025922 | Bacteria | 4061 |
| 168 | Ga0207694_10006398 | 3300025924 | Bacteria | 8972 |
| 169 | Ga0207687_10105593 | 3300025927 | Bacteria | 2081 |
| 170 | Ga0207687_10466926 | 3300025927 | Bacteria | 1049 |
| 171 | Ga0207690_10000102 | 3300025932 | Bacteria | 69683 |
| 172 | Ga0207690_10063437 | 3300025932 | Bacteria | 2519 |
| 173 | Ga0207706_10002958 | 3300025933 | Bacteria | 16402 |
| 174 | Ga0207670_10227457 | 3300025936 | Bacteria | 1431 |
| 175 | Ga0207704_10032607 | 3300025938 | Bacteria | 2950 |
| 176 | Ga0207704_10032808 | 3300025938 | Bacteria | 2944 |
| 177 | Ga0207691_10038607 | 3300025940 | Bacteria | 4419 |
| 178 | Ga0207691_10062425 | 3300025940 | Bacteria | 3381 |
| 179 | Ga0207691_10137363 | 3300025940 | Bacteria | 2155 |
| 180 | Ga0207711_10162064 | 3300025941 | Bacteria | 2025 |
| 181 | Ga0207689_10003547 | 3300025942 | Bacteria | 14265 |
| 182 | Ga0207689_10052331 | 3300025942 | Bacteria | 3365 |
| 183 | Ga0207689_10094838 | 3300025942 | Bacteria | 2451 |
| 184 | Ga0207679_10032964 | 3300025945 | Bacteria | 3642 |
| 185 | Ga0207679_10197895 | 3300025945 | Bacteria | 1676 |
| 186 | Ga0207667_10051532 | 3300025949 | Bacteria | 4339 |
| 187 | Ga0207667_10213808 | 3300025949 | Bacteria | 1976 |
| 188 | Ga0207667_10257978 | 3300025949 | Bacteria | 1783 |
| 189 | Ga0207651_10083744 | 3300025960 | Bacteria | 2307 |
| 190 | Ga0207712_10219507 | 3300025961 | Bacteria | 1519 |
| 191 | Ga0207677_10056852 | 3300026023 | Bacteria | 2683 |
| 192 | Ga0207677_10216660 | 3300026023 | Bacteria | 1533 |
| 193 | Ga0207677_10361695 | 3300026023 | Bacteria | 1219 |
| 194 | Ga0207703_10053617 | 3300026035 | Bacteria | 3278 |
| 195 | Ga0207703_10225711 | 3300026035 | Bacteria | 1677 |
| 196 | Ga0207639_10092193 | 3300026041 | Bacteria | 2428 |
| 197 | Ga0207678_10004107 | 3300026067 | Bacteria | 13091 |
| 198 | Ga0207708_10003125 | 3300026075 | Bacteria | 12190 |
| 199 | Ga0207708_10367565 | 3300026075 | Bacteria | 1183 |
| 200 | Ga0207702_10190783 | 3300026078 | Bacteria | 1893 |
| 201 | Ga0207641_10121714 | 3300026088 | Bacteria | 2329 |
| 202 | Ga0207641_10146996 | 3300026088 | Bacteria | 2132 |
| 203 | Ga0207641_10185910 | 3300026088 | Bacteria | 1906 |
| 204 | Ga0207648_10038583 | 3300026089 | Bacteria | 4203 |
| 205 | Ga0207648_10059767 | 3300026089 | Bacteria | 3324 |
| 206 | Ga0207648_10249234 | 3300026089 | Bacteria | 1583 |
| 207 | Ga0207676_10062641 | 3300026095 | Bacteria | 2951 |
| 208 | Ga0207674_10081698 | 3300026116 | Bacteria | 3234 |
| 209 | Ga0207674_10198835 | 3300026116 | Bacteria | 1954 |
| 210 | Ga0207675_100009234 | 3300026118 | Bacteria | 9248 |
| 211 | Ga0207675_100039257 | 3300026118 | Bacteria | 4419 |
| 212 | Ga0207683_10022139 | 3300026121 | Bacteria | 5453 |
| 213 | Ga0207683_10044401 | 3300026121 | Bacteria | 3885 |
| 214 | Ga0207683_10249697 | 3300026121 | Bacteria | 1619 |
| 215 | Ga0207698_10013997 | 3300026142 | Bacteria | 5315 |
| 216 | Ga0207698_10072659 | 3300026142 | Bacteria | 2735 |
| 217 | Ga0209371_1000079 | 3300027312 | Bacteria | 187621 |
| 218 | Ga0209967_1003804 | 3300027364 | Bacteria | 1993 |
| 219 | Ga0209981_1006007 | 3300027378 | Bacteria | 1621 |
| 220 | Ga0209999_1005054 | 3300027543 | Bacteria | 2371 |
| 221 | Ga0209974_10020186 | 3300027876 | Bacteria | 2209 |
| 222 | Ga0207428_10000830 | 3300027907 | Bacteria | 34841 |
| 223 | Ga0207428_10034099 | 3300027907 | Bacteria | 4174 |
| 224 | Ga0207428_10345274 | 3300027907 | Bacteria | 1096 |
| 225 | Ga0268265_10033116 | 3300028380 | Bacteria | 3754 |
| 226 | Ga0268264_10064795 | 3300028381 | Bacteria | 3076 |
| 227 | Ga0268264_10413163 | 3300028381 | Bacteria | 1300 |
| 228 | Ga0265323_10002607 | 3300028653 | Bacteria | 8183 |
| 229 | Ga0265336_10003222 | 3300028666 | Bacteria | 6473 |
| 230 | Ga0265338_10079698 | 3300028800 | Bacteria | 2755 |
| 231 | Ga0265324_10000034 | 3300029957 | Bacteria | 124255 |
| 232 | Ga0265324_10000928 | 3300029957 | Bacteria | 18416 |
| 233 | Ga0265324_10008351 | 3300029957 | Bacteria | 4117 |
| 234 | Ga0268256_1000090 | 3300030500 | Bacteria | 153976 |
| 235 | Ga0265332_10019855 | 3300031238 | Bacteria | 2966 |
| 236 | Ga0265328_10002316 | 3300031239 | Bacteria | 8583 |
| 237 | Ga0265328_10005022 | 3300031239 | Bacteria | 5701 |
| 238 | Ga0265328_10025725 | 3300031239 | Bacteria | 2217 |
| 239 | Ga0265328_10044916 | 3300031239 | Bacteria | 1625 |
| 240 | Ga0265325_10000220 | 3300031241 | Bacteria | 40313 |
| 241 | Ga0265325_10006034 | 3300031241 | Bacteria | 7411 |
| 242 | Ga0265331_10000115 | 3300031250 | Bacteria | 105212 |
| 243 | Ga0265331_10001043 | 3300031250 | Bacteria | 21599 |
| 244 | Ga0265331_10002725 | 3300031250 | Bacteria | 11772 |
| 245 | Ga0265331_10016983 | 3300031250 | Bacteria | 3807 |
| 246 | Ga0265331_10019845 | 3300031250 | Bacteria | 3462 |
| 247 | Ga0265331_10020051 | 3300031250 | Bacteria | 3439 |
| 248 | Ga0265331_10044009 | 3300031250 | Bacteria | 2160 |
| 249 | Ga0265327_10000045 | 3300031251 | Bacteria | 282880 |
| 250 | Ga0265327_10000217 | 3300031251 | Bacteria | 117085 |
| 251 | Ga0265327_10000261 | 3300031251 | Bacteria | 104627 |
| 252 | Ga0265327_10000439 | 3300031251 | Bacteria | 75504 |
| 253 | Ga0265327_10000645 | 3300031251 | Bacteria | 56357 |
| 254 | Ga0265327_10021590 | 3300031251 | Bacteria | 3880 |
| 255 | Ga0265327_10026412 | 3300031251 | Bacteria | 3363 |
| 256 | Ga0265327_10084885 | 3300031251 | Bacteria | 1555 |
| 257 | Ga0265316_10012725 | 3300031344 | Bacteria | 7522 |
| 258 | Ga0265316_10068144 | 3300031344 | Bacteria | 2751 |
| 259 | Ga0265316_10133561 | 3300031344 | Bacteria | 1868 |
| 260 | Ga0265316_10151206 | 3300031344 | Bacteria | 1739 |
| 261 | Ga0307509_10000053 | 3300031507 | Bacteria | 164364 |
| 262 | Ga0307408_100320233 | 3300031548 | Bacteria | 1306 |
| 263 | Ga0265314_10000384 | 3300031711 | Bacteria | 60231 |
| 264 | Ga0265314_10006581 | 3300031711 | Bacteria | 10238 |
| 265 | Ga0265314_10057783 | 3300031711 | Bacteria | 2661 |
| 266 | Ga0265342_10006157 | 3300031712 | Bacteria | 8979 |
| 267 | Ga0307413_10128704 | 3300031824 | Bacteria | 1729 |
| 268 | Ga0307416_100213150 | 3300032002 | Bacteria | 1844 |
| 269 | Ga0307416_100516344 | 3300032002 | Bacteria | 1262 |
| 270 | Ga0307411_10011940 | 3300032005 | Bacteria | 4714 |
| 271 | Ga0373934_0010374 | 3300035086 | Bacteria | 3496 |
| 272 | Ga0373952_0000121 | 3300035092 | Bacteria | 10903 |
| 273 | Ga0373936_0009042 | 3300035113 | Bacteria | 3759 |
| 274 | Ga0373945_0040910 | 3300035116 | Bacteria | 1675 |
| 275 | Ga0373953_0083098 | 3300035117 | Bacteria | 1333 |
| 276 | Ga0373954_0001060 | 3300035118 | Bacteria | 10954 |
| 277 | Ga0373954_0005524 | 3300035118 | Bacteria | 5470 |
| 278 | Ga0373954_0177501 | 3300035118 | Bacteria | 1044 |
| 279 | Ga0373956_0000137 | 3300035119 | Bacteria | 26180 |
| 280 | Ga0373957_0000904 | 3300035120 | Bacteria | 7741 |
| 281 | Ga0373957_0040822 | 3300035120 | Bacteria | 1745 |
| 282 | Ga0373943_0023398 | 3300035170 | Bacteria | 2873 |
| 283 | Ga0373943_0192040 | 3300035170 | Bacteria | 1127 |
| 284 | Ga0373955_0074239 | 3300035172 | Bacteria | 1908 |
| 285 | Ga0373955_0074282 | 3300035172 | Bacteria | 1907 |
| 286 | Ga0373931_0152746 | 3300035691 | Bacteria | 1347 |
| 287 | Ga0373931_0174842 | 3300035691 | Bacteria | 1268 |
| 288 | Ga0373935_0017948 | 3300035692 | Bacteria | 4299 |
| 289 | Ga0373927_0007684 | 3300035695 | Bacteria | 7296 |
| 290 | Ga0373927_0179325 | 3300035695 | Bacteria | 1389 |
| 291 | Ga0373933_0002078 | 3300035724 | Bacteria | 11494 |
| 292 | Ga0373933_0193864 | 3300035724 | Bacteria | 1299 |
| 293 | Ga0373937_0001819 | 3300036401 | Bacteria | 17904 |
| 294 | Ga0373937_0042715 | 3300036401 | Bacteria | 4136 |
| 295 | Ga0373937_0148766 | 3300036401 | Bacteria | 2193 |
| 296 | Ga0373937_0200746 | 3300036401 | Bacteria | 1874 |
| 297 | Ga0395900_0344898 | 3300037418 | Bacteria | 1464 |
| 298 | Ga0436365_1065712 | 3300039437 | Bacteria | 2160 |
| 299 | Ga0436361_0138833 | 3300039447 | Bacteria | 4030 |
| 300 | Ga0436361_0842412 | 3300039447 | Bacteria | 17784 |
| 301 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 302 | Ga0451577_0002370 | 3300042876 | Bacteria | 22606 |
| 303 | Ga0451577_0043759 | 3300042876 | Bacteria | 4010 |
| 304 | Ga0451577_0070307 | 3300042876 | Bacteria | 3122 |
| 305 | Ga0451577_0502696 | 3300042876 | Bacteria | 1100 |
| 306 | Ga0453683_0000003 | 3300044673 | Bacteria | 942572 |
| 307 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 308 | Ga0453684_0000075 | 3300044712 | Bacteria | 437715 |
| 309 | Ga0453684_0008235 | 3300044712 | Bacteria | 18793 |
| 310 | Ga0453684_0009433 | 3300044712 | Bacteria | 17070 |
| 311 | Ga0453684_0071533 | 3300044712 | Bacteria | 4385 |
| 312 | Ga0453684_0107757 | 3300044712 | Bacteria | 3392 |
| 313 | Ga0453684_0170593 | 3300044712 | Bacteria | 2564 |
| 314 | Ga0466959_0080551 | 3300045049 | Bacteria | 2347 |
| 315 | Ga0451576_0000004 | 3300045051 | Bacteria | 1312238 |
| 316 | Ga0451576_0000013 | 3300045051 | Bacteria | 665120 |
| 317 | Ga0451576_0000765 | 3300045051 | Bacteria | 63455 |
| 318 | Ga0451576_0001449 | 3300045051 | Bacteria | 40328 |
| 319 | Ga0451576_0001549 | 3300045051 | Bacteria | 38731 |
| 320 | Ga0451576_0001661 | 3300045051 | Bacteria | 36936 |
| 321 | Ga0451576_0001796 | 3300045051 | Bacteria | 35141 |
| 322 | Ga0451576_0011136 | 3300045051 | Bacteria | 10258 |
| 323 | Ga0451576_0035936 | 3300045051 | Bacteria | 5254 |
| 324 | Ga0451576_0038429 | 3300045051 | Bacteria | 5065 |
| 325 | Ga0451576_0226101 | 3300045051 | Bacteria | 1954 |
| 326 | Ga0495592_0095904 | 3300046454 | Bacteria | 2120 |
| 327 | Ga0495592_0106199 | 3300046454 | Bacteria | 1993 |
| 328 | Ga0495651_0000330 | 3300046462 | Bacteria | 36818 |
| 329 | Ga0495651_0042723 | 3300046462 | Bacteria | 3518 |
| 330 | Ga0495653_0048944 | 3300046463 | Bacteria | 3259 |
| 331 | Ga0495580_0067776 | 3300046472 | Bacteria | 2496 |
| 332 | Ga0495580_0230450 | 3300046472 | Bacteria | 1272 |
| 333 | Ga0495582_0029222 | 3300046473 | Bacteria | 3026 |
| 334 | Ga0495662_0006147 | 3300046476 | Bacteria | 6002 |
| 335 | Ga0495608_0017936 | 3300046511 | Bacteria | 4893 |
| 336 | Ga0495618_0138511 | 3300046514 | Bacteria | 1556 |
| 337 | Ga0495628_0000779 | 3300046516 | Bacteria | 29317 |
| 338 | Ga0495628_0013635 | 3300046516 | Bacteria | 6830 |
| 339 | Ga0495628_0065308 | 3300046516 | Bacteria | 2847 |
| 340 | Ga0495630_0098410 | 3300046517 | Bacteria | 2212 |
| 341 | Ga0495630_0248378 | 3300046517 | Bacteria | 1359 |
| 342 | Ga0495666_0058977 | 3300046526 | Bacteria | 1835 |
| 343 | Ga0495642_0032301 | 3300046528 | Bacteria | 2100 |
| 344 | Ga0495652_0078474 | 3300046529 | Bacteria | 2733 |
| 345 | Ga0495665_0154560 | 3300046531 | Bacteria | 1197 |
| 346 | Ga0495640_0161472 | 3300046533 | Bacteria | 1435 |
| 347 | Ga0495598_0030752 | 3300046537 | Bacteria | 1506 |
| 348 | Ga0495645_0000769 | 3300046543 | Bacteria | 21928 |
| 349 | Ga0495633_0063112 | 3300046558 | Bacteria | 1734 |
| 350 | Ga0495667_0028228 | 3300046559 | Bacteria | 3777 |
| 351 | Ga0495659_0100818 | 3300046664 | Bacteria | 1118 |
| 352 | Ga0495657_0015591 | 3300046675 | Bacteria | 5555 |
| 353 | Ga0495599_0000736 | 3300046678 | Bacteria | 18470 |
| 354 | Ga0495599_0128334 | 3300046678 | Bacteria | 1575 |
| 355 | Ga0495647_0035709 | 3300046681 | Bacteria | 1867 |
| 356 | Ga0495658_0081162 | 3300046683 | Bacteria | 1904 |
| 357 | Ga0495669_0071196 | 3300046684 | Bacteria | 1585 |
| 358 | Ga0495613_0019047 | 3300046689 | Bacteria | 5115 |
| 359 | Ga0495624_0128779 | 3300046690 | Bacteria | 1552 |
| 360 | Ga0495604_0126662 | 3300047317 | Bacteria | 1840 |
| 361 | Ga0495636_0063365 | 3300047318 | Bacteria | 1567 |
| 362 | Ga0495680_0237208 | 3300047322 | Bacteria | 1296 |
| 363 | Ga0495684_0044018 | 3300047471 | Bacteria | 3417 |
| 364 | Ga0496108_0038992 | 3300048911 | Bacteria | 3960 |
| 365 | Ga0496108_0275457 | 3300048911 | Bacteria | 1465 |
| 366 | Ga0496109_0186270 | 3300048912 | Bacteria | 1950 |
| 367 | Ga0496109_0282868 | 3300048912 | Bacteria | 1563 |
| 368 | Ga0496110_0100682 | 3300048913 | Bacteria | 2590 |
| 369 | Ga0496111_0137216 | 3300048914 | Bacteria | 1812 |
| 370 | Ga0496114_0000506 | 3300048917 | Bacteria | 28521 |
| 371 | Ga0496114_0031437 | 3300048917 | Bacteria | 4368 |
| 372 | Ga0496114_0136071 | 3300048917 | Bacteria | 2125 |
| 373 | Ga0496115_0406404 | 3300048918 | Bacteria | 1104 |
| 374 | Ga0501290_004752 | 3300049513 | Bacteria | 1695 |
| 375 | Ga0501031_0064132 | 3300049568 | Bacteria | 2392 |
| 376 | Ga0501031_0130239 | 3300049568 | Bacteria | 1643 |
| 377 | Ga0501031_0161738 | 3300049568 | Bacteria | 1463 |
| 378 | Ga0501032_0000195 | 3300049569 | Bacteria | 50432 |
| 379 | Ga0501032_0007574 | 3300049569 | Bacteria | 7928 |
| 380 | Ga0501032_0020636 | 3300049569 | Bacteria | 4586 |
| 381 | Ga0501033_0000769 | 3300049570 | Bacteria | 29459 |
| 382 | Ga0501033_0030572 | 3300049570 | Bacteria | 4046 |
| 383 | Ga0501033_0031705 | 3300049570 | Bacteria | 3969 |
| 384 | Ga0501034_0061730 | 3300049571 | Bacteria | 3763 |
| 385 | Ga0501034_0079912 | 3300049571 | Bacteria | 3274 |
| 386 | Ga0501036_0018739 | 3300049572 | Bacteria | 5805 |
| 387 | Ga0501036_0032140 | 3300049572 | Bacteria | 4433 |
| 388 | Ga0501036_0145441 | 3300049572 | Bacteria | 1999 |
| 389 | Ga0501037_0016853 | 3300049573 | Bacteria | 5375 |
| 390 | Ga0501038_0004407 | 3300049574 | Bacteria | 13093 |
| 391 | Ga0501038_0009495 | 3300049574 | Bacteria | 8926 |
| 392 | Ga0501038_0016210 | 3300049574 | Bacteria | 6757 |
| 393 | Ga0501038_0019172 | 3300049574 | Bacteria | 6170 |
| 394 | Ga0501038_0115195 | 3300049574 | Bacteria | 2222 |
| 395 | Ga0501039_0007196 | 3300049575 | Bacteria | 8479 |
| 396 | Ga0501039_0027909 | 3300049575 | Bacteria | 4341 |
| 397 | Ga0501039_0037543 | 3300049575 | Bacteria | 3739 |
| 398 | Ga0501040_0008296 | 3300049576 | Bacteria | 6757 |
| 399 | Ga0501041_0263653 | 3300049577 | Bacteria | 1083 |
| 400 | Ga0501042_0011071 | 3300049578 | Bacteria | 6074 |
| 401 | Ga0501043_0013190 | 3300049579 | Bacteria | 6464 |
| 402 | Ga0501043_0036608 | 3300049579 | Bacteria | 3862 |
| 403 | Ga0501043_0052412 | 3300049579 | Bacteria | 3204 |
| 404 | Ga0501043_0150495 | 3300049579 | Bacteria | 1821 |
| 405 | Ga0501046_0002569 | 3300049580 | Bacteria | 16990 |
| 406 | Ga0501046_0014062 | 3300049580 | Bacteria | 6758 |
| 407 | Ga0501047_0009664 | 3300049581 | Bacteria | 9116 |
| 408 | Ga0501048_0006214 | 3300049582 | Bacteria | 9086 |
| 409 | Ga0501068_0000062 | 3300049584 | Bacteria | 42494 |
| 410 | Ga0501068_0001455 | 3300049584 | Bacteria | 12580 |
| 411 | Ga0501068_0089189 | 3300049584 | Bacteria | 1901 |
| 412 | Ga0501068_0226307 | 3300049584 | Bacteria | 1189 |
| 413 | Ga0501069_0018380 | 3300049585 | Bacteria | 3772 |
| 414 | Ga0501070_0001800 | 3300049586 | Bacteria | 18908 |
| 415 | Ga0501070_0015939 | 3300049586 | Bacteria | 6318 |
| 416 | Ga0501070_0027425 | 3300049586 | Bacteria | 4778 |
| 417 | Ga0501071_0007107 | 3300049587 | Bacteria | 7316 |
| 418 | Ga0501071_0027203 | 3300049587 | Bacteria | 4022 |
| 419 | Ga0501073_0001234 | 3300049589 | Bacteria | 18672 |
| 420 | Ga0501073_0030581 | 3300049589 | Bacteria | 3844 |
| 421 | Ga0501073_0039353 | 3300049589 | Bacteria | 3350 |
| 422 | Ga0501074_0031724 | 3300049590 | Bacteria | 3828 |
| 423 | Ga0501075_0002095 | 3300049591 | Bacteria | 13189 |
| 424 | Ga0501075_0061831 | 3300049591 | Bacteria | 2822 |
| 425 | Ga0501075_0064479 | 3300049591 | Bacteria | 2763 |
| 426 | Ga0501076_0000797 | 3300049592 | Bacteria | 20393 |
| 427 | Ga0501077_0030866 | 3300049593 | Bacteria | 3411 |
| 428 | Ga0501077_0057642 | 3300049593 | Bacteria | 2466 |
| 429 | Ga0501079_0007373 | 3300049741 | Bacteria | 8318 |
| 430 | Ga0501080_0011759 | 3300049742 | Bacteria | 8022 |
| 431 | Ga0501080_0018353 | 3300049742 | Bacteria | 6474 |
| 432 | Ga0501080_0028390 | 3300049742 | Bacteria | 5205 |
| 433 | Ga0501080_0319370 | 3300049742 | Bacteria | 1406 |
| 434 | Ga0501081_0005835 | 3300049743 | Bacteria | 7969 |
| 435 | Ga0501081_0072930 | 3300049743 | Bacteria | 2394 |
| 436 | Ga0501083_0038393 | 3300049744 | Bacteria | 3256 |
| 437 | Ga0501035_0000827 | 3300049822 | Bacteria | 33027 |
| 438 | Ga0501035_0055517 | 3300049822 | Bacteria | 3536 |
| 439 | Ga0501044_0000248 | 3300049823 | Bacteria | 68598 |
| 440 | Ga0501044_0004061 | 3300049823 | Bacteria | 16418 |
| 441 | Ga0501045_0001453 | 3300049824 | Bacteria | 15744 |
| 442 | Ga0501045_0013862 | 3300049824 | Bacteria | 5701 |
| 443 | nmdc:mga09592_17028_c1 | 3300050508 | Bacteria | 5949 |
| 444 | nmdc:mga08y16_175837_c1 | 3300050511 | Bacteria | 2223 |
| 445 | nmdc:mga08y16_4227_c1 | 3300050511 | Bacteria | 14981 |
| 446 | nmdc:mga08y16_424968_c1 | 3300050511 | Bacteria | 1358 |
| 447 | nmdc:mga0n895_128791_c1 | 3300050512 | Bacteria | 2555 |
| 448 | nmdc:mga08x19_132396_c1 | 3300050514 | Bacteria | 1678 |
| 449 | Ga0495601_0000433 | 3300053077 | Bacteria | 21909 |
| 450 | Ga0495595_0002021 | 3300053084 | Bacteria | 7877 |
| 451 | Ga0495619_0174566 | 3300053085 | Bacteria | 1486 |
| 452 | Ga0500622_0000001 | 3300053156 | Bacteria | 657715 |
| 453 | Ga0501084_0017520 | 3300054114 | Bacteria | 5957 |
| 454 | Ga0590071_004702 | 3300059421 | Bacteria | 3297 |
| 455 | Ga0590077_010593 | 3300059426 | Bacteria | 1896 |
| 456 | Ga0501082_0001624 | 3300060353 | Bacteria | 19807 |
| 457 | Ga0501082_0099832 | 3300060353 | Bacteria | 2510 |
| 458 | Ga0501082_0154596 | 3300060353 | Bacteria | 1993 |
| 459 | Ga0530510_0002600 | 3300061734 | Bacteria | 12409 |
| 460 | 2501080587 | 2501025502 | Bacteria | 9641094 |
| 461 | 2511086960 | 2510917013 | Bacteria | 9951648 |
| 462 | 2519459128 | 2519103095 | Bacteria | 6629912 |
| 463 | 2585290290 | 2582581311 | Bacteria | 6763856 |
| 464 | 2599736730 | 2599185239 | Bacteria | 8686614 |
| 465 | 2599744803 | 2599185240 | Bacteria | 7968121 |
| 466 | 2600205833 | 2599185355 | Bacteria | 7968906 |
| 467 | 2676742932 | 2675903129 | Bacteria | 7964495 |
| 468 | 2817261413 | 2816332253 | Bacteria | 6764532 |
| 469 | 2817279099 | 2816332256 | Bacteria | 6891714 |
| 470 | 2817456296 | 2816332286 | Bacteria | 6853759 |
| 471 | 2819631214 | 2818991452 | Bacteria | 8442785 |
| 472 | 2856294276 | 2856287931 | Bacteria | 7223934 |
| 473 | 2857367533 | 2857357740 | Bacteria | 9937880 |
| 474 | 2863427432 | 2863421361 | Bacteria | 7300805 |
| 475 | 2870070904 | 2870068957 | Bacteria | 8925310 |
| 476 | 2891636741 | 2891633521 | Bacteria | 4602265 |
| 477 | 2904570050 | 2904564687 | Bacteria | 7609577 |
| 478 | 2904576039 | 2904571731 | Bacteria | 7608790 |
| 479 | 2928162939 | 2928157003 | Bacteria | 7522202 |
| 480 | 2928169601 | 2928163908 | Bacteria | 7561269 |
| 481 | 2928171667 | 2928170801 | Bacteria | 8785406 |
| 482 | 2928542614 | 2928536128 | Bacteria | 7657547 |
| 483 | 2981996778 | 2981990288 | Bacteria | 7590678 |
| 484 | 642418468 | 641736154 | Bacteria | 7689995 |
| 485 | 8018847004 | 8018845410 | Bacteria | 8933938 |
| 486 | 8020813657 | 8020807995 | Bacteria | 6801506 |
| 487 | 8020944966 | 8020938398 | Bacteria | 7472757 |
| 488 | 8020945541 | 8020945358 | Bacteria | 8467355 |
| 489 | 8020956997 | 8020953355 | Bacteria | 7439080 |
| 490 | 8021122144 | 8021120328 | Bacteria | 8782274 |
| 491 | 8039102702 | 8039098773 | Bacteria | 6602928 |
| 492 | 8040172765 | 8040167225 | Bacteria | 6542727 |
| 493 | 8040173764 | 8040173305 | Bacteria | 6827067 |
| 494 | Ga0496105_0236916 | |||
| 495 | JGI24740J21852_10024741 | |||
| 496 | JGI24735J21928_10014670 | |||
| 497 | rootH1_10027341 | |||
| 498 | Ga0055527_1001098 | |||
| 499 | Ga0055542_1002480 | |||
| 500 | Ga0055529_1001459 | |||
| 501 | Ga0055528_1001201 | |||
| 502 | Ga0055541_1009042 | |||
| 503 | Ga0058692_1015196 | |||
| 504 | Ga0065712_10007940 | |||
| 505 | Ga0070658_10055142 | |||
| 506 | Ga0070670_100037241 | |||
| 507 | Ga0070677_10005223 | |||
| 508 | Ga0068869_100028115 | |||
| 509 | Ga0068869_100079986 | |||
| 510 | Ga0070666_10102639 | |||
| 511 | Ga0070666_10366611 | |||
| 512 | Ga0068868_100086829 | |||
| 513 | Ga0068868_100119648 | |||
| 514 | Ga0068868_100133257 | |||
| 515 | Ga0068868_100312833 | |||
| 516 | Ga0070660_100000046 | |||
| 517 | Ga0070689_100060566 | |||
| 518 | Ga0070691_10049535 | |||
| 519 | Ga0070687_100072846 | |||
| 520 | Ga0070692_10174851 | |||
| 521 | Ga0070668_100024741 | |||
| 522 | Ga0070675_100129963 | |||
| 523 | Ga0070674_100410554 | |||
| 524 | Ga0070688_100067852 | |||
| 525 | Ga0070659_100000137 | |||
| 526 | Ga0070667_100063285 | |||
| 527 | Ga0070714_100005890 | |||
| 528 | Ga0070705_100038820 | |||
| 529 | Ga0070700_100005116 | |||
| 530 | Ga0070694_100029123 | |||
| 531 | Ga0070694_100037669 | |||
| 532 | Ga0070708_100384757 | |||
| 533 | Ga0070663_100001427 | |||
| 534 | Ga0070678_100008111 | |||
| 535 | Ga0070678_100098663 | |||
| 536 | Ga0070662_100007689 | |||
| 537 | Ga0070662_100046290 | |||
| 538 | Ga0070681_10006689 | |||
| 539 | Ga0070681_10006857 | |||
| 540 | Ga0070681_10232919 | |||
| 541 | Ga0068867_100195640 | |||
| 542 | Ga0070706_100303208 | |||
| 543 | Ga0070707_100016314 | |||
| 544 | Ga0070699_100120196 | |||
| 545 | Ga0070697_100096085 | |||
| 546 | Ga0068853_100041483 | |||
| 547 | Ga0070672_100026599 | |||
| 548 | Ga0070672_100354552 | |||
| 549 | Ga0070695_100218565 | |||
| 550 | Ga0070696_100000392 | |||
| 551 | Ga0070696_100177919 | |||
| 552 | Ga0070665_100025061 | |||
| 553 | Ga0070704_100008150 | |||
| 554 | Ga0070704_100029116 | |||
| 555 | Ga0070704_100048797 | |||
| 556 | Ga0068855_100124279 | |||
| 557 | Ga0068855_100133240 | |||
| 558 | Ga0068855_100134113 | |||
| 559 | Ga0070664_100006972 | |||
| 560 | Ga0068857_100067605 | |||
| 561 | Ga0068854_100069230 | |||
| 562 | Ga0068852_100011917 | |||
| 563 | Ga0068852_100421879 | |||
| 564 | Ga0068859_100458203 | |||
| 565 | Ga0068864_100105097 | |||
| 566 | Ga0068866_10006618 | |||
| 567 | Ga0068861_100048896 | |||
| 568 | Ga0068851_10017524 | |||
| 569 | Ga0068870_10031022 | |||
| 570 | Ga0068870_10038295 | |||
| 571 | Ga0068863_100211346 | |||
| 572 | Ga0068858_100430768 | |||
| 573 | Ga0068860_100056721 | |||
| 574 | Ga0068860_100174635 | |||
| 575 | Ga0068860_100453029 | |||
| 576 | Ga0068862_100056646 | |||
| 577 | Ga0097621_100015777 | |||
| 578 | Ga0068871_100037578 | |||
| 579 | Ga0068871_100243878 | |||
| 580 | Ga0075428_100000521 | |||
| 581 | Ga0075430_100225192 | |||
| 582 | Ga0075434_100103676 | |||
| 583 | Ga0075429_100020657 | |||
| 584 | Ga0075429_100033574 | |||
| 585 | Ga0068865_100015250 | |||
| 586 | Ga0068865_100042743 | |||
| 587 | Ga0075436_100064759 | |||
| 588 | Ga0097620_100458277 | |||
| 589 | Ga0099795_10005599 | |||
| 590 | Ga0105250_10015742 | |||
| 591 | Ga0105240_10026104 | |||
| 592 | Ga0105240_10030439 | |||
| 593 | Ga0105240_10054014 | |||
| 594 | Ga0105240_10290029 | |||
| 595 | Ga0111539_10001172 | |||
| 596 | Ga0111539_10009312 | |||
| 597 | Ga0111539_10030266 | |||
| 598 | Ga0111539_10282558 | |||
| 599 | Ga0105245_10185012 | |||
| 600 | Ga0105247_10192616 | |||
| 601 | Ga0105243_10009687 | |||
| 602 | Ga0105241_10090874 | |||
| 603 | Ga0105241_10095198 | |||
| 604 | Ga0105242_10047633 | |||
| 605 | Ga0105242_10171044 | |||
| 606 | Ga0105248_10026883 | |||
| 607 | Ga0105238_10004384 | |||
| 608 | Ga0099796_10013535 | |||
| 609 | Ga0105239_10029223 | |||
| 610 | Ga0157370_10008713 | |||
| 611 | Ga0157374_10001207 | |||
| 612 | Ga0157374_10029174 | |||
| 613 | Ga0157374_10090792 | |||
| 614 | Ga0157378_10029477 | |||
| 615 | Ga0157378_10052531 | |||
| 616 | Ga0157378_10385666 | |||
| 617 | Ga0163162_10067895 | |||
| 618 | Ga0163162_10086769 | |||
| 619 | Ga0157375_10016421 | |||
| 620 | Ga0157375_10135495 | |||
| 621 | Ga0163163_10008865 | |||
| 622 | Ga0157380_10568800 | |||
| 623 | Ga0157377_10027064 | |||
| 624 | Ga0157376_10033893 | |||
| 625 | Ga0157376_10045702 | |||
| 626 | Ga0157376_10202493 | |||
| 627 | Ga0213872_10001354 | |||
| 628 | Ga0213872_10002022 | |||
| 629 | Ga0213872_10012179 | |||
| 630 | Ga0209566_102185 | |||
| 631 | Ga0209672_100014 | |||
| 632 | Ga0209672_100023 | |||
| 633 | Ga0209147_100127 | |||
| 634 | Ga0209147_100171 | |||
| 635 | Ga0209147_100586 | |||
| 636 | Ga0209258_100134 | |||
| 637 | Ga0209258_100183 | |||
| 638 | Ga0209148_1000035 | |||
| 639 | Ga0209759_1003294 | |||
| 640 | Ga0209455_1000072 | |||
| 641 | Ga0209673_1000140 | |||
| 642 | Ga0209564_1004595 | |||
| 643 | Ga0207656_10010393 | |||
| 644 | Ga0207696_1025786 | |||
| 645 | Ga0207642_10004347 | |||
| 646 | Ga0207688_10004916 | |||
| 647 | Ga0207647_10002161 | |||
| 648 | Ga0207645_10042327 | |||
| 649 | Ga0207645_10179902 | |||
| 650 | Ga0207643_10004473 | |||
| 651 | Ga0207643_10027142 | |||
| 652 | Ga0207707_10067332 | |||
| 653 | Ga0207695_10002788 | |||
| 654 | Ga0207695_10050102 | |||
| 655 | Ga0207671_10010223 | |||
| 656 | Ga0207662_10017037 | |||
| 657 | Ga0207662_10096097 | |||
| 658 | Ga0207657_10004086 | |||
| 659 | Ga0207649_10035897 | |||
| 660 | Ga0207646_10042955 | |||
| 661 | Ga0207694_10006398 | |||
| 662 | Ga0207687_10105593 | |||
| 663 | Ga0207687_10466926 | |||
| 664 | Ga0207690_10000102 | |||
| 665 | Ga0207690_10063437 | |||
| 666 | Ga0207706_10002958 | |||
| 667 | Ga0207670_10227457 | |||
| 668 | Ga0207704_10032607 | |||
| 669 | Ga0207704_10032808 | |||
| 670 | Ga0207691_10038607 | |||
| 671 | Ga0207691_10062425 | |||
| 672 | Ga0207691_10137363 | |||
| 673 | Ga0207711_10162064 | |||
| 674 | Ga0207689_10003547 | |||
| 675 | Ga0207689_10052331 | |||
| 676 | Ga0207689_10094838 | |||
| 677 | Ga0207679_10032964 | |||
| 678 | Ga0207679_10197895 | |||
| 679 | Ga0207667_10051532 | |||
| 680 | Ga0207667_10213808 | |||
| 681 | Ga0207667_10257978 | |||
| 682 | Ga0207651_10083744 | |||
| 683 | Ga0207712_10219507 | |||
| 684 | Ga0207677_10056852 | |||
| 685 | Ga0207677_10216660 | |||
| 686 | Ga0207677_10361695 | |||
| 687 | Ga0207703_10053617 | |||
| 688 | Ga0207703_10225711 | |||
| 689 | Ga0207639_10092193 | |||
| 690 | Ga0207678_10004107 | |||
| 691 | Ga0207708_10003125 | |||
| 692 | Ga0207708_10367565 | |||
| 693 | Ga0207702_10190783 | |||
| 694 | Ga0207641_10121714 | |||
| 695 | Ga0207641_10146996 | |||
| 696 | Ga0207641_10185910 | |||
| 697 | Ga0207648_10038583 | |||
| 698 | Ga0207648_10059767 | |||
| 699 | Ga0207648_10249234 | |||
| 700 | Ga0207676_10062641 | |||
| 701 | Ga0207674_10081698 | |||
| 702 | Ga0207674_10198835 | |||
| 703 | Ga0207675_100009234 | |||
| 704 | Ga0207675_100039257 | |||
| 705 | Ga0207683_10022139 | |||
| 706 | Ga0207683_10044401 | |||
| 707 | Ga0207683_10249697 | |||
| 708 | Ga0207698_10013997 | |||
| 709 | Ga0207698_10072659 | |||
| 710 | Ga0209371_1000079 | |||
| 711 | Ga0209967_1003804 | |||
| 712 | Ga0209981_1006007 | |||
| 713 | Ga0209999_1005054 | |||
| 714 | Ga0209974_10020186 | |||
| 715 | Ga0207428_10000830 | |||
| 716 | Ga0207428_10034099 | |||
| 717 | Ga0207428_10345274 | |||
| 718 | Ga0268265_10033116 | |||
| 719 | Ga0268264_10064795 | |||
| 720 | Ga0268264_10413163 | |||
| 721 | Ga0265323_10002607 | |||
| 722 | Ga0265336_10003222 | |||
| 723 | Ga0265338_10079698 | |||
| 724 | Ga0265324_10000034 | |||
| 725 | Ga0265324_10000928 | |||
| 726 | Ga0265324_10008351 | |||
| 727 | Ga0268256_1000090 | |||
| 728 | Ga0265332_10019855 | |||
| 729 | Ga0265328_10002316 | |||
| 730 | Ga0265328_10005022 | |||
| 731 | Ga0265328_10025725 | |||
| 732 | Ga0265328_10044916 | |||
| 733 | Ga0265325_10000220 | |||
| 734 | Ga0265325_10006034 | |||
| 735 | Ga0265331_10000115 | |||
| 736 | Ga0265331_10001043 | |||
| 737 | Ga0265331_10002725 | |||
| 738 | Ga0265331_10016983 | |||
| 739 | Ga0265331_10019845 | |||
| 740 | Ga0265331_10020051 | |||
| 741 | Ga0265331_10044009 | |||
| 742 | Ga0265327_10000045 | |||
| 743 | Ga0265327_10000217 | |||
| 744 | Ga0265327_10000261 | |||
| 745 | Ga0265327_10000439 | |||
| 746 | Ga0265327_10000645 | |||
| 747 | Ga0265327_10021590 | |||
| 748 | Ga0265327_10026412 | |||
| 749 | Ga0265327_10084885 | |||
| 750 | Ga0265316_10012725 | |||
| 751 | Ga0265316_10068144 | |||
| 752 | Ga0265316_10133561 | |||
| 753 | Ga0265316_10151206 | |||
| 754 | Ga0307509_10000053 | |||
| 755 | Ga0307408_100320233 | |||
| 756 | Ga0265314_10000384 | |||
| 757 | Ga0265314_10006581 | |||
| 758 | Ga0265314_10057783 | |||
| 759 | Ga0265342_10006157 | |||
| 760 | Ga0307413_10128704 | |||
| 761 | Ga0307416_100213150 | |||
| 762 | Ga0307416_100516344 | |||
| 763 | Ga0307411_10011940 | |||
| 764 | Ga0373934_0010374 | |||
| 765 | Ga0373952_0000121 | |||
| 766 | Ga0373936_0009042 | |||
| 767 | Ga0373945_0040910 | |||
| 768 | Ga0373953_0083098 | |||
| 769 | Ga0373954_0001060 | |||
| 770 | Ga0373954_0005524 | |||
| 771 | Ga0373954_0177501 | |||
| 772 | Ga0373956_0000137 | |||
| 773 | Ga0373957_0000904 | |||
| 774 | Ga0373957_0040822 | |||
| 775 | Ga0373943_0023398 | |||
| 776 | Ga0373943_0192040 | |||
| 777 | Ga0373955_0074239 | |||
| 778 | Ga0373955_0074282 | |||
| 779 | Ga0373931_0152746 | |||
| 780 | Ga0373931_0174842 | |||
| 781 | Ga0373935_0017948 | |||
| 782 | Ga0373927_0007684 | |||
| 783 | Ga0373927_0179325 | |||
| 784 | Ga0373933_0002078 | |||
| 785 | Ga0373933_0193864 | |||
| 786 | Ga0373937_0001819 | |||
| 787 | Ga0373937_0042715 | |||
| 788 | Ga0373937_0148766 | |||
| 789 | Ga0373937_0200746 | |||
| 790 | Ga0395900_0344898 | |||
| 791 | Ga0436365_1065712 | |||
| 792 | Ga0436361_0138833 | |||
| 793 | Ga0436361_0842412 | |||
| 794 | Ga0451577_0000002 | |||
| 795 | Ga0451577_0002370 | |||
| 796 | Ga0451577_0043759 | |||
| 797 | Ga0451577_0070307 | |||
| 798 | Ga0451577_0502696 | |||
| 799 | Ga0453683_0000003 | |||
| 800 | Ga0453684_0000002 | |||
| 801 | Ga0453684_0000075 | |||
| 802 | Ga0453684_0008235 | |||
| 803 | Ga0453684_0009433 | |||
| 804 | Ga0453684_0071533 | |||
| 805 | Ga0453684_0107757 | |||
| 806 | Ga0453684_0170593 | |||
| 807 | Ga0466959_0080551 | |||
| 808 | Ga0451576_0000004 | |||
| 809 | Ga0451576_0000013 | |||
| 810 | Ga0451576_0000765 | |||
| 811 | Ga0451576_0001449 | |||
| 812 | Ga0451576_0001549 | |||
| 813 | Ga0451576_0001661 | |||
| 814 | Ga0451576_0001796 | |||
| 815 | Ga0451576_0011136 | |||
| 816 | Ga0451576_0035936 | |||
| 817 | Ga0451576_0038429 | |||
| 818 | Ga0451576_0226101 | |||
| 819 | Ga0495592_0095904 | |||
| 820 | Ga0495592_0106199 | |||
| 821 | Ga0495651_0000330 | |||
| 822 | Ga0495651_0042723 | |||
| 823 | Ga0495653_0048944 | |||
| 824 | Ga0495580_0067776 | |||
| 825 | Ga0495580_0230450 | |||
| 826 | Ga0495582_0029222 | |||
| 827 | Ga0495662_0006147 | |||
| 828 | Ga0495608_0017936 | |||
| 829 | Ga0495618_0138511 | |||
| 830 | Ga0495628_0000779 | |||
| 831 | Ga0495628_0013635 | |||
| 832 | Ga0495628_0065308 | |||
| 833 | Ga0495630_0098410 | |||
| 834 | Ga0495630_0248378 | |||
| 835 | Ga0495666_0058977 | |||
| 836 | Ga0495642_0032301 | |||
| 837 | Ga0495652_0078474 | |||
| 838 | Ga0495665_0154560 | |||
| 839 | Ga0495640_0161472 | |||
| 840 | Ga0495598_0030752 | |||
| 841 | Ga0495645_0000769 | |||
| 842 | Ga0495633_0063112 | |||
| 843 | Ga0495667_0028228 | |||
| 844 | Ga0495659_0100818 | |||
| 845 | Ga0495657_0015591 | |||
| 846 | Ga0495599_0000736 | |||
| 847 | Ga0495599_0128334 | |||
| 848 | Ga0495647_0035709 | |||
| 849 | Ga0495658_0081162 | |||
| 850 | Ga0495669_0071196 | |||
| 851 | Ga0495613_0019047 | |||
| 852 | Ga0495624_0128779 | |||
| 853 | Ga0495604_0126662 | |||
| 854 | Ga0495636_0063365 | |||
| 855 | Ga0495680_0237208 | |||
| 856 | Ga0495684_0044018 | |||
| 857 | Ga0496108_0038992 | |||
| 858 | Ga0496108_0275457 | |||
| 859 | Ga0496109_0186270 | |||
| 860 | Ga0496109_0282868 | |||
| 861 | Ga0496110_0100682 | |||
| 862 | Ga0496111_0137216 | |||
| 863 | Ga0496114_0000506 | |||
| 864 | Ga0496114_0031437 | |||
| 865 | Ga0496114_0136071 | |||
| 866 | Ga0496115_0406404 | |||
| 867 | Ga0501290_004752 | |||
| 868 | Ga0501031_0064132 | |||
| 869 | Ga0501031_0130239 | |||
| 870 | Ga0501031_0161738 | |||
| 871 | Ga0501032_0000195 | |||
| 872 | Ga0501032_0007574 | |||
| 873 | Ga0501032_0020636 | |||
| 874 | Ga0501033_0000769 | |||
| 875 | Ga0501033_0030572 | |||
| 876 | Ga0501033_0031705 | |||
| 877 | Ga0501034_0061730 | |||
| 878 | Ga0501034_0079912 | |||
| 879 | Ga0501036_0018739 | |||
| 880 | Ga0501036_0032140 | |||
| 881 | Ga0501036_0145441 | |||
| 882 | Ga0501037_0016853 | |||
| 883 | Ga0501038_0004407 | |||
| 884 | Ga0501038_0009495 | |||
| 885 | Ga0501038_0016210 | |||
| 886 | Ga0501038_0019172 | |||
| 887 | Ga0501038_0115195 | |||
| 888 | Ga0501039_0007196 | |||
| 889 | Ga0501039_0027909 | |||
| 890 | Ga0501039_0037543 | |||
| 891 | Ga0501040_0008296 | |||
| 892 | Ga0501041_0263653 | |||
| 893 | Ga0501042_0011071 | |||
| 894 | Ga0501043_0013190 | |||
| 895 | Ga0501043_0036608 | |||
| 896 | Ga0501043_0052412 | |||
| 897 | Ga0501043_0150495 | |||
| 898 | Ga0501046_0002569 | |||
| 899 | Ga0501046_0014062 | |||
| 900 | Ga0501047_0009664 | |||
| 901 | Ga0501048_0006214 | |||
| 902 | Ga0501068_0000062 | |||
| 903 | Ga0501068_0001455 | |||
| 904 | Ga0501068_0089189 | |||
| 905 | Ga0501068_0226307 | |||
| 906 | Ga0501069_0018380 | |||
| 907 | Ga0501070_0001800 | |||
| 908 | Ga0501070_0015939 | |||
| 909 | Ga0501070_0027425 | |||
| 910 | Ga0501071_0007107 | |||
| 911 | Ga0501071_0027203 | |||
| 912 | Ga0501073_0001234 | |||
| 913 | Ga0501073_0030581 | |||
| 914 | Ga0501073_0039353 | |||
| 915 | Ga0501074_0031724 | |||
| 916 | Ga0501075_0002095 | |||
| 917 | Ga0501075_0061831 | |||
| 918 | Ga0501075_0064479 | |||
| 919 | Ga0501076_0000797 | |||
| 920 | Ga0501077_0030866 | |||
| 921 | Ga0501077_0057642 | |||
| 922 | Ga0501079_0007373 | |||
| 923 | Ga0501080_0011759 | |||
| 924 | Ga0501080_0018353 | |||
| 925 | Ga0501080_0028390 | |||
| 926 | Ga0501080_0319370 | |||
| 927 | Ga0501081_0005835 | |||
| 928 | Ga0501081_0072930 | |||
| 929 | Ga0501083_0038393 | |||
| 930 | Ga0501035_0000827 | |||
| 931 | Ga0501035_0055517 | |||
| 932 | Ga0501044_0000248 | |||
| 933 | Ga0501044_0004061 | |||
| 934 | Ga0501045_0001453 | |||
| 935 | Ga0501045_0013862 | |||
| 936 | nmdc:mga09592_17028_c1 | |||
| 937 | nmdc:mga08y16_175837_c1 | |||
| 938 | nmdc:mga08y16_4227_c1 | |||
| 939 | nmdc:mga08y16_424968_c1 | |||
| 940 | nmdc:mga0n895_128791_c1 | |||
| 941 | nmdc:mga08x19_132396_c1 | |||
| 942 | Ga0495601_0000433 | |||
| 943 | Ga0495595_0002021 | |||
| 944 | Ga0495619_0174566 | |||
| 945 | Ga0500622_0000001 | |||
| 946 | Ga0501084_0017520 | |||
| 947 | Ga0590071_004702 | |||
| 948 | Ga0590077_010593 | |||
| 949 | Ga0501082_0001624 | |||
| 950 | Ga0501082_0099832 | |||
| 951 | Ga0501082_0154596 | |||
| 952 | Ga0530510_0002600 | |||
| 953 | 2501080587 | |||
| 954 | 2511086960 | |||
| 955 | 2519459128 | |||
| 956 | 2585290290 | |||
| 957 | 2599736730 | |||
| 958 | 2599744803 | |||
| 959 | 2600205833 | |||
| 960 | 2676742932 | |||
| 961 | 2817261413 | |||
| 962 | 2817279099 | |||
| 963 | 2817456296 | |||
| 964 | 2819631214 | |||
| 965 | 2856294276 | |||
| 966 | 2857367533 | |||
| 967 | 2863427432 | |||
| 968 | 2870070904 | |||
| 969 | 2891636741 | |||
| 970 | 2904570050 | |||
| 971 | 2904576039 | |||
| 972 | 2928162939 | |||
| 973 | 2928169601 | |||
| 974 | 2928171667 | |||
| 975 | 2928542614 | |||
| 976 | 2981996778 | |||
| 977 | 642418468 | |||
| 978 | 8018847004 | |||
| 979 | 8020813657 | |||
| 980 | 8020944966 | |||
| 981 | 8020945541 | |||
| 982 | 8020956997 | |||
| 983 | 8021122144 | |||
| 984 | 8039102702 | |||
| 985 | 8040172765 | |||
| 986 | 8040173764 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f9y-assembly1.cif.gz_A-2 | the crystal structure of the carboxyltransferase subunit of acc from escherichia coli | 0.901 | 4 | 314 |
| 2f9i-assembly1.cif.gz_C | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.8931 | 5 | 318 |
| 2f9y-assembly1.cif.gz_A-2 | the crystal structure of the carboxyltransferase subunit of acc from escherichia coli | 0.8926 | 4 | 314 |
| 5kdr-assembly1.cif.gz_A-2 | the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. | 0.8922 | 6 | 318 |
| 2f9i-assembly1.cif.gz_C | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.8903 | 5 | 318 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXM7_1_314_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9043 | 5 | 318 | 3.90.226.10 |
| af_Q2FXM7_1_314_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9016 | 5 | 318 | 3.90.226.10 |
| af_P9WQH9_238_492_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8857 | 54 | 309 | 3.90.226.10 |
| af_P9WQH9_238_492_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8599 | 54 | 309 | 3.90.226.10 |
| 5iniB02 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.8027 | 69 | 296 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-B2IKU6-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9356 | 3 | 312 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A8IHS4-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9328 | 3 | 312 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A9IZR9-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9328 | 3 | 314 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-H6SIV5-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9322 | 1 | 314 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A1H8JCB9-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9312 | 3 | 311 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |