F454483

General Info

Members Datasets Scaffolds Average Seq Length
493 309 986 322

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0236916|Ga0496105_0236916_57_1121
Length 354
Sequence VSFSAVSGFSRRSLCICFEQAHARRFGGGLDPMKTTFLEFEQPIAELEAKIEELRFVQDDSALDISEEIARLQKKSQGLTKEVYSKLSAWQISQVARHPQRPYALDYMQNLFSGFEELHGDRAFGDDAAIIGGLARFNEQSVMVIGHQKGRDTKDKIYRNFGMPKPEGYRKALRLMKLAEKFGVPVFTFIDTPGAYPGVGAEERGQSEAIGRNLYVMAELRVPVVCTIIGEGGSGGALAIAVGDALLMLQYATYSVISPEGCASILWKSADFAAEAAETLGITATRLKTLGVIDKIVSEPVGGAHRDHDAMMQSLRKALQDAWRQLQGQSIDDLLRTRFERLMAYGKFKEVAAK

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
154 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
159 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
160 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
269 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
276 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
277 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
278 2519103095 Burkholderia sp. KJ006 Isolate Nodule
279 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
280 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
281 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
282 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
283 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
284 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
285 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
286 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
287 2818991452 Burkholderia cepacia 561 Isolate Unclassified
288 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
289 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
290 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
291 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
292 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
293 2904564687 Burkholderia sp. 571 Isolate Unclassified
294 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
295 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
296 2928163908 Burkholderia sp. 567 Isolate Unclassified
297 2928170801 Burkholderia sp. 572 Isolate Unclassified
298 2928536128 Burkholderia sola 565 Isolate Unclassified
299 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
300 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
301 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
302 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
303 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
304 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
305 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
306 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
307 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
308 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
309 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.1
Metatranscriptomes 0
Isolates 6.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.65
Nodule 0.2
Rhizoplane 3.04
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0236916 3300048908 Bacteria 1482
2 JGI24740J21852_10024741 3300001979 Bacteria 2033
3 JGI24735J21928_10014670 3300002067 Bacteria 2453
4 rootH1_10027341 3300003316 Bacteria 3341
5 Ga0055527_1001098 3300003760 Bacteria 6309
6 Ga0055542_1002480 3300003762 Bacteria 6031
7 Ga0055529_1001459 3300003763 Bacteria 7228
8 Ga0055528_1001201 3300003790 Bacteria 16658
9 Ga0055541_1009042 3300003841 Bacteria 1559
10 Ga0058692_1015196 3300003856 Bacteria 1743
11 Ga0065712_10007940 3300005290 Bacteria 3057
12 Ga0070658_10055142 3300005327 Bacteria 3229
13 Ga0070670_100037241 3300005331 Bacteria 4185
14 Ga0070677_10005223 3300005333 Bacteria 4272
15 Ga0068869_100028115 3300005334 Bacteria 3926
16 Ga0068869_100079986 3300005334 Bacteria 2437
17 Ga0070666_10102639 3300005335 Bacteria 1972
18 Ga0070666_10366611 3300005335 Bacteria 1032
19 Ga0068868_100086829 3300005338 Bacteria 2515
20 Ga0068868_100119648 3300005338 Bacteria 2147
21 Ga0068868_100133257 3300005338 Bacteria 2035
22 Ga0068868_100312833 3300005338 Bacteria 1336
23 Ga0070660_100000046 3300005339 Bacteria 70459
24 Ga0070689_100060566 3300005340 Bacteria 2943
25 Ga0070691_10049535 3300005341 Bacteria 2002
26 Ga0070687_100072846 3300005343 Bacteria 1850
27 Ga0070692_10174851 3300005345 Bacteria 1240
28 Ga0070668_100024741 3300005347 Bacteria 4551
29 Ga0070675_100129963 3300005354 Bacteria 2145
30 Ga0070674_100410554 3300005356 Bacteria 1109
31 Ga0070688_100067852 3300005365 Bacteria 2273
32 Ga0070659_100000137 3300005366 Bacteria 56527
33 Ga0070667_100063285 3300005367 Bacteria 3134
34 Ga0070714_100005890 3300005435 Bacteria 9406
35 Ga0070705_100038820 3300005440 Bacteria 2697
36 Ga0070700_100005116 3300005441 Bacteria 6921
37 Ga0070694_100029123 3300005444 Bacteria 3601
38 Ga0070694_100037669 3300005444 Bacteria 3208
39 Ga0070708_100384757 3300005445 Bacteria 1323
40 Ga0070663_100001427 3300005455 Bacteria 13081
41 Ga0070678_100008111 3300005456 Bacteria 6274
42 Ga0070678_100098663 3300005456 Bacteria 2259
43 Ga0070662_100007689 3300005457 Bacteria 6992
44 Ga0070662_100046290 3300005457 Bacteria 3126
45 Ga0070681_10006689 3300005458 Bacteria 11214
46 Ga0070681_10006857 3300005458 Bacteria 11083
47 Ga0070681_10232919 3300005458 Bacteria 1756
48 Ga0068867_100195640 3300005459 Bacteria 1616
49 Ga0070706_100303208 3300005467 Bacteria 1490
50 Ga0070707_100016314 3300005468 Bacteria 6972
51 Ga0070699_100120196 3300005518 Bacteria 2310
52 Ga0070697_100096085 3300005536 Bacteria 2458
53 Ga0068853_100041483 3300005539 Bacteria 3931
54 Ga0070672_100026599 3300005543 Bacteria 4307
55 Ga0070672_100354552 3300005543 Bacteria 1251
56 Ga0070695_100218565 3300005545 Bacteria 1372
57 Ga0070696_100000392 3300005546 Bacteria 27022
58 Ga0070696_100177919 3300005546 Bacteria 1576
59 Ga0070665_100025061 3300005548 Bacteria 6012
60 Ga0070704_100008150 3300005549 Bacteria 6266
61 Ga0070704_100029116 3300005549 Bacteria 3683
62 Ga0070704_100048797 3300005549 Bacteria 2965
63 Ga0068855_100124279 3300005563 Bacteria 2951
64 Ga0068855_100133240 3300005563 Bacteria 2836
65 Ga0068855_100134113 3300005563 Bacteria 2826
66 Ga0070664_100006972 3300005564 Bacteria 9111
67 Ga0068857_100067605 3300005577 Bacteria 3180
68 Ga0068854_100069230 3300005578 Bacteria 2575
69 Ga0068852_100011917 3300005616 Bacteria 6575
70 Ga0068852_100421879 3300005616 Bacteria 1316
71 Ga0068859_100458203 3300005617 Bacteria 1371
72 Ga0068864_100105097 3300005618 Bacteria 2509
73 Ga0068866_10006618 3300005718 Bacteria 4833
74 Ga0068861_100048896 3300005719 Bacteria 3199
75 Ga0068851_10017524 3300005834 Bacteria 3441
76 Ga0068870_10031022 3300005840 Bacteria 2705
77 Ga0068870_10038295 3300005840 Bacteria 2475
78 Ga0068863_100211346 3300005841 Bacteria 1868
79 Ga0068858_100430768 3300005842 Bacteria 1269
80 Ga0068860_100056721 3300005843 Bacteria 3723
81 Ga0068860_100174635 3300005843 Bacteria 2076
82 Ga0068860_100453029 3300005843 Bacteria 1276
83 Ga0068862_100056646 3300005844 Bacteria 3359
84 Ga0097621_100015777 3300006237 Bacteria 5694
85 Ga0068871_100037578 3300006358 Bacteria 3862
86 Ga0068871_100243878 3300006358 Bacteria 1563
87 Ga0075428_100000521 3300006844 Bacteria 39098
88 Ga0075430_100225192 3300006846 Bacteria 1555
89 Ga0075434_100103676 3300006871 Bacteria 2853
90 Ga0075429_100020657 3300006880 Bacteria 5716
91 Ga0075429_100033574 3300006880 Bacteria 4459
92 Ga0068865_100015250 3300006881 Bacteria 4898
93 Ga0068865_100042743 3300006881 Bacteria 3092
94 Ga0075436_100064759 3300006914 Bacteria 2527
95 Ga0097620_100458277 3300006931 Bacteria 1371
96 Ga0099795_10005599 3300007788 Bacteria 3358
97 Ga0105250_10015742 3300009092 Bacteria 3094
98 Ga0105240_10026104 3300009093 Bacteria 7669
99 Ga0105240_10030439 3300009093 Bacteria 7016
100 Ga0105240_10054014 3300009093 Bacteria 5037
101 Ga0105240_10290029 3300009093 Bacteria 1876
102 Ga0111539_10001172 3300009094 Bacteria 34757
103 Ga0111539_10009312 3300009094 Bacteria 12402
104 Ga0111539_10030266 3300009094 Bacteria 6582
105 Ga0111539_10282558 3300009094 Bacteria 1931
106 Ga0105245_10185012 3300009098 Bacteria 1993
107 Ga0105247_10192616 3300009101 Bacteria 1366
108 Ga0105243_10009687 3300009148 Bacteria 7336
109 Ga0105241_10090874 3300009174 Bacteria 2408
110 Ga0105241_10095198 3300009174 Bacteria 2357
111 Ga0105242_10047633 3300009176 Bacteria 3481
112 Ga0105242_10171044 3300009176 Bacteria 1910
113 Ga0105248_10026883 3300009177 Bacteria 6400
114 Ga0105238_10004384 3300009551 Bacteria 14000
115 Ga0099796_10013535 3300010159 Bacteria 2333
116 Ga0105239_10029223 3300010375 Bacteria 6061
117 Ga0157370_10008713 3300013104 Bacteria 10913
118 Ga0157374_10001207 3300013296 Bacteria 22110
119 Ga0157374_10029174 3300013296 Bacteria 4992
120 Ga0157374_10090792 3300013296 Bacteria 2912
121 Ga0157378_10029477 3300013297 Bacteria 4845
122 Ga0157378_10052531 3300013297 Bacteria 3626
123 Ga0157378_10385666 3300013297 Bacteria 1377
124 Ga0163162_10067895 3300013306 Bacteria 3616
125 Ga0163162_10086769 3300013306 Bacteria 3207
126 Ga0157375_10016421 3300013308 Bacteria 6652
127 Ga0157375_10135495 3300013308 Bacteria 2586
128 Ga0163163_10008865 3300014325 Bacteria 8956
129 Ga0157380_10568800 3300014326 Bacteria 1115
130 Ga0157377_10027064 3300014745 Bacteria 3075
131 Ga0157376_10033893 3300014969 Bacteria 4117
132 Ga0157376_10045702 3300014969 Bacteria 3607
133 Ga0157376_10202493 3300014969 Bacteria 1827
134 Ga0213872_10001354 3300021361 Bacteria 16160
135 Ga0213872_10002022 3300021361 Bacteria 12319
136 Ga0213872_10012179 3300021361 Bacteria 4055
137 Ga0209566_102185 3300025225 Bacteria 3906
138 Ga0209672_100014 3300025228 Bacteria 546252
139 Ga0209672_100023 3300025228 Bacteria 371758
140 Ga0209147_100127 3300025229 Bacteria 123986
141 Ga0209147_100171 3300025229 Bacteria 86726
142 Ga0209147_100586 3300025229 Bacteria 20183
143 Ga0209258_100134 3300025242 Bacteria 174683
144 Ga0209258_100183 3300025242 Bacteria 136466
145 Ga0209148_1000035 3300025254 Bacteria 548413
146 Ga0209759_1003294 3300025256 Bacteria 6505
147 Ga0209455_1000072 3300025272 Bacteria 293074
148 Ga0209673_1000140 3300025273 Bacteria 157575
149 Ga0209564_1004595 3300025295 Bacteria 8335
150 Ga0207656_10010393 3300025321 Bacteria 3486
151 Ga0207696_1025786 3300025711 Bacteria 1827
152 Ga0207642_10004347 3300025899 Bacteria 4569
153 Ga0207688_10004916 3300025901 Bacteria 7275
154 Ga0207647_10002161 3300025904 Bacteria 14993
155 Ga0207645_10042327 3300025907 Bacteria 2914
156 Ga0207645_10179902 3300025907 Bacteria 1387
157 Ga0207643_10004473 3300025908 Bacteria 7515
158 Ga0207643_10027142 3300025908 Bacteria 3173
159 Ga0207707_10067332 3300025912 Bacteria 3119
160 Ga0207695_10002788 3300025913 Bacteria 25437
161 Ga0207695_10050102 3300025913 Bacteria 4396
162 Ga0207671_10010223 3300025914 Bacteria 7767
163 Ga0207662_10017037 3300025918 Bacteria 4105
164 Ga0207662_10096097 3300025918 Bacteria 1830
165 Ga0207657_10004086 3300025919 Bacteria 15489
166 Ga0207649_10035897 3300025920 Bacteria 2982
167 Ga0207646_10042955 3300025922 Bacteria 4061
168 Ga0207694_10006398 3300025924 Bacteria 8972
169 Ga0207687_10105593 3300025927 Bacteria 2081
170 Ga0207687_10466926 3300025927 Bacteria 1049
171 Ga0207690_10000102 3300025932 Bacteria 69683
172 Ga0207690_10063437 3300025932 Bacteria 2519
173 Ga0207706_10002958 3300025933 Bacteria 16402
174 Ga0207670_10227457 3300025936 Bacteria 1431
175 Ga0207704_10032607 3300025938 Bacteria 2950
176 Ga0207704_10032808 3300025938 Bacteria 2944
177 Ga0207691_10038607 3300025940 Bacteria 4419
178 Ga0207691_10062425 3300025940 Bacteria 3381
179 Ga0207691_10137363 3300025940 Bacteria 2155
180 Ga0207711_10162064 3300025941 Bacteria 2025
181 Ga0207689_10003547 3300025942 Bacteria 14265
182 Ga0207689_10052331 3300025942 Bacteria 3365
183 Ga0207689_10094838 3300025942 Bacteria 2451
184 Ga0207679_10032964 3300025945 Bacteria 3642
185 Ga0207679_10197895 3300025945 Bacteria 1676
186 Ga0207667_10051532 3300025949 Bacteria 4339
187 Ga0207667_10213808 3300025949 Bacteria 1976
188 Ga0207667_10257978 3300025949 Bacteria 1783
189 Ga0207651_10083744 3300025960 Bacteria 2307
190 Ga0207712_10219507 3300025961 Bacteria 1519
191 Ga0207677_10056852 3300026023 Bacteria 2683
192 Ga0207677_10216660 3300026023 Bacteria 1533
193 Ga0207677_10361695 3300026023 Bacteria 1219
194 Ga0207703_10053617 3300026035 Bacteria 3278
195 Ga0207703_10225711 3300026035 Bacteria 1677
196 Ga0207639_10092193 3300026041 Bacteria 2428
197 Ga0207678_10004107 3300026067 Bacteria 13091
198 Ga0207708_10003125 3300026075 Bacteria 12190
199 Ga0207708_10367565 3300026075 Bacteria 1183
200 Ga0207702_10190783 3300026078 Bacteria 1893
201 Ga0207641_10121714 3300026088 Bacteria 2329
202 Ga0207641_10146996 3300026088 Bacteria 2132
203 Ga0207641_10185910 3300026088 Bacteria 1906
204 Ga0207648_10038583 3300026089 Bacteria 4203
205 Ga0207648_10059767 3300026089 Bacteria 3324
206 Ga0207648_10249234 3300026089 Bacteria 1583
207 Ga0207676_10062641 3300026095 Bacteria 2951
208 Ga0207674_10081698 3300026116 Bacteria 3234
209 Ga0207674_10198835 3300026116 Bacteria 1954
210 Ga0207675_100009234 3300026118 Bacteria 9248
211 Ga0207675_100039257 3300026118 Bacteria 4419
212 Ga0207683_10022139 3300026121 Bacteria 5453
213 Ga0207683_10044401 3300026121 Bacteria 3885
214 Ga0207683_10249697 3300026121 Bacteria 1619
215 Ga0207698_10013997 3300026142 Bacteria 5315
216 Ga0207698_10072659 3300026142 Bacteria 2735
217 Ga0209371_1000079 3300027312 Bacteria 187621
218 Ga0209967_1003804 3300027364 Bacteria 1993
219 Ga0209981_1006007 3300027378 Bacteria 1621
220 Ga0209999_1005054 3300027543 Bacteria 2371
221 Ga0209974_10020186 3300027876 Bacteria 2209
222 Ga0207428_10000830 3300027907 Bacteria 34841
223 Ga0207428_10034099 3300027907 Bacteria 4174
224 Ga0207428_10345274 3300027907 Bacteria 1096
225 Ga0268265_10033116 3300028380 Bacteria 3754
226 Ga0268264_10064795 3300028381 Bacteria 3076
227 Ga0268264_10413163 3300028381 Bacteria 1300
228 Ga0265323_10002607 3300028653 Bacteria 8183
229 Ga0265336_10003222 3300028666 Bacteria 6473
230 Ga0265338_10079698 3300028800 Bacteria 2755
231 Ga0265324_10000034 3300029957 Bacteria 124255
232 Ga0265324_10000928 3300029957 Bacteria 18416
233 Ga0265324_10008351 3300029957 Bacteria 4117
234 Ga0268256_1000090 3300030500 Bacteria 153976
235 Ga0265332_10019855 3300031238 Bacteria 2966
236 Ga0265328_10002316 3300031239 Bacteria 8583
237 Ga0265328_10005022 3300031239 Bacteria 5701
238 Ga0265328_10025725 3300031239 Bacteria 2217
239 Ga0265328_10044916 3300031239 Bacteria 1625
240 Ga0265325_10000220 3300031241 Bacteria 40313
241 Ga0265325_10006034 3300031241 Bacteria 7411
242 Ga0265331_10000115 3300031250 Bacteria 105212
243 Ga0265331_10001043 3300031250 Bacteria 21599
244 Ga0265331_10002725 3300031250 Bacteria 11772
245 Ga0265331_10016983 3300031250 Bacteria 3807
246 Ga0265331_10019845 3300031250 Bacteria 3462
247 Ga0265331_10020051 3300031250 Bacteria 3439
248 Ga0265331_10044009 3300031250 Bacteria 2160
249 Ga0265327_10000045 3300031251 Bacteria 282880
250 Ga0265327_10000217 3300031251 Bacteria 117085
251 Ga0265327_10000261 3300031251 Bacteria 104627
252 Ga0265327_10000439 3300031251 Bacteria 75504
253 Ga0265327_10000645 3300031251 Bacteria 56357
254 Ga0265327_10021590 3300031251 Bacteria 3880
255 Ga0265327_10026412 3300031251 Bacteria 3363
256 Ga0265327_10084885 3300031251 Bacteria 1555
257 Ga0265316_10012725 3300031344 Bacteria 7522
258 Ga0265316_10068144 3300031344 Bacteria 2751
259 Ga0265316_10133561 3300031344 Bacteria 1868
260 Ga0265316_10151206 3300031344 Bacteria 1739
261 Ga0307509_10000053 3300031507 Bacteria 164364
262 Ga0307408_100320233 3300031548 Bacteria 1306
263 Ga0265314_10000384 3300031711 Bacteria 60231
264 Ga0265314_10006581 3300031711 Bacteria 10238
265 Ga0265314_10057783 3300031711 Bacteria 2661
266 Ga0265342_10006157 3300031712 Bacteria 8979
267 Ga0307413_10128704 3300031824 Bacteria 1729
268 Ga0307416_100213150 3300032002 Bacteria 1844
269 Ga0307416_100516344 3300032002 Bacteria 1262
270 Ga0307411_10011940 3300032005 Bacteria 4714
271 Ga0373934_0010374 3300035086 Bacteria 3496
272 Ga0373952_0000121 3300035092 Bacteria 10903
273 Ga0373936_0009042 3300035113 Bacteria 3759
274 Ga0373945_0040910 3300035116 Bacteria 1675
275 Ga0373953_0083098 3300035117 Bacteria 1333
276 Ga0373954_0001060 3300035118 Bacteria 10954
277 Ga0373954_0005524 3300035118 Bacteria 5470
278 Ga0373954_0177501 3300035118 Bacteria 1044
279 Ga0373956_0000137 3300035119 Bacteria 26180
280 Ga0373957_0000904 3300035120 Bacteria 7741
281 Ga0373957_0040822 3300035120 Bacteria 1745
282 Ga0373943_0023398 3300035170 Bacteria 2873
283 Ga0373943_0192040 3300035170 Bacteria 1127
284 Ga0373955_0074239 3300035172 Bacteria 1908
285 Ga0373955_0074282 3300035172 Bacteria 1907
286 Ga0373931_0152746 3300035691 Bacteria 1347
287 Ga0373931_0174842 3300035691 Bacteria 1268
288 Ga0373935_0017948 3300035692 Bacteria 4299
289 Ga0373927_0007684 3300035695 Bacteria 7296
290 Ga0373927_0179325 3300035695 Bacteria 1389
291 Ga0373933_0002078 3300035724 Bacteria 11494
292 Ga0373933_0193864 3300035724 Bacteria 1299
293 Ga0373937_0001819 3300036401 Bacteria 17904
294 Ga0373937_0042715 3300036401 Bacteria 4136
295 Ga0373937_0148766 3300036401 Bacteria 2193
296 Ga0373937_0200746 3300036401 Bacteria 1874
297 Ga0395900_0344898 3300037418 Bacteria 1464
298 Ga0436365_1065712 3300039437 Bacteria 2160
299 Ga0436361_0138833 3300039447 Bacteria 4030
300 Ga0436361_0842412 3300039447 Bacteria 17784
301 Ga0451577_0000002 3300042876 Bacteria 1731375
302 Ga0451577_0002370 3300042876 Bacteria 22606
303 Ga0451577_0043759 3300042876 Bacteria 4010
304 Ga0451577_0070307 3300042876 Bacteria 3122
305 Ga0451577_0502696 3300042876 Bacteria 1100
306 Ga0453683_0000003 3300044673 Bacteria 942572
307 Ga0453684_0000002 3300044712 Bacteria 1731375
308 Ga0453684_0000075 3300044712 Bacteria 437715
309 Ga0453684_0008235 3300044712 Bacteria 18793
310 Ga0453684_0009433 3300044712 Bacteria 17070
311 Ga0453684_0071533 3300044712 Bacteria 4385
312 Ga0453684_0107757 3300044712 Bacteria 3392
313 Ga0453684_0170593 3300044712 Bacteria 2564
314 Ga0466959_0080551 3300045049 Bacteria 2347
315 Ga0451576_0000004 3300045051 Bacteria 1312238
316 Ga0451576_0000013 3300045051 Bacteria 665120
317 Ga0451576_0000765 3300045051 Bacteria 63455
318 Ga0451576_0001449 3300045051 Bacteria 40328
319 Ga0451576_0001549 3300045051 Bacteria 38731
320 Ga0451576_0001661 3300045051 Bacteria 36936
321 Ga0451576_0001796 3300045051 Bacteria 35141
322 Ga0451576_0011136 3300045051 Bacteria 10258
323 Ga0451576_0035936 3300045051 Bacteria 5254
324 Ga0451576_0038429 3300045051 Bacteria 5065
325 Ga0451576_0226101 3300045051 Bacteria 1954
326 Ga0495592_0095904 3300046454 Bacteria 2120
327 Ga0495592_0106199 3300046454 Bacteria 1993
328 Ga0495651_0000330 3300046462 Bacteria 36818
329 Ga0495651_0042723 3300046462 Bacteria 3518
330 Ga0495653_0048944 3300046463 Bacteria 3259
331 Ga0495580_0067776 3300046472 Bacteria 2496
332 Ga0495580_0230450 3300046472 Bacteria 1272
333 Ga0495582_0029222 3300046473 Bacteria 3026
334 Ga0495662_0006147 3300046476 Bacteria 6002
335 Ga0495608_0017936 3300046511 Bacteria 4893
336 Ga0495618_0138511 3300046514 Bacteria 1556
337 Ga0495628_0000779 3300046516 Bacteria 29317
338 Ga0495628_0013635 3300046516 Bacteria 6830
339 Ga0495628_0065308 3300046516 Bacteria 2847
340 Ga0495630_0098410 3300046517 Bacteria 2212
341 Ga0495630_0248378 3300046517 Bacteria 1359
342 Ga0495666_0058977 3300046526 Bacteria 1835
343 Ga0495642_0032301 3300046528 Bacteria 2100
344 Ga0495652_0078474 3300046529 Bacteria 2733
345 Ga0495665_0154560 3300046531 Bacteria 1197
346 Ga0495640_0161472 3300046533 Bacteria 1435
347 Ga0495598_0030752 3300046537 Bacteria 1506
348 Ga0495645_0000769 3300046543 Bacteria 21928
349 Ga0495633_0063112 3300046558 Bacteria 1734
350 Ga0495667_0028228 3300046559 Bacteria 3777
351 Ga0495659_0100818 3300046664 Bacteria 1118
352 Ga0495657_0015591 3300046675 Bacteria 5555
353 Ga0495599_0000736 3300046678 Bacteria 18470
354 Ga0495599_0128334 3300046678 Bacteria 1575
355 Ga0495647_0035709 3300046681 Bacteria 1867
356 Ga0495658_0081162 3300046683 Bacteria 1904
357 Ga0495669_0071196 3300046684 Bacteria 1585
358 Ga0495613_0019047 3300046689 Bacteria 5115
359 Ga0495624_0128779 3300046690 Bacteria 1552
360 Ga0495604_0126662 3300047317 Bacteria 1840
361 Ga0495636_0063365 3300047318 Bacteria 1567
362 Ga0495680_0237208 3300047322 Bacteria 1296
363 Ga0495684_0044018 3300047471 Bacteria 3417
364 Ga0496108_0038992 3300048911 Bacteria 3960
365 Ga0496108_0275457 3300048911 Bacteria 1465
366 Ga0496109_0186270 3300048912 Bacteria 1950
367 Ga0496109_0282868 3300048912 Bacteria 1563
368 Ga0496110_0100682 3300048913 Bacteria 2590
369 Ga0496111_0137216 3300048914 Bacteria 1812
370 Ga0496114_0000506 3300048917 Bacteria 28521
371 Ga0496114_0031437 3300048917 Bacteria 4368
372 Ga0496114_0136071 3300048917 Bacteria 2125
373 Ga0496115_0406404 3300048918 Bacteria 1104
374 Ga0501290_004752 3300049513 Bacteria 1695
375 Ga0501031_0064132 3300049568 Bacteria 2392
376 Ga0501031_0130239 3300049568 Bacteria 1643
377 Ga0501031_0161738 3300049568 Bacteria 1463
378 Ga0501032_0000195 3300049569 Bacteria 50432
379 Ga0501032_0007574 3300049569 Bacteria 7928
380 Ga0501032_0020636 3300049569 Bacteria 4586
381 Ga0501033_0000769 3300049570 Bacteria 29459
382 Ga0501033_0030572 3300049570 Bacteria 4046
383 Ga0501033_0031705 3300049570 Bacteria 3969
384 Ga0501034_0061730 3300049571 Bacteria 3763
385 Ga0501034_0079912 3300049571 Bacteria 3274
386 Ga0501036_0018739 3300049572 Bacteria 5805
387 Ga0501036_0032140 3300049572 Bacteria 4433
388 Ga0501036_0145441 3300049572 Bacteria 1999
389 Ga0501037_0016853 3300049573 Bacteria 5375
390 Ga0501038_0004407 3300049574 Bacteria 13093
391 Ga0501038_0009495 3300049574 Bacteria 8926
392 Ga0501038_0016210 3300049574 Bacteria 6757
393 Ga0501038_0019172 3300049574 Bacteria 6170
394 Ga0501038_0115195 3300049574 Bacteria 2222
395 Ga0501039_0007196 3300049575 Bacteria 8479
396 Ga0501039_0027909 3300049575 Bacteria 4341
397 Ga0501039_0037543 3300049575 Bacteria 3739
398 Ga0501040_0008296 3300049576 Bacteria 6757
399 Ga0501041_0263653 3300049577 Bacteria 1083
400 Ga0501042_0011071 3300049578 Bacteria 6074
401 Ga0501043_0013190 3300049579 Bacteria 6464
402 Ga0501043_0036608 3300049579 Bacteria 3862
403 Ga0501043_0052412 3300049579 Bacteria 3204
404 Ga0501043_0150495 3300049579 Bacteria 1821
405 Ga0501046_0002569 3300049580 Bacteria 16990
406 Ga0501046_0014062 3300049580 Bacteria 6758
407 Ga0501047_0009664 3300049581 Bacteria 9116
408 Ga0501048_0006214 3300049582 Bacteria 9086
409 Ga0501068_0000062 3300049584 Bacteria 42494
410 Ga0501068_0001455 3300049584 Bacteria 12580
411 Ga0501068_0089189 3300049584 Bacteria 1901
412 Ga0501068_0226307 3300049584 Bacteria 1189
413 Ga0501069_0018380 3300049585 Bacteria 3772
414 Ga0501070_0001800 3300049586 Bacteria 18908
415 Ga0501070_0015939 3300049586 Bacteria 6318
416 Ga0501070_0027425 3300049586 Bacteria 4778
417 Ga0501071_0007107 3300049587 Bacteria 7316
418 Ga0501071_0027203 3300049587 Bacteria 4022
419 Ga0501073_0001234 3300049589 Bacteria 18672
420 Ga0501073_0030581 3300049589 Bacteria 3844
421 Ga0501073_0039353 3300049589 Bacteria 3350
422 Ga0501074_0031724 3300049590 Bacteria 3828
423 Ga0501075_0002095 3300049591 Bacteria 13189
424 Ga0501075_0061831 3300049591 Bacteria 2822
425 Ga0501075_0064479 3300049591 Bacteria 2763
426 Ga0501076_0000797 3300049592 Bacteria 20393
427 Ga0501077_0030866 3300049593 Bacteria 3411
428 Ga0501077_0057642 3300049593 Bacteria 2466
429 Ga0501079_0007373 3300049741 Bacteria 8318
430 Ga0501080_0011759 3300049742 Bacteria 8022
431 Ga0501080_0018353 3300049742 Bacteria 6474
432 Ga0501080_0028390 3300049742 Bacteria 5205
433 Ga0501080_0319370 3300049742 Bacteria 1406
434 Ga0501081_0005835 3300049743 Bacteria 7969
435 Ga0501081_0072930 3300049743 Bacteria 2394
436 Ga0501083_0038393 3300049744 Bacteria 3256
437 Ga0501035_0000827 3300049822 Bacteria 33027
438 Ga0501035_0055517 3300049822 Bacteria 3536
439 Ga0501044_0000248 3300049823 Bacteria 68598
440 Ga0501044_0004061 3300049823 Bacteria 16418
441 Ga0501045_0001453 3300049824 Bacteria 15744
442 Ga0501045_0013862 3300049824 Bacteria 5701
443 nmdc:mga09592_17028_c1 3300050508 Bacteria 5949
444 nmdc:mga08y16_175837_c1 3300050511 Bacteria 2223
445 nmdc:mga08y16_4227_c1 3300050511 Bacteria 14981
446 nmdc:mga08y16_424968_c1 3300050511 Bacteria 1358
447 nmdc:mga0n895_128791_c1 3300050512 Bacteria 2555
448 nmdc:mga08x19_132396_c1 3300050514 Bacteria 1678
449 Ga0495601_0000433 3300053077 Bacteria 21909
450 Ga0495595_0002021 3300053084 Bacteria 7877
451 Ga0495619_0174566 3300053085 Bacteria 1486
452 Ga0500622_0000001 3300053156 Bacteria 657715
453 Ga0501084_0017520 3300054114 Bacteria 5957
454 Ga0590071_004702 3300059421 Bacteria 3297
455 Ga0590077_010593 3300059426 Bacteria 1896
456 Ga0501082_0001624 3300060353 Bacteria 19807
457 Ga0501082_0099832 3300060353 Bacteria 2510
458 Ga0501082_0154596 3300060353 Bacteria 1993
459 Ga0530510_0002600 3300061734 Bacteria 12409
460 2501080587 2501025502 Bacteria 9641094
461 2511086960 2510917013 Bacteria 9951648
462 2519459128 2519103095 Bacteria 6629912
463 2585290290 2582581311 Bacteria 6763856
464 2599736730 2599185239 Bacteria 8686614
465 2599744803 2599185240 Bacteria 7968121
466 2600205833 2599185355 Bacteria 7968906
467 2676742932 2675903129 Bacteria 7964495
468 2817261413 2816332253 Bacteria 6764532
469 2817279099 2816332256 Bacteria 6891714
470 2817456296 2816332286 Bacteria 6853759
471 2819631214 2818991452 Bacteria 8442785
472 2856294276 2856287931 Bacteria 7223934
473 2857367533 2857357740 Bacteria 9937880
474 2863427432 2863421361 Bacteria 7300805
475 2870070904 2870068957 Bacteria 8925310
476 2891636741 2891633521 Bacteria 4602265
477 2904570050 2904564687 Bacteria 7609577
478 2904576039 2904571731 Bacteria 7608790
479 2928162939 2928157003 Bacteria 7522202
480 2928169601 2928163908 Bacteria 7561269
481 2928171667 2928170801 Bacteria 8785406
482 2928542614 2928536128 Bacteria 7657547
483 2981996778 2981990288 Bacteria 7590678
484 642418468 641736154 Bacteria 7689995
485 8018847004 8018845410 Bacteria 8933938
486 8020813657 8020807995 Bacteria 6801506
487 8020944966 8020938398 Bacteria 7472757
488 8020945541 8020945358 Bacteria 8467355
489 8020956997 8020953355 Bacteria 7439080
490 8021122144 8021120328 Bacteria 8782274
491 8039102702 8039098773 Bacteria 6602928
492 8040172765 8040167225 Bacteria 6542727
493 8040173764 8040173305 Bacteria 6827067
494 Ga0496105_0236916
495 JGI24740J21852_10024741
496 JGI24735J21928_10014670
497 rootH1_10027341
498 Ga0055527_1001098
499 Ga0055542_1002480
500 Ga0055529_1001459
501 Ga0055528_1001201
502 Ga0055541_1009042
503 Ga0058692_1015196
504 Ga0065712_10007940
505 Ga0070658_10055142
506 Ga0070670_100037241
507 Ga0070677_10005223
508 Ga0068869_100028115
509 Ga0068869_100079986
510 Ga0070666_10102639
511 Ga0070666_10366611
512 Ga0068868_100086829
513 Ga0068868_100119648
514 Ga0068868_100133257
515 Ga0068868_100312833
516 Ga0070660_100000046
517 Ga0070689_100060566
518 Ga0070691_10049535
519 Ga0070687_100072846
520 Ga0070692_10174851
521 Ga0070668_100024741
522 Ga0070675_100129963
523 Ga0070674_100410554
524 Ga0070688_100067852
525 Ga0070659_100000137
526 Ga0070667_100063285
527 Ga0070714_100005890
528 Ga0070705_100038820
529 Ga0070700_100005116
530 Ga0070694_100029123
531 Ga0070694_100037669
532 Ga0070708_100384757
533 Ga0070663_100001427
534 Ga0070678_100008111
535 Ga0070678_100098663
536 Ga0070662_100007689
537 Ga0070662_100046290
538 Ga0070681_10006689
539 Ga0070681_10006857
540 Ga0070681_10232919
541 Ga0068867_100195640
542 Ga0070706_100303208
543 Ga0070707_100016314
544 Ga0070699_100120196
545 Ga0070697_100096085
546 Ga0068853_100041483
547 Ga0070672_100026599
548 Ga0070672_100354552
549 Ga0070695_100218565
550 Ga0070696_100000392
551 Ga0070696_100177919
552 Ga0070665_100025061
553 Ga0070704_100008150
554 Ga0070704_100029116
555 Ga0070704_100048797
556 Ga0068855_100124279
557 Ga0068855_100133240
558 Ga0068855_100134113
559 Ga0070664_100006972
560 Ga0068857_100067605
561 Ga0068854_100069230
562 Ga0068852_100011917
563 Ga0068852_100421879
564 Ga0068859_100458203
565 Ga0068864_100105097
566 Ga0068866_10006618
567 Ga0068861_100048896
568 Ga0068851_10017524
569 Ga0068870_10031022
570 Ga0068870_10038295
571 Ga0068863_100211346
572 Ga0068858_100430768
573 Ga0068860_100056721
574 Ga0068860_100174635
575 Ga0068860_100453029
576 Ga0068862_100056646
577 Ga0097621_100015777
578 Ga0068871_100037578
579 Ga0068871_100243878
580 Ga0075428_100000521
581 Ga0075430_100225192
582 Ga0075434_100103676
583 Ga0075429_100020657
584 Ga0075429_100033574
585 Ga0068865_100015250
586 Ga0068865_100042743
587 Ga0075436_100064759
588 Ga0097620_100458277
589 Ga0099795_10005599
590 Ga0105250_10015742
591 Ga0105240_10026104
592 Ga0105240_10030439
593 Ga0105240_10054014
594 Ga0105240_10290029
595 Ga0111539_10001172
596 Ga0111539_10009312
597 Ga0111539_10030266
598 Ga0111539_10282558
599 Ga0105245_10185012
600 Ga0105247_10192616
601 Ga0105243_10009687
602 Ga0105241_10090874
603 Ga0105241_10095198
604 Ga0105242_10047633
605 Ga0105242_10171044
606 Ga0105248_10026883
607 Ga0105238_10004384
608 Ga0099796_10013535
609 Ga0105239_10029223
610 Ga0157370_10008713
611 Ga0157374_10001207
612 Ga0157374_10029174
613 Ga0157374_10090792
614 Ga0157378_10029477
615 Ga0157378_10052531
616 Ga0157378_10385666
617 Ga0163162_10067895
618 Ga0163162_10086769
619 Ga0157375_10016421
620 Ga0157375_10135495
621 Ga0163163_10008865
622 Ga0157380_10568800
623 Ga0157377_10027064
624 Ga0157376_10033893
625 Ga0157376_10045702
626 Ga0157376_10202493
627 Ga0213872_10001354
628 Ga0213872_10002022
629 Ga0213872_10012179
630 Ga0209566_102185
631 Ga0209672_100014
632 Ga0209672_100023
633 Ga0209147_100127
634 Ga0209147_100171
635 Ga0209147_100586
636 Ga0209258_100134
637 Ga0209258_100183
638 Ga0209148_1000035
639 Ga0209759_1003294
640 Ga0209455_1000072
641 Ga0209673_1000140
642 Ga0209564_1004595
643 Ga0207656_10010393
644 Ga0207696_1025786
645 Ga0207642_10004347
646 Ga0207688_10004916
647 Ga0207647_10002161
648 Ga0207645_10042327
649 Ga0207645_10179902
650 Ga0207643_10004473
651 Ga0207643_10027142
652 Ga0207707_10067332
653 Ga0207695_10002788
654 Ga0207695_10050102
655 Ga0207671_10010223
656 Ga0207662_10017037
657 Ga0207662_10096097
658 Ga0207657_10004086
659 Ga0207649_10035897
660 Ga0207646_10042955
661 Ga0207694_10006398
662 Ga0207687_10105593
663 Ga0207687_10466926
664 Ga0207690_10000102
665 Ga0207690_10063437
666 Ga0207706_10002958
667 Ga0207670_10227457
668 Ga0207704_10032607
669 Ga0207704_10032808
670 Ga0207691_10038607
671 Ga0207691_10062425
672 Ga0207691_10137363
673 Ga0207711_10162064
674 Ga0207689_10003547
675 Ga0207689_10052331
676 Ga0207689_10094838
677 Ga0207679_10032964
678 Ga0207679_10197895
679 Ga0207667_10051532
680 Ga0207667_10213808
681 Ga0207667_10257978
682 Ga0207651_10083744
683 Ga0207712_10219507
684 Ga0207677_10056852
685 Ga0207677_10216660
686 Ga0207677_10361695
687 Ga0207703_10053617
688 Ga0207703_10225711
689 Ga0207639_10092193
690 Ga0207678_10004107
691 Ga0207708_10003125
692 Ga0207708_10367565
693 Ga0207702_10190783
694 Ga0207641_10121714
695 Ga0207641_10146996
696 Ga0207641_10185910
697 Ga0207648_10038583
698 Ga0207648_10059767
699 Ga0207648_10249234
700 Ga0207676_10062641
701 Ga0207674_10081698
702 Ga0207674_10198835
703 Ga0207675_100009234
704 Ga0207675_100039257
705 Ga0207683_10022139
706 Ga0207683_10044401
707 Ga0207683_10249697
708 Ga0207698_10013997
709 Ga0207698_10072659
710 Ga0209371_1000079
711 Ga0209967_1003804
712 Ga0209981_1006007
713 Ga0209999_1005054
714 Ga0209974_10020186
715 Ga0207428_10000830
716 Ga0207428_10034099
717 Ga0207428_10345274
718 Ga0268265_10033116
719 Ga0268264_10064795
720 Ga0268264_10413163
721 Ga0265323_10002607
722 Ga0265336_10003222
723 Ga0265338_10079698
724 Ga0265324_10000034
725 Ga0265324_10000928
726 Ga0265324_10008351
727 Ga0268256_1000090
728 Ga0265332_10019855
729 Ga0265328_10002316
730 Ga0265328_10005022
731 Ga0265328_10025725
732 Ga0265328_10044916
733 Ga0265325_10000220
734 Ga0265325_10006034
735 Ga0265331_10000115
736 Ga0265331_10001043
737 Ga0265331_10002725
738 Ga0265331_10016983
739 Ga0265331_10019845
740 Ga0265331_10020051
741 Ga0265331_10044009
742 Ga0265327_10000045
743 Ga0265327_10000217
744 Ga0265327_10000261
745 Ga0265327_10000439
746 Ga0265327_10000645
747 Ga0265327_10021590
748 Ga0265327_10026412
749 Ga0265327_10084885
750 Ga0265316_10012725
751 Ga0265316_10068144
752 Ga0265316_10133561
753 Ga0265316_10151206
754 Ga0307509_10000053
755 Ga0307408_100320233
756 Ga0265314_10000384
757 Ga0265314_10006581
758 Ga0265314_10057783
759 Ga0265342_10006157
760 Ga0307413_10128704
761 Ga0307416_100213150
762 Ga0307416_100516344
763 Ga0307411_10011940
764 Ga0373934_0010374
765 Ga0373952_0000121
766 Ga0373936_0009042
767 Ga0373945_0040910
768 Ga0373953_0083098
769 Ga0373954_0001060
770 Ga0373954_0005524
771 Ga0373954_0177501
772 Ga0373956_0000137
773 Ga0373957_0000904
774 Ga0373957_0040822
775 Ga0373943_0023398
776 Ga0373943_0192040
777 Ga0373955_0074239
778 Ga0373955_0074282
779 Ga0373931_0152746
780 Ga0373931_0174842
781 Ga0373935_0017948
782 Ga0373927_0007684
783 Ga0373927_0179325
784 Ga0373933_0002078
785 Ga0373933_0193864
786 Ga0373937_0001819
787 Ga0373937_0042715
788 Ga0373937_0148766
789 Ga0373937_0200746
790 Ga0395900_0344898
791 Ga0436365_1065712
792 Ga0436361_0138833
793 Ga0436361_0842412
794 Ga0451577_0000002
795 Ga0451577_0002370
796 Ga0451577_0043759
797 Ga0451577_0070307
798 Ga0451577_0502696
799 Ga0453683_0000003
800 Ga0453684_0000002
801 Ga0453684_0000075
802 Ga0453684_0008235
803 Ga0453684_0009433
804 Ga0453684_0071533
805 Ga0453684_0107757
806 Ga0453684_0170593
807 Ga0466959_0080551
808 Ga0451576_0000004
809 Ga0451576_0000013
810 Ga0451576_0000765
811 Ga0451576_0001449
812 Ga0451576_0001549
813 Ga0451576_0001661
814 Ga0451576_0001796
815 Ga0451576_0011136
816 Ga0451576_0035936
817 Ga0451576_0038429
818 Ga0451576_0226101
819 Ga0495592_0095904
820 Ga0495592_0106199
821 Ga0495651_0000330
822 Ga0495651_0042723
823 Ga0495653_0048944
824 Ga0495580_0067776
825 Ga0495580_0230450
826 Ga0495582_0029222
827 Ga0495662_0006147
828 Ga0495608_0017936
829 Ga0495618_0138511
830 Ga0495628_0000779
831 Ga0495628_0013635
832 Ga0495628_0065308
833 Ga0495630_0098410
834 Ga0495630_0248378
835 Ga0495666_0058977
836 Ga0495642_0032301
837 Ga0495652_0078474
838 Ga0495665_0154560
839 Ga0495640_0161472
840 Ga0495598_0030752
841 Ga0495645_0000769
842 Ga0495633_0063112
843 Ga0495667_0028228
844 Ga0495659_0100818
845 Ga0495657_0015591
846 Ga0495599_0000736
847 Ga0495599_0128334
848 Ga0495647_0035709
849 Ga0495658_0081162
850 Ga0495669_0071196
851 Ga0495613_0019047
852 Ga0495624_0128779
853 Ga0495604_0126662
854 Ga0495636_0063365
855 Ga0495680_0237208
856 Ga0495684_0044018
857 Ga0496108_0038992
858 Ga0496108_0275457
859 Ga0496109_0186270
860 Ga0496109_0282868
861 Ga0496110_0100682
862 Ga0496111_0137216
863 Ga0496114_0000506
864 Ga0496114_0031437
865 Ga0496114_0136071
866 Ga0496115_0406404
867 Ga0501290_004752
868 Ga0501031_0064132
869 Ga0501031_0130239
870 Ga0501031_0161738
871 Ga0501032_0000195
872 Ga0501032_0007574
873 Ga0501032_0020636
874 Ga0501033_0000769
875 Ga0501033_0030572
876 Ga0501033_0031705
877 Ga0501034_0061730
878 Ga0501034_0079912
879 Ga0501036_0018739
880 Ga0501036_0032140
881 Ga0501036_0145441
882 Ga0501037_0016853
883 Ga0501038_0004407
884 Ga0501038_0009495
885 Ga0501038_0016210
886 Ga0501038_0019172
887 Ga0501038_0115195
888 Ga0501039_0007196
889 Ga0501039_0027909
890 Ga0501039_0037543
891 Ga0501040_0008296
892 Ga0501041_0263653
893 Ga0501042_0011071
894 Ga0501043_0013190
895 Ga0501043_0036608
896 Ga0501043_0052412
897 Ga0501043_0150495
898 Ga0501046_0002569
899 Ga0501046_0014062
900 Ga0501047_0009664
901 Ga0501048_0006214
902 Ga0501068_0000062
903 Ga0501068_0001455
904 Ga0501068_0089189
905 Ga0501068_0226307
906 Ga0501069_0018380
907 Ga0501070_0001800
908 Ga0501070_0015939
909 Ga0501070_0027425
910 Ga0501071_0007107
911 Ga0501071_0027203
912 Ga0501073_0001234
913 Ga0501073_0030581
914 Ga0501073_0039353
915 Ga0501074_0031724
916 Ga0501075_0002095
917 Ga0501075_0061831
918 Ga0501075_0064479
919 Ga0501076_0000797
920 Ga0501077_0030866
921 Ga0501077_0057642
922 Ga0501079_0007373
923 Ga0501080_0011759
924 Ga0501080_0018353
925 Ga0501080_0028390
926 Ga0501080_0319370
927 Ga0501081_0005835
928 Ga0501081_0072930
929 Ga0501083_0038393
930 Ga0501035_0000827
931 Ga0501035_0055517
932 Ga0501044_0000248
933 Ga0501044_0004061
934 Ga0501045_0001453
935 Ga0501045_0013862
936 nmdc:mga09592_17028_c1
937 nmdc:mga08y16_175837_c1
938 nmdc:mga08y16_4227_c1
939 nmdc:mga08y16_424968_c1
940 nmdc:mga0n895_128791_c1
941 nmdc:mga08x19_132396_c1
942 Ga0495601_0000433
943 Ga0495595_0002021
944 Ga0495619_0174566
945 Ga0500622_0000001
946 Ga0501084_0017520
947 Ga0590071_004702
948 Ga0590077_010593
949 Ga0501082_0001624
950 Ga0501082_0099832
951 Ga0501082_0154596
952 Ga0530510_0002600
953 2501080587
954 2511086960
955 2519459128
956 2585290290
957 2599736730
958 2599744803
959 2600205833
960 2676742932
961 2817261413
962 2817279099
963 2817456296
964 2819631214
965 2856294276
966 2857367533
967 2863427432
968 2870070904
969 2891636741
970 2904570050
971 2904576039
972 2928162939
973 2928169601
974 2928171667
975 2928542614
976 2981996778
977 642418468
978 8018847004
979 8020813657
980 8020944966
981 8020945541
982 8020956997
983 8021122144
984 8039102702
985 8040172765
986 8040173764

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

37

346

1

PF01039

Carboxyl_trans

Carboxyl transferase domain

57

334

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.901 4 314
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.8931 5 318
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.8926 4 314
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.8922 6 318
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.8903 5 318
ID Description Score Start End Superfamily
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9043 5 318 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9016 5 318 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8857 54 309 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8599 54 309 3.90.226.10
5iniB02 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8027 69 296 3.90.226.10
ID Description Score Start End GO Terms
AF-B2IKU6-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9356 3 312 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A8IHS4-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9328 3 312 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A9IZR9-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9328 3 314 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-H6SIV5-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9322 1 314 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A1H8JCB9-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9312 3 311 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295

Map