F454445

General Info

Members Datasets Scaffolds Average Seq Length
493 227 491 168

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10184159|Ga0307517_101841591
Length 167
Sequence MSSRSDPEKPVLVVTTGGTIDKVYFDALSSYQVGDSQIARLLALARVTHPFQVVELMRKDSLELDDGDRDRIYAAVAGAETPYIVVTHGTDTMTTTARRLAFPDKTVVLVGSLSPARFSESDAAFNLGMAFAAAQIAAAGVYITMNGTVFDADRVVKDRDRGAFISS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
208 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
211 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
214 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
215 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
220 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
221 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
224 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
225 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
226 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
227 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.79
Nodule 0
Rhizoplane 2.64
Rhizosphere 67.14
Stem 0
Stem Tuber 0
Unclassified 16.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3113019 2162886007 Bacteria 39820
2 JGI24752J21851_1000372 3300001976 Bacteria 6242
3 JGI25150J39212_1000262 3300002774 Bacteria 28028
4 JGI25153J46596_10000093 3300003215 Bacteria 103442
5 rootH2_10234014 3300003320 Bacteria 2205
6 rootH2_10236659 3300003320 Bacteria 1125
7 Ga0055526_1001437 3300003771 Bacteria 16952
8 Ga0055530_10005741 3300003791 Bacteria 5770
9 Ga0055530_10014187 3300003791 Bacteria 2669
10 Ga0055540_1001103 3300003792 Bacteria 17034
11 Ga0065704_10000192 3300005289 Bacteria 216848
12 Ga0065704_10098235 3300005289 Bacteria 2361
13 Ga0065704_10102855 3300005289 Bacteria 2191
14 Ga0065707_10082002 3300005295 Bacteria 25413
15 Ga0065707_10082223 3300005295 Bacteria 18788
16 Ga0065707_10430649 3300005295 Bacteria 820
17 Ga0070683_100234550 3300005329 Bacteria 1744
18 Ga0070683_100502089 3300005329 Unclassified 1159
19 Ga0070670_100000027 3300005331 Bacteria 186072
20 Ga0070670_100510542 3300005331 Bacteria 1070
21 Ga0070666_10018802 3300005335 Bacteria 4450
22 Ga0070666_10370770 3300005335 Bacteria 1027
23 Ga0070680_100013453 3300005336 Bacteria 6374
24 Ga0070660_100505017 3300005339 Bacteria 1006
25 Ga0070669_100000398 3300005353 Bacteria 33332
26 Ga0070669_100257173 3300005353 Bacteria 1392
27 Ga0070671_100000248 3300005355 Bacteria 36385
28 Ga0070671_100000347 3300005355 Bacteria 31780
29 Ga0070671_100042746 3300005355 Unclassified 3767
30 Ga0070667_100000481 3300005367 Bacteria 40807
31 Ga0070667_100000638 3300005367 Bacteria 34017
32 Ga0070667_100004174 3300005367 Bacteria 12201
33 Ga0070667_100008754 3300005367 Bacteria 8388
34 Ga0070667_100495806 3300005367 Bacteria 1119
35 Ga0070663_100992383 3300005455 Bacteria 730
36 Ga0070684_100162241 3300005535 Bacteria 2028
37 Ga0070684_100773278 3300005535 Bacteria 897
38 Ga0068853_100470281 3300005539 Bacteria 1184
39 Ga0070672_101392712 3300005543 Bacteria 627
40 Ga0070665_100000896 3300005548 Bacteria 38200
41 Ga0070665_100001096 3300005548 Bacteria 33479
42 Ga0070665_100006455 3300005548 Bacteria 11934
43 Ga0070665_100008392 3300005548 Bacteria 10449
44 Ga0070665_100021887 3300005548 Bacteria 6430
45 Ga0070665_100048315 3300005548 Bacteria 4273
46 Ga0070665_100056289 3300005548 Bacteria 3943
47 Ga0070665_100090275 3300005548 Bacteria 3069
48 Ga0070665_100325615 3300005548 Bacteria 1541
49 Ga0068855_100000864 3300005563 Bacteria 37644
50 Ga0068855_100448707 3300005563 Bacteria 1408
51 Ga0070664_100459340 3300005564 Bacteria 1170
52 Ga0068859_100014419 3300005617 Bacteria 7931
53 Ga0068859_100035574 3300005617 Bacteria 4997
54 Ga0068859_100629623 3300005617 Bacteria 1165
55 Ga0068864_100000083 3300005618 Bacteria 100972
56 Ga0068861_100009847 3300005719 Bacteria 6611
57 Ga0068861_100981774 3300005719 Bacteria 805
58 Ga0068851_10204373 3300005834 Bacteria 1104
59 Ga0068863_100000025 3300005841 Bacteria 186072
60 Ga0068863_100002525 3300005841 Bacteria 18156
61 Ga0068863_100002872 3300005841 Bacteria 17057
62 Ga0068863_100003218 3300005841 Bacteria 16174
63 Ga0068863_100005026 3300005841 Bacteria 13038
64 Ga0068863_100005830 3300005841 Bacteria 12070
65 Ga0068858_100001526 3300005842 Bacteria 23774
66 Ga0068858_100009745 3300005842 Bacteria 9150
67 Ga0068858_100086339 3300005842 Bacteria 2919
68 Ga0068858_100116853 3300005842 Bacteria 2493
69 Ga0068858_100190279 3300005842 Unclassified 1939
70 Ga0068860_100001916 3300005843 Bacteria 22090
71 Ga0068860_100002810 3300005843 Bacteria 18107
72 Ga0068860_100009042 3300005843 Bacteria 9917
73 Ga0068860_100014439 3300005843 Bacteria 7737
74 Ga0068860_100025299 3300005843 Bacteria 5729
75 Ga0068860_100627888 3300005843 Bacteria 1081
76 Ga0068862_100000027 3300005844 Bacteria 186072
77 Ga0068862_100000742 3300005844 Bacteria 32711
78 Ga0068862_100012030 3300005844 Bacteria 7150
79 Ga0068862_100020605 3300005844 Bacteria 5508
80 Ga0068862_100321545 3300005844 Bacteria 1428
81 Ga0081539_10152223 3300005985 Bacteria 1111
82 Ga0075364_10303631 3300006051 Bacteria 1087
83 Ga0070712_100420746 3300006175 Unclassified 1107
84 Ga0075369_10145918 3300006186 Bacteria 1080
85 Ga0097621_100454073 3300006237 Bacteria 1155
86 Ga0075370_10018935 3300006353 Bacteria 3739
87 Ga0068871_100273202 3300006358 Bacteria 1477
88 Ga0068871_100512604 3300006358 Bacteria 1082
89 Ga0075430_100093060 3300006846 Bacteria 2520
90 Ga0075430_100095607 3300006846 Bacteria 2483
91 Ga0075430_100122663 3300006846 Bacteria 2167
92 Ga0075431_100000252 3300006847 Bacteria 40784
93 Ga0075431_100435183 3300006847 Bacteria 1309
94 Ga0075429_100529122 3300006880 Bacteria 1033
95 Ga0097620_100014419 3300006931 Bacteria 7931
96 Ga0097620_100035575 3300006931 Bacteria 4997
97 Ga0097620_100629665 3300006931 Bacteria 1165
98 Ga0099794_10012023 3300007265 Bacteria 3723
99 Ga0099795_10007517 3300007788 Bacteria 3047
100 Ga0105251_10000554 3300009011 Bacteria 35071
101 Ga0105250_10453880 3300009092 Unclassified 576
102 Ga0105240_10002346 3300009093 Bacteria 30550
103 Ga0105240_10031399 3300009093 Bacteria 6889
104 Ga0105240_10097870 3300009093 Bacteria 3574
105 Ga0105240_10176002 3300009093 Bacteria 2529
106 Ga0105240_10183870 3300009093 Bacteria 2464
107 Ga0105240_10224601 3300009093 Bacteria 2186
108 Ga0105240_10317691 3300009093 Bacteria 1776
109 Ga0105240_10491663 3300009093 Bacteria 1366
110 Ga0105240_12071557 3300009093 Bacteria 591
111 Ga0111539_10008631 3300009094 Bacteria 12942
112 Ga0111539_10201076 3300009094 Bacteria 2323
113 Ga0105247_10000498 3300009101 Bacteria 32456
114 Ga0105247_10006556 3300009101 Bacteria 7197
115 Ga0105247_10008816 3300009101 Bacteria 6148
116 Ga0114129_10050160 3300009147 Bacteria 5863
117 Ga0114129_10496842 3300009147 Bacteria 1594
118 Ga0105248_10000026 3300009177 Bacteria 257155
119 Ga0105248_10011174 3300009177 Bacteria 9902
120 Ga0105248_10260790 3300009177 Unclassified 1951
121 Ga0105248_12153010 3300009177 Bacteria 634
122 Ga0105237_10042538 3300009545 Bacteria 4580
123 Ga0105237_10158927 3300009545 Bacteria 2258
124 Ga0105237_10161823 3300009545 Bacteria 2237
125 Ga0105237_10192919 3300009545 Bacteria 2037
126 Ga0105237_10265445 3300009545 Bacteria 1720
127 Ga0105237_10302944 3300009545 Bacteria 1601
128 Ga0105238_10099137 3300009551 Unclassified 2897
129 Ga0105238_10426187 3300009551 Unclassified 1322
130 Ga0105238_10892862 3300009551 Bacteria 907
131 Ga0105249_10000123 3300009553 Bacteria 104747
132 Ga0105249_10000161 3300009553 Bacteria 80491
133 Ga0105249_10129586 3300009553 Bacteria 2406
134 Ga0105249_10239794 3300009553 Bacteria 1792
135 Ga0105249_10252024 3300009553 Bacteria 1751
136 Ga0099796_10003854 3300010159 Bacteria 3546
137 Ga0105239_10163924 3300010375 Bacteria 2485
138 Ga0105239_10192213 3300010375 Bacteria 2284
139 Ga0105239_10313492 3300010375 Bacteria 1768
140 Ga0105246_10012636 3300011119 Bacteria 5274
141 Ga0157374_10564174 3300013296 Bacteria 1147
142 Ga0157378_10007322 3300013297 Bacteria 9637
143 Ga0163162_10095269 3300013306 Unclassified 3063
144 Ga0163162_10255486 3300013306 Bacteria 1884
145 Ga0157372_10705573 3300013307 Bacteria 1174
146 Ga0157375_10345910 3300013308 Bacteria 1652
147 Ga0163163_10012544 3300014325 Bacteria 7728
148 Ga0163163_10124540 3300014325 Bacteria 2614
149 Ga0163163_10156368 3300014325 Bacteria 2324
150 Ga0163163_10339381 3300014325 Bacteria 1557
151 Ga0163163_10986687 3300014325 Bacteria 906
152 Ga0157380_10000630 3300014326 Bacteria 21676
153 Ga0157380_10023265 3300014326 Bacteria 4672
154 Ga0182008_10185468 3300014497 Bacteria 1054
155 Ga0157379_10048235 3300014968 Bacteria 3801
156 Ga0157379_10054672 3300014968 Bacteria 3567
157 Ga0157379_10751074 3300014968 Bacteria 918
158 Ga0157379_11206770 3300014968 Bacteria 728
159 Ga0157376_11428911 3300014969 Bacteria 724
160 Ga0157376_11936824 3300014969 Bacteria 627
161 Ga0207425_1000072 3300025245 Bacteria 115017
162 Ga0209129_1000734 3300025258 Bacteria 21070
163 Ga0209565_1000132 3300025263 Bacteria 104716
164 Ga0209565_1013103 3300025263 Bacteria 1951
165 Ga0209673_1010920 3300025273 Bacteria 3788
166 Ga0209676_1002301 3300025292 Bacteria 13913
167 Ga0209676_1021604 3300025292 Bacteria 2156
168 Ga0209025_1003336 3300025294 Bacteria 15403
169 Ga0209564_1001899 3300025295 Bacteria 18729
170 Ga0209564_1017232 3300025295 Bacteria 2827
171 Ga0209758_1000009 3300025297 Bacteria 1123483
172 Ga0209758_1023237 3300025297 Bacteria 2811
173 Ga0209050_1000005 3300025298 Bacteria 1557793
174 Ga0209050_1001236 3300025298 Bacteria 29567
175 Ga0209050_1022173 3300025298 Bacteria 2283
176 Ga0209050_1064966 3300025298 Bacteria 843
177 Ga0207426_1053154 3300025302 Bacteria 1197
178 Ga0209051_1000507 3300025303 Bacteria 49396
179 Ga0209257_1003743 3300025304 Bacteria 12596
180 Ga0209257_1003760 3300025304 Bacteria 12537
181 Ga0207713_1000615 3300025735 Bacteria 35051
182 Ga0207710_10000147 3300025900 Bacteria 80231
183 Ga0207710_10004596 3300025900 Bacteria 6002
184 Ga0207710_10027626 3300025900 Unclassified 2459
185 Ga0207680_10027523 3300025903 Unclassified 3167
186 Ga0207647_10038083 3300025904 Bacteria 3043
187 Ga0207695_10013476 3300025913 Bacteria 9748
188 Ga0207695_10014260 3300025913 Bacteria 9427
189 Ga0207695_10021679 3300025913 Bacteria 7323
190 Ga0207695_10124806 3300025913 Bacteria 2538
191 Ga0207695_10138467 3300025913 Bacteria 2385
192 Ga0207695_10179163 3300025913 Unclassified 2041
193 Ga0207695_10256336 3300025913 Bacteria 1648
194 Ga0207695_10904256 3300025913 Unclassified 762
195 Ga0207671_10049367 3300025914 Bacteria 3115
196 Ga0207671_10067425 3300025914 Unclassified 2665
197 Ga0207671_10121735 3300025914 Bacteria 1995
198 Ga0207671_10549286 3300025914 Bacteria 921
199 Ga0207660_10063810 3300025917 Bacteria 2657
200 Ga0207652_10119313 3300025921 Bacteria 2346
201 Ga0207681_10061596 3300025923 Bacteria 2580
202 Ga0207694_10448149 3300025924 Bacteria 1077
203 Ga0207694_10469346 3300025924 Bacteria 1052
204 Ga0207694_10489968 3300025924 Bacteria 1029
205 Ga0207650_10000056 3300025925 Bacteria 157972
206 Ga0207650_10043744 3300025925 Bacteria 3289
207 Ga0207700_10132368 3300025928 Bacteria 2038
208 Ga0207644_10000366 3300025931 Bacteria 29522
209 Ga0207644_10005160 3300025931 Bacteria 8530
210 Ga0207644_10024583 3300025931 Bacteria 4137
211 Ga0207644_10088705 3300025931 Bacteria 2301
212 Ga0207691_10767118 3300025940 Bacteria 811
213 Ga0207711_10000004 3300025941 Bacteria 870636
214 Ga0207711_10197111 3300025941 Bacteria 1837
215 Ga0207661_10073642 3300025944 Bacteria 2798
216 Ga0207661_10565260 3300025944 Bacteria 1042
217 Ga0207667_10008319 3300025949 Bacteria 12339
218 Ga0207712_10000059 3300025961 Bacteria 137849
219 Ga0207712_10008880 3300025961 Bacteria 6355
220 Ga0207712_10739346 3300025961 Bacteria 861
221 Ga0207658_10000251 3300025986 Bacteria 56192
222 Ga0207658_10000520 3300025986 Bacteria 35135
223 Ga0207658_10011171 3300025986 Bacteria 6116
224 Ga0207658_10033146 3300025986 Unclassified 3682
225 Ga0207658_10317153 3300025986 Bacteria 1348
226 Ga0207658_10516547 3300025986 Bacteria 1065
227 Ga0207703_10002044 3300026035 Bacteria 17813
228 Ga0207703_10003560 3300026035 Bacteria 13019
229 Ga0207703_10470954 3300026035 Bacteria 1176
230 Ga0207639_10031464 3300026041 Unclassified 3900
231 Ga0207639_10257499 3300026041 Bacteria 1525
232 Ga0207678_10033205 3300026067 Bacteria 4497
233 Ga0207702_10029583 3300026078 Bacteria 4559
234 Ga0207702_10998322 3300026078 Bacteria 830
235 Ga0207641_10000018 3300026088 Bacteria 298209
236 Ga0207641_10000117 3300026088 Bacteria 117830
237 Ga0207641_10003204 3300026088 Bacteria 14644
238 Ga0207641_10007380 3300026088 Bacteria 9150
239 Ga0207641_10013373 3300026088 Bacteria 6729
240 Ga0207641_10018142 3300026088 Bacteria 5766
241 Ga0207676_10000027 3300026095 Bacteria 245868
242 Ga0207428_10002282 3300027907 Bacteria 19247
243 Ga0207428_10004991 3300027907 Bacteria 12481
244 Ga0268266_10000159 3300028379 Bacteria 126969
245 Ga0268266_10003742 3300028379 Bacteria 14960
246 Ga0268266_10003965 3300028379 Bacteria 14360
247 Ga0268266_10013709 3300028379 Bacteria 6981
248 Ga0268266_10069357 3300028379 Bacteria 3054
249 Ga0268266_10130297 3300028379 Bacteria 2249
250 Ga0268265_10000042 3300028380 Bacteria 186086
251 Ga0268265_10000281 3300028380 Bacteria 57698
252 Ga0268264_10000183 3300028381 Bacteria 133803
253 Ga0268264_10000899 3300028381 Bacteria 31348
254 Ga0268264_10006973 3300028381 Bacteria 9485
255 Ga0268264_10463617 3300028381 Bacteria 1230
256 Ga0265334_10024393 3300028573 Bacteria 2452
257 Ga0307517_10184159 3300028786 Bacteria 1341
258 Ga0307515_10042298 3300028794 Bacteria 7134
259 Ga0307511_10000028 3300030521 Bacteria 109328
260 Ga0265340_10030838 3300031247 Bacteria 2685
261 Ga0265331_10162312 3300031250 Bacteria 1012
262 Ga0307513_10735377 3300031456 Bacteria 692
263 Ga0307509_10000025 3300031507 Bacteria 235550
264 Ga0307509_10000581 3300031507 Bacteria 62548
265 Ga0307408_100040800 3300031548 Bacteria 3288
266 Ga0307408_100136637 3300031548 Bacteria 1919
267 Ga0307516_10621355 3300031730 Bacteria 735
268 Ga0307405_10114334 3300031731 Bacteria 1834
269 Ga0307405_10517011 3300031731 Bacteria 960
270 Ga0307413_10047059 3300031824 Bacteria 2569
271 Ga0307413_10487609 3300031824 Bacteria 987
272 Ga0307413_10636527 3300031824 Bacteria 878
273 Ga0307413_10973678 3300031824 Bacteria 725
274 Ga0307413_11669703 3300031824 Unclassified 567
275 Ga0307410_10045208 3300031852 Bacteria 2930
276 Ga0307410_10187568 3300031852 Bacteria 1570
277 Ga0307410_10252097 3300031852 Bacteria 1373
278 Ga0307410_10804058 3300031852 Bacteria 800
279 Ga0307406_10139285 3300031901 Bacteria 1715
280 Ga0307406_11059148 3300031901 Bacteria 698
281 Ga0307407_10024073 3300031903 Bacteria 3186
282 Ga0307407_10063829 3300031903 Bacteria 2162
283 Ga0307407_10922397 3300031903 Bacteria 671
284 Ga0307412_10521045 3300031911 Bacteria 993
285 Ga0307412_10637138 3300031911 Bacteria 907
286 Ga0307412_11200666 3300031911 Bacteria 679
287 Ga0307409_100148866 3300031995 Bacteria 2029
288 Ga0307409_100192094 3300031995 Bacteria 1818
289 Ga0307409_100227844 3300031995 Bacteria 1687
290 Ga0307409_100750970 3300031995 Bacteria 979
291 Ga0307409_100924345 3300031995 Unclassified 887
292 Ga0307409_100944784 3300031995 Bacteria 878
293 Ga0307416_100251525 3300032002 Bacteria 1720
294 Ga0307414_10003057 3300032004 Bacteria 8877
295 Ga0307414_10082697 3300032004 Bacteria 2355
296 Ga0307411_10026343 3300032005 Bacteria 3500
297 Ga0307411_10243169 3300032005 Unclassified 1410
298 Ga0307411_10416686 3300032005 Bacteria 1114
299 Ga0307411_10549224 3300032005 Bacteria 985
300 Ga0307415_100346244 3300032126 Bacteria 1249
301 Ga0307507_10344193 3300033179 Unclassified 881
302 Ga0307510_10000002 3300033180 Bacteria 801565
303 Ga0307510_10036411 3300033180 Bacteria 5475
304 Ga0307510_10138554 3300033180 Bacteria 2084
305 Ga0373936_0027513 3300035113 Bacteria 2230
306 Ga0373936_0029937 3300035113 Bacteria 2146
307 Ga0373927_0563081 3300035695 Bacteria 753
308 Ga0395898_0002405 3300037466 Bacteria 22206
309 Ga0436364_0876164 3300037853 Bacteria 1047
310 Ga0436365_0243813 3300039437 Unclassified 634
311 Ga0439448_0073186 3300042005 Bacteria 1143
312 Ga0439457_083103 3300042014 Bacteria 737
313 Ga0439464_0127146 3300042439 Bacteria 788
314 Ga0439440_0067146 3300042993 Bacteria 927
315 Ga0466969_0075889 3300044656 Bacteria 1610
316 Ga0466966_0841423 3300044684 Unclassified 553
317 Ga0466959_0117517 3300045049 Bacteria 1893
318 Ga0495627_000124 3300046453 Bacteria 93651
319 Ga0495638_0030893 3300046460 Bacteria 3444
320 Ga0495650_0000822 3300046471 Bacteria 37641
321 Ga0495596_0000054 3300046500 Bacteria 83068
322 Ga0495596_0004170 3300046500 Bacteria 7101
323 Ga0495607_0017649 3300046501 Bacteria 4574
324 Ga0495607_0355277 3300046501 Bacteria 675
325 Ga0495606_0180422 3300046507 Bacteria 1218
326 Ga0495610_0000022 3300046512 Bacteria 317107
327 Ga0495610_0000436 3300046512 Bacteria 42966
328 Ga0495610_0003492 3300046512 Bacteria 12223
329 Ga0495620_0032347 3300046515 Bacteria 2384
330 Ga0495632_0000533 3300046519 Bacteria 35890
331 Ga0495632_0062224 3300046519 Bacteria 1810
332 Ga0495632_0096853 3300046519 Bacteria 1393
333 Ga0495643_0000042 3300046522 Bacteria 229665
334 Ga0495643_0060903 3300046522 Bacteria 2002
335 Ga0495648_0061248 3300046524 Bacteria 2236
336 Ga0495654_0004203 3300046530 Bacteria 8614
337 Ga0495654_0021480 3300046530 Bacteria 3358
338 Ga0495609_0004316 3300046538 Bacteria 7815
339 Ga0495609_0098583 3300046538 Bacteria 1267
340 Ga0495633_0042387 3300046558 Bacteria 2162
341 Ga0495668_0053651 3300046616 Bacteria 2228
342 Ga0495611_0224411 3300046648 Bacteria 874
343 Ga0495625_0001187 3300046660 Bacteria 33373
344 Ga0495625_0052793 3300046660 Bacteria 2909
345 Ga0495625_0052958 3300046660 Bacteria 2905
346 Ga0495625_0316987 3300046660 Bacteria 994
347 Ga0495625_0400904 3300046660 Bacteria 857
348 Ga0495670_0196709 3300046691 Bacteria 1067
349 Ga0495683_0120563 3300047323 Bacteria 1245
350 Ga0495687_027325 3300047443 Unclassified 2672
351 Ga0495681_0000010 3300047470 Bacteria 203548
352 Ga0495686_0015271 3300047472 Bacteria 5251
353 Ga0495626_0000436 3300048091 Bacteria 42597
354 Ga0496102_0000529 3300048905 Bacteria 41357
355 Ga0496102_0001077 3300048905 Bacteria 25235
356 Ga0496102_0170154 3300048905 Bacteria 2051
357 Ga0496102_0182536 3300048905 Bacteria 1977
358 Ga0496102_0535873 3300048905 Bacteria 1093
359 Ga0496103_0000358 3300048906 Bacteria 41329
360 Ga0496103_0000687 3300048906 Bacteria 25235
361 Ga0496103_0026083 3300048906 Bacteria 3536
362 Ga0496105_0151623 3300048908 Bacteria 1905
363 Ga0496106_0296629 3300048909 Bacteria 1296
364 Ga0496109_0683540 3300048912 Bacteria 963
365 Ga0496112_0112731 3300048915 Bacteria 2690
366 Ga0496115_0084120 3300048918 Bacteria 2594
367 Ga0496116_0000017 3300048919 Bacteria 554463
368 Ga0496116_0000750 3300048919 Bacteria 41221
369 Ga0496116_0003018 3300048919 Bacteria 17047
370 Ga0496116_0020341 3300048919 Bacteria 5043
371 Ga0496116_0020691 3300048919 Bacteria 4988
372 Ga0496116_0153341 3300048919 Bacteria 1276
373 Ga0496117_0000054 3300048920 Bacteria 278013
374 Ga0496117_0001078 3300048920 Bacteria 41357
375 Ga0496117_0002210 3300048920 Bacteria 25235
376 Ga0496117_0002463 3300048920 Bacteria 23295
377 Ga0496117_0070846 3300048920 Bacteria 2339
378 Ga0496117_0140496 3300048920 Bacteria 1447
379 Ga0496117_0362562 3300048920 Bacteria 744
380 Ga0496118_0000195 3300048921 Bacteria 107276
381 Ga0496118_0000262 3300048921 Bacteria 92154
382 Ga0496118_0001124 3300048921 Bacteria 41357
383 Ga0496118_0002409 3300048921 Bacteria 25235
384 Ga0496118_0010987 3300048921 Bacteria 8896
385 Ga0496118_0042209 3300048921 Bacteria 3601
386 Ga0496118_0125979 3300048921 Bacteria 1658
387 Ga0496118_0134621 3300048921 Bacteria 1579
388 Ga0496118_0160320 3300048921 Bacteria 1392
389 Ga0496118_0260560 3300048921 Unclassified 979
390 Ga0496118_0512736 3300048921 Bacteria 593
391 Ga0496119_0002547 3300048922 Bacteria 19839
392 Ga0496119_0004480 3300048922 Bacteria 13889
393 Ga0496119_0016308 3300048922 Bacteria 5662
394 Ga0496119_0086806 3300048922 Bacteria 1787
395 Ga0496119_0090543 3300048922 Bacteria 1739
396 Ga0496119_0132838 3300048922 Bacteria 1354
397 Ga0496119_0358051 3300048922 Bacteria 705
398 Ga0496120_0000558 3300048923 Bacteria 56867
399 Ga0496120_0016551 3300048923 Bacteria 4818
400 Ga0496120_0331414 3300048923 Bacteria 688
401 Ga0496121_0000022 3300048924 Bacteria 472849
402 Ga0496121_0002831 3300048924 Bacteria 25625
403 Ga0496121_0003373 3300048924 Bacteria 22895
404 Ga0496121_0013117 3300048924 Bacteria 8943
405 Ga0496121_0015551 3300048924 Bacteria 7956
406 Ga0496121_0099223 3300048924 Bacteria 2251
407 Ga0496121_0747300 3300048924 Bacteria 582
408 Ga0496122_0026373 3300048925 Bacteria 5011
409 Ga0496123_0001455 3300048926 Bacteria 32951
410 Ga0496124_0001157 3300048927 Bacteria 41357
411 Ga0496124_0002299 3300048927 Bacteria 25235
412 Ga0496124_0007454 3300048927 Bacteria 11622
413 Ga0496124_0022383 3300048927 Bacteria 5794
414 Ga0496124_0022420 3300048927 Bacteria 5788
415 Ga0496124_0029380 3300048927 Bacteria 4899
416 Ga0496124_0206536 3300048927 Bacteria 1489
417 Ga0496125_0000289 3300048928 Bacteria 99535
418 Ga0496125_0003926 3300048928 Bacteria 17541
419 Ga0496125_0044522 3300048928 Bacteria 3752
420 Ga0496125_0058826 3300048928 Bacteria 3101
421 Ga0496125_0252224 3300048928 Bacteria 1112
422 Ga0496125_0348932 3300048928 Bacteria 885
423 Ga0496125_0425269 3300048928 Bacteria 768
424 Ga0496126_0007938 3300048929 Bacteria 11537
425 Ga0496126_0038029 3300048929 Bacteria 4480
426 Ga0496126_0043879 3300048929 Bacteria 4121
427 Ga0496126_0050188 3300048929 Bacteria 3804
428 Ga0496126_0105795 3300048929 Bacteria 2456
429 Ga0496126_0198598 3300048929 Bacteria 1695
430 Ga0496126_0320340 3300048929 Bacteria 1274
431 Ga0496126_0923759 3300048929 Bacteria 660
432 Ga0495682_0190505 3300049460 Unclassified 728
433 Ga0495682_0193952 3300049460 Bacteria 721
434 Ga0501037_0541795 3300049573 Unclassified 786
435 Ga0501038_0069936 3300049574 Bacteria 2981
436 Ga0501039_0999051 3300049575 Unclassified 650
437 Ga0501046_0125413 3300049580 Bacteria 1951
438 Ga0501046_1004023 3300049580 Bacteria 579
439 Ga0501047_0176820 3300049581 Bacteria 2002
440 Ga0501047_0207476 3300049581 Bacteria 1819
441 Ga0501047_0246750 3300049581 Bacteria 1635
442 Ga0501067_0215225 3300049583 Bacteria 1070
443 Ga0501044_0436618 3300049823 Bacteria 1218
444 nmdc:mga03683_41_c1 3300050489 Bacteria 60927
445 nmdc:mga03683_6020_c1 3300050489 Bacteria 4132
446 nmdc:mga00v17_160240_c1 3300050491 Bacteria 1448
447 nmdc:mga00v17_278110_c1 3300050491 Bacteria 1087
448 nmdc:mga0k408_6801_c1 3300050493 Bacteria 6098
449 nmdc:mga07m45_16_c1 3300050496 Bacteria 151695
450 nmdc:mga05p37_23502_c1 3300050507 Bacteria 7479
451 nmdc:mga09592_145_c1 3300050508 Bacteria 47800
452 nmdc:mga09592_487304_c1 3300050508 Bacteria 1062
453 nmdc:mga0qj67_284255_c1 3300050509 Bacteria 1341
454 nmdc:mga0qj67_56338_c1 3300050509 Bacteria 3115
455 nmdc:mga06r32_389424_c1 3300050510 Bacteria 1376
456 nmdc:mga06r32_40_c1 3300050510 Bacteria 79168
457 nmdc:mga08y16_148_c1 3300050511 Bacteria 60964
458 nmdc:mga08y16_3044_c1 3300050511 Bacteria 17317
459 Ga0500643_000121 3300053087 Bacteria 81461
460 Ga0500643_000203 3300053087 Bacteria 56433
461 Ga0500643_000250 3300053087 Bacteria 49518
462 Ga0500646_0253555 3300053090 Bacteria 620
463 Ga0500583_0122134 3300053092 Bacteria 1289
464 Ga0500556_0237020 3300053104 Bacteria 719
465 Ga0500592_000791 3300053116 Bacteria 5200
466 Ga0500594_0004104 3300053118 Bacteria 3208
467 Ga0500595_001296 3300053119 Bacteria 13597
468 Ga0500607_000188 3300053121 Bacteria 55367
469 Ga0500618_000768 3300053125 Bacteria 18139
470 Ga0500618_078255 3300053125 Bacteria 742
471 Ga0500652_206735 3300053131 Bacteria 794
472 Ga0500559_0152841 3300053136 Bacteria 1084
473 Ga0500559_0246012 3300053136 Bacteria 843
474 Ga0500559_0252195 3300053136 Unclassified 832
475 Ga0500564_270193 3300053138 Bacteria 665
476 Ga0500568_0061295 3300053139 Bacteria 1455
477 Ga0500588_0010348 3300053146 Bacteria 2249
478 Ga0500588_0242877 3300053146 Unclassified 675
479 Ga0500590_000691 3300053148 Bacteria 12204
480 Ga0500604_0199910 3300053151 Bacteria 687
481 Ga0500616_0065178 3300053153 Bacteria 1874
482 Ga0500622_0002161 3300053156 Bacteria 14580
483 Ga0500622_0002233 3300053156 Bacteria 14245
484 Ga0500627_0000945 3300053158 Bacteria 7847
485 Ga0500627_0061329 3300053158 Bacteria 1654
486 Ga0500630_040713 3300053159 Bacteria 2269
487 Ga0500637_0009309 3300053178 Bacteria 4995
488 Ga0500637_0025440 3300053178 Bacteria 3253
489 Ga0500637_0116335 3300053178 Bacteria 1551
490 Ga0500637_0290523 3300053178 Bacteria 896
491 Ga0500611_010857 3300053727 Bacteria 1489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10564174 Ga0157374_105641741 155
2 3300044656 Ga0466969_0075889 Ga0466969_0075889_510_989 156
3 3300005843 Ga0068860_100627888 Ga0068860_1006278881 157
4 3300028381 Ga0268264_10463617 Ga0268264_104636172 157
5 3300031456 Ga0307513_10735377 Ga0307513_107353771 157
6 3300031730 Ga0307516_10621355 Ga0307516_106213552 157
7 3300053136 Ga0500559_0252195 Ga0500559_0252195_183_662 157
8 3300031824 Ga0307413_11669703 Ga0307413_116697031 159
9 3300031995 Ga0307409_100924345 Ga0307409_1009243452 159
10 3300005548 Ga0070665_100006455 Ga0070665_10000645514 160
11 3300005841 Ga0068863_100002525 Ga0068863_10000252516 160
12 3300005843 Ga0068860_100002810 Ga0068860_1000028103 160
13 3300005844 Ga0068862_100000742 Ga0068862_1000007426 160
14 3300006846 Ga0075430_100122663 Ga0075430_1001226632 160
15 3300009101 Ga0105247_10008816 Ga0105247_100088164 160
16 3300009553 Ga0105249_10000161 Ga0105249_1000016118 160
17 3300025900 Ga0207710_10004596 Ga0207710_100045964 160
18 3300025961 Ga0207712_10000059 Ga0207712_1000005985 160
19 3300026088 Ga0207641_10003204 Ga0207641_100032046 160
20 3300028380 Ga0268265_10000281 Ga0268265_1000028131 160
21 3300028381 Ga0268264_10000899 Ga0268264_1000089926 160
22 3300048920 Ga0496117_0362562 Ga0496117_0362562_27_539 160
23 3300048921 Ga0496118_0260560 Ga0496118_0260560_162_674 160
24 3300049573 Ga0501037_0541795 Ga0501037_0541795_269_751 160
25 3300049574 Ga0501038_0069936 Ga0501038_0069936_752_1234 160
26 3300049575 Ga0501039_0999051 Ga0501039_0999051_145_627 160
27 3300031247 Ga0265340_10030838 Ga0265340_100308382 161
28 3300048924 Ga0496121_0000022 Ga0496121_0000022_70574_71059 161
29 3300053090 Ga0500646_0253555 Ga0500646_0253555_108_596 161
30 3300053092 Ga0500583_0122134 Ga0500583_0122134_80_568 161
31 3300053104 Ga0500556_0237020 Ga0500556_0237020_182_673 161
32 3300053119 Ga0500595_001296 Ga0500595_001296_3366_3854 161
33 3300053125 Ga0500618_000768 Ga0500618_000768_5846_6331 161
34 3300053125 Ga0500618_078255 Ga0500618_078255_49_534 161
35 iso_pu_bacteria 2510917021 2511127252 161
36 3300006051 Ga0075364_10303631 Ga0075364_103036312 162
37 3300049823 Ga0501044_0436618 Ga0501044_0436618_545_1063 162
38 3300050491 nmdc:mga00v17_160240_c1 nmdc:mga00v17_160240_c1_756_1247 162
39 3300003320 rootH2_10234014 rootH2_102340142 163
40 3300003791 Ga0055530_10005741 Ga0055530_100057414 163
41 3300003792 Ga0055540_1001103 Ga0055540_10011034 163
42 3300005295 Ga0065707_10430649 Ga0065707_104306491 163
43 3300005367 Ga0070667_100000481 Ga0070667_10000048138 163
44 3300005841 Ga0068863_100005026 Ga0068863_1000050266 163
45 3300005843 Ga0068860_100014439 Ga0068860_1000144392 163
46 3300014497 Ga0182008_10185468 Ga0182008_101854682 163
47 3300025263 Ga0209565_1013103 Ga0209565_10131031 163
48 3300025292 Ga0209676_1002301 Ga0209676_10023019 163
49 3300025292 Ga0209676_1021604 Ga0209676_10216042 163
50 3300025298 Ga0209050_1000005 Ga0209050_1000005494 163
51 3300025298 Ga0209050_1064966 Ga0209050_10649662 163
52 3300025303 Ga0209051_1000507 Ga0209051_100050728 163
53 3300025304 Ga0209257_1003743 Ga0209257_10037438 163
54 3300025304 Ga0209257_1003760 Ga0209257_10037608 163
55 3300025904 Ga0207647_10038083 Ga0207647_100380832 163
56 3300025931 Ga0207644_10024583 Ga0207644_100245832 163
57 3300025986 Ga0207658_10000520 Ga0207658_1000052011 163
58 3300026088 Ga0207641_10007380 Ga0207641_100073806 163
59 3300031548 Ga0307408_100040800 Ga0307408_1000408003 163
60 3300031548 Ga0307408_100136637 Ga0307408_1001366372 163
61 3300031731 Ga0307405_10114334 Ga0307405_101143342 163
62 3300031731 Ga0307405_10517011 Ga0307405_105170111 163
63 3300031824 Ga0307413_10047059 Ga0307413_100470593 163
64 3300031824 Ga0307413_10973678 Ga0307413_109736781 163
65 3300031852 Ga0307410_10045208 Ga0307410_100452082 163
66 3300031852 Ga0307410_10187568 Ga0307410_101875682 163
67 3300031901 Ga0307406_10139285 Ga0307406_101392852 163
68 3300031901 Ga0307406_11059148 Ga0307406_110591481 163
69 3300031903 Ga0307407_10024073 Ga0307407_100240734 163
70 3300031903 Ga0307407_10063829 Ga0307407_100638292 163
71 3300031911 Ga0307412_10521045 Ga0307412_105210451 163
72 3300031911 Ga0307412_10637138 Ga0307412_106371381 163
73 3300031911 Ga0307412_11200666 Ga0307412_112006661 163
74 3300031995 Ga0307409_100148866 Ga0307409_1001488664 163
75 3300031995 Ga0307409_100192094 Ga0307409_1001920942 163
76 3300031995 Ga0307409_100750970 Ga0307409_1007509701 163
77 3300032002 Ga0307416_100251525 Ga0307416_1002515252 163
78 3300032004 Ga0307414_10082697 Ga0307414_100826973 163
79 3300032005 Ga0307411_10026343 Ga0307411_100263434 163
80 3300032005 Ga0307411_10416686 Ga0307411_104166862 163
81 3300032126 Ga0307415_100346244 Ga0307415_1003462442 163
82 3300033180 Ga0307510_10138554 Ga0307510_101385542 163
83 3300046453 Ga0495627_000124 Ga0495627_000124_84521_85012 163
84 3300046471 Ga0495650_0000822 Ga0495650_0000822_28387_28878 163
85 3300046512 Ga0495610_0000022 Ga0495610_0000022_224566_225057 163
86 3300046515 Ga0495620_0032347 Ga0495620_0032347_441_932 163
87 3300046519 Ga0495632_0000533 Ga0495632_0000533_25289_25780 163
88 3300046530 Ga0495654_0021480 Ga0495654_0021480_2775_3266 163
89 3300046660 Ga0495625_0400904 Ga0495625_0400904_291_806 163
90 3300047323 Ga0495683_0120563 Ga0495683_0120563_173_664 163
91 3300047470 Ga0495681_0000010 Ga0495681_0000010_31640_32131 163
92 3300048905 Ga0496102_0182536 Ga0496102_0182536_305_796 163
93 3300050489 nmdc:mga03683_6020_c1 nmdc:mga03683_6020_c1_591_1085 163
94 3300002774 JGI25150J39212_1000262 JGI25150J39212_100026218 164
95 3300003215 JGI25153J46596_10000093 JGI25153J46596_1000009373 164
96 3300003771 Ga0055526_1001437 Ga0055526_10014379 164
97 3300005289 Ga0065704_10098235 Ga0065704_100982353 164
98 3300005295 Ga0065707_10082002 Ga0065707_100820026 164
99 3300005295 Ga0065707_10082223 Ga0065707_1008222312 164
100 3300005335 Ga0070666_10018802 Ga0070666_100188023 164
101 3300005353 Ga0070669_100000398 Ga0070669_10000039816 164
102 3300005353 Ga0070669_100257173 Ga0070669_1002571732 164
103 3300005355 Ga0070671_100000248 Ga0070671_10000024821 164
104 3300005355 Ga0070671_100000347 Ga0070671_1000003472 164
105 3300005367 Ga0070667_100004174 Ga0070667_1000041748 164
106 3300005367 Ga0070667_100008754 Ga0070667_1000087542 164
107 3300005367 Ga0070667_100495806 Ga0070667_1004958062 164
108 3300005543 Ga0070672_101392712 Ga0070672_1013927121 164
109 3300005548 Ga0070665_100000896 Ga0070665_1000008964 164
110 3300005548 Ga0070665_100001096 Ga0070665_10000109614 164
111 3300005548 Ga0070665_100056289 Ga0070665_1000562893 164
112 3300005617 Ga0068859_100014419 Ga0068859_10001441910 164
113 3300005719 Ga0068861_100009847 Ga0068861_1000098479 164
114 3300005719 Ga0068861_100981774 Ga0068861_1009817741 164
115 3300005841 Ga0068863_100003218 Ga0068863_1000032186 164
116 3300005841 Ga0068863_100005830 Ga0068863_1000058307 164
117 3300005842 Ga0068858_100001526 Ga0068858_10000152613 164
118 3300005842 Ga0068858_100116853 Ga0068858_1001168532 164
119 3300005842 Ga0068858_100190279 Ga0068858_1001902791 164
120 3300005843 Ga0068860_100009042 Ga0068860_1000090424 164
121 3300005843 Ga0068860_100025299 Ga0068860_1000252991 164
122 3300005844 Ga0068862_100012030 Ga0068862_1000120305 164
123 3300005844 Ga0068862_100020605 Ga0068862_1000206052 164
124 3300006846 Ga0075430_100095607 Ga0075430_1000956072 164
125 3300006931 Ga0097620_100014419 Ga0097620_10001441910 164
126 3300007265 Ga0099794_10012023 Ga0099794_100120234 164
127 3300007788 Ga0099795_10007517 Ga0099795_100075172 164
128 3300009092 Ga0105250_10453880 Ga0105250_104538801 164
129 3300009093 Ga0105240_10031399 Ga0105240_100313996 164
130 3300009093 Ga0105240_10097870 Ga0105240_100978703 164
131 3300009093 Ga0105240_12071557 Ga0105240_120715571 164
132 3300009101 Ga0105247_10000498 Ga0105247_1000049821 164
133 3300009177 Ga0105248_10011174 Ga0105248_100111742 164
134 3300009177 Ga0105248_10260790 Ga0105248_102607901 164
135 3300009545 Ga0105237_10158927 Ga0105237_101589273 164
136 3300009553 Ga0105249_10129586 Ga0105249_101295863 164
137 3300009553 Ga0105249_10252024 Ga0105249_102520242 164
138 3300010159 Ga0099796_10003854 Ga0099796_100038543 164
139 3300010375 Ga0105239_10313492 Ga0105239_103134922 164
140 3300013297 Ga0157378_10007322 Ga0157378_100073227 164
141 3300013306 Ga0163162_10255486 Ga0163162_102554862 164
142 3300013308 Ga0157375_10345910 Ga0157375_103459102 164
143 3300014325 Ga0163163_10012544 Ga0163163_100125447 164
144 3300014326 Ga0157380_10000630 Ga0157380_1000063018 164
145 3300014326 Ga0157380_10023265 Ga0157380_100232656 164
146 3300014968 Ga0157379_10054672 Ga0157379_100546724 164
147 3300014968 Ga0157379_10751074 Ga0157379_107510742 164
148 3300025245 Ga0207425_1000072 Ga0207425_100007239 164
149 3300025258 Ga0209129_1000734 Ga0209129_100073411 164
150 3300025263 Ga0209565_1000132 Ga0209565_100013228 164
151 3300025273 Ga0209673_1010920 Ga0209673_10109201 164
152 3300025294 Ga0209025_1003336 Ga0209025_10033362 164
153 3300025295 Ga0209564_1001899 Ga0209564_10018996 164
154 3300025295 Ga0209564_1017232 Ga0209564_10172322 164
155 3300025297 Ga0209758_1000009 Ga0209758_1000009675 164
156 3300025297 Ga0209758_1023237 Ga0209758_10232371 164
157 3300025298 Ga0209050_1022173 Ga0209050_10221732 164
158 3300025302 Ga0207426_1053154 Ga0207426_10531542 164
159 3300025900 Ga0207710_10000147 Ga0207710_1000014747 164
160 3300025913 Ga0207695_10014260 Ga0207695_100142603 164
161 3300025913 Ga0207695_10138467 Ga0207695_101384673 164
162 3300025914 Ga0207671_10121735 Ga0207671_101217351 164
163 3300025923 Ga0207681_10061596 Ga0207681_100615961 164
164 3300025925 Ga0207650_10043744 Ga0207650_100437441 164
165 3300025931 Ga0207644_10000366 Ga0207644_100003662 164
166 3300025931 Ga0207644_10005160 Ga0207644_100051608 164
167 3300025931 Ga0207644_10088705 Ga0207644_100887053 164
168 3300025940 Ga0207691_10767118 Ga0207691_107671182 164
169 3300025941 Ga0207711_10197111 Ga0207711_101971112 164
170 3300025986 Ga0207658_10011171 Ga0207658_100111715 164
171 3300025986 Ga0207658_10317153 Ga0207658_103171531 164
172 3300025986 Ga0207658_10516547 Ga0207658_105165472 164
173 3300026035 Ga0207703_10002044 Ga0207703_100020444 164
174 3300026088 Ga0207641_10013373 Ga0207641_100133734 164
175 3300026088 Ga0207641_10018142 Ga0207641_100181422 164
176 3300028379 Ga0268266_10000159 Ga0268266_1000015930 164
177 3300028379 Ga0268266_10003742 Ga0268266_100037424 164
178 3300028379 Ga0268266_10069357 Ga0268266_100693573 164
179 3300028381 Ga0268264_10006973 Ga0268264_1000697310 164
180 3300028794 Ga0307515_10042298 Ga0307515_100422985 164
181 3300030521 Ga0307511_10000028 Ga0307511_1000002816 164
182 3300031507 Ga0307509_10000025 Ga0307509_1000002568 164
183 3300031852 Ga0307410_10804058 Ga0307410_108040581 164
184 3300032005 Ga0307411_10243169 Ga0307411_102431692 164
185 3300032005 Ga0307411_10549224 Ga0307411_105492242 164
186 3300033179 Ga0307507_10344193 Ga0307507_103441932 164
187 3300035695 Ga0373927_0563081 Ga0373927_0563081_42_548 164
188 3300037853 Ga0436364_0876164 Ga0436364_0876164_387_884 164
189 3300039437 Ga0436365_0243813 Ga0436365_0243813_117_614 164
190 3300046501 Ga0495607_0017649 Ga0495607_0017649_3382_3879 164
191 3300046522 Ga0495643_0060903 Ga0495643_0060903_925_1422 164
192 3300046530 Ga0495654_0004203 Ga0495654_0004203_7490_8011 164
193 3300046616 Ga0495668_0053651 Ga0495668_0053651_653_1174 164
194 3300046660 Ga0495625_0001187 Ga0495625_0001187_31520_32074 164
195 3300046691 Ga0495670_0196709 Ga0495670_0196709_530_1051 164
196 3300047472 Ga0495686_0015271 Ga0495686_0015271_2191_2685 164
197 3300048905 Ga0496102_0001077 Ga0496102_0001077_4959_5459 164
198 3300048905 Ga0496102_0170154 Ga0496102_0170154_860_1357 164
199 3300048906 Ga0496103_0000687 Ga0496103_0000687_4959_5459 164
200 3300048909 Ga0496106_0296629 Ga0496106_0296629_521_1018 164
201 3300048912 Ga0496109_0683540 Ga0496109_0683540_102_599 164
202 3300048915 Ga0496112_0112731 Ga0496112_0112731_912_1409 164
203 3300048919 Ga0496116_0003018 Ga0496116_0003018_4933_5433 164
204 3300048919 Ga0496116_0153341 Ga0496116_0153341_340_855 164
205 3300048920 Ga0496117_0002210 Ga0496117_0002210_4959_5459 164
206 3300048921 Ga0496118_0002409 Ga0496118_0002409_4959_5459 164
207 3300048921 Ga0496118_0134621 Ga0496118_0134621_511_1026 164
208 3300048921 Ga0496118_0160320 Ga0496118_0160320_829_1326 164
209 3300048921 Ga0496118_0512736 Ga0496118_0512736_45_542 164
210 3300048922 Ga0496119_0016308 Ga0496119_0016308_1553_2053 164
211 3300048922 Ga0496119_0086806 Ga0496119_0086806_747_1262 164
212 3300048922 Ga0496119_0358051 Ga0496119_0358051_35_532 164
213 3300048923 Ga0496120_0331414 Ga0496120_0331414_13_528 164
214 3300048924 Ga0496121_0003373 Ga0496121_0003373_16149_16646 164
215 3300048924 Ga0496121_0015551 Ga0496121_0015551_102_617 164
216 3300048924 Ga0496121_0747300 Ga0496121_0747300_36_530 164
217 3300048927 Ga0496124_0002299 Ga0496124_0002299_19777_20277 164
218 3300048927 Ga0496124_0206536 Ga0496124_0206536_680_1195 164
219 3300048928 Ga0496125_0058826 Ga0496125_0058826_307_822 164
220 3300048928 Ga0496125_0348932 Ga0496125_0348932_59_631 164
221 3300048928 Ga0496125_0425269 Ga0496125_0425269_195_692 164
222 3300048929 Ga0496126_0105795 Ga0496126_0105795_1284_1799 164
223 3300048929 Ga0496126_0198598 Ga0496126_0198598_363_881 164
224 3300048929 Ga0496126_0320340 Ga0496126_0320340_51_632 164
225 3300049460 Ga0495682_0190505 Ga0495682_0190505_82_588 164
226 3300049583 Ga0501067_0215225 Ga0501067_0215225_333_830 164
227 3300050509 nmdc:mga0qj67_284255_c1 nmdc:mga0qj67_284255_c1_192_689 164
228 3300053087 Ga0500643_000250 Ga0500643_000250_44661_45182 164
229 3300053116 Ga0500592_000791 Ga0500592_000791_371_931 164
230 3300053121 Ga0500607_000188 Ga0500607_000188_20114_20638 164
231 3300053158 Ga0500627_0000945 Ga0500627_0000945_6673_7194 164
232 3300053158 Ga0500627_0061329 Ga0500627_0061329_139_648 164
233 3300053178 Ga0500637_0009309 Ga0500637_0009309_865_1371 164
234 3300053178 Ga0500637_0025440 Ga0500637_0025440_836_1417 164
235 3300053178 Ga0500637_0290523 Ga0500637_0290523_377_886 164
236 3300053727 Ga0500611_010857 Ga0500611_010857_422_982 164
237 3300001976 JGI24752J21851_1000372 JGI24752J21851_10003724 165
238 3300003320 rootH2_10236659 rootH2_102366592 165
239 3300005289 Ga0065704_10102855 Ga0065704_101028554 165
240 3300005331 Ga0070670_100000027 Ga0070670_100000027113 165
241 3300005331 Ga0070670_100510542 Ga0070670_1005105422 165
242 3300005335 Ga0070666_10370770 Ga0070666_103707701 165
243 3300005355 Ga0070671_100042746 Ga0070671_1000427464 165
244 3300005367 Ga0070667_100000638 Ga0070667_10000063830 165
245 3300005455 Ga0070663_100992383 Ga0070663_1009923831 165
246 3300005539 Ga0068853_100470281 Ga0068853_1004702812 165
247 3300005548 Ga0070665_100008392 Ga0070665_1000083922 165
248 3300005548 Ga0070665_100021887 Ga0070665_1000218877 165
249 3300005548 Ga0070665_100048315 Ga0070665_1000483152 165
250 3300005548 Ga0070665_100090275 Ga0070665_1000902755 165
251 3300005548 Ga0070665_100325615 Ga0070665_1003256152 165
252 3300005563 Ga0068855_100000864 Ga0068855_10000086416 165
253 3300005563 Ga0068855_100448707 Ga0068855_1004487072 165
254 3300005617 Ga0068859_100035574 Ga0068859_1000355745 165
255 3300005617 Ga0068859_100629623 Ga0068859_1006296232 165
256 3300005618 Ga0068864_100000083 Ga0068864_10000008397 165
257 3300005841 Ga0068863_100000025 Ga0068863_10000002597 165
258 3300005842 Ga0068858_100009745 Ga0068858_1000097453 165
259 3300005842 Ga0068858_100086339 Ga0068858_1000863392 165
260 3300005844 Ga0068862_100000027 Ga0068862_100000027117 165
261 3300005844 Ga0068862_100321545 Ga0068862_1003215452 165
262 3300005985 Ga0081539_10152223 Ga0081539_101522232 165
263 3300006846 Ga0075430_100093060 Ga0075430_1000930601 165
264 3300006847 Ga0075431_100000252 Ga0075431_10000025228 165
265 3300006931 Ga0097620_100035575 Ga0097620_1000355755 165
266 3300006931 Ga0097620_100629665 Ga0097620_1006296652 165
267 3300009011 Ga0105251_10000554 Ga0105251_1000055431 165
268 3300009093 Ga0105240_10002346 Ga0105240_1000234611 165
269 3300009093 Ga0105240_10176002 Ga0105240_101760022 165
270 3300009093 Ga0105240_10183870 Ga0105240_101838703 165
271 3300009093 Ga0105240_10317691 Ga0105240_103176913 165
272 3300009094 Ga0111539_10008631 Ga0111539_100086315 165
273 3300009101 Ga0105247_10006556 Ga0105247_100065563 165
274 3300009147 Ga0114129_10050160 Ga0114129_100501604 165
275 3300009147 Ga0114129_10496842 Ga0114129_104968422 165
276 3300009177 Ga0105248_10000026 Ga0105248_10000026121 165
277 3300009177 Ga0105248_12153010 Ga0105248_121530101 165
278 3300009545 Ga0105237_10042538 Ga0105237_100425384 165
279 3300009545 Ga0105237_10265445 Ga0105237_102654452 165
280 3300009551 Ga0105238_10099137 Ga0105238_100991373 165
281 3300009551 Ga0105238_10426187 Ga0105238_104261872 165
282 3300009553 Ga0105249_10000123 Ga0105249_10000123103 165
283 3300009553 Ga0105249_10239794 Ga0105249_102397941 165
284 3300010375 Ga0105239_10163924 Ga0105239_101639243 165
285 3300011119 Ga0105246_10012636 Ga0105246_100126365 165
286 3300014325 Ga0163163_10124540 Ga0163163_101245402 165
287 3300014325 Ga0163163_10156368 Ga0163163_101563683 165
288 3300014325 Ga0163163_10339381 Ga0163163_103393813 165
289 3300014325 Ga0163163_10986687 Ga0163163_109866872 165
290 3300014968 Ga0157379_10048235 Ga0157379_100482352 165
291 3300014969 Ga0157376_11428911 Ga0157376_114289111 165
292 3300025735 Ga0207713_1000615 Ga0207713_100061531 165
293 3300025900 Ga0207710_10027626 Ga0207710_100276265 165
294 3300025903 Ga0207680_10027523 Ga0207680_100275235 165
295 3300025913 Ga0207695_10013476 Ga0207695_100134767 165
296 3300025913 Ga0207695_10124806 Ga0207695_101248062 165
297 3300025913 Ga0207695_10179163 Ga0207695_101791632 165
298 3300025913 Ga0207695_10256336 Ga0207695_102563362 165
299 3300025913 Ga0207695_10904256 Ga0207695_109042562 165
300 3300025914 Ga0207671_10049367 Ga0207671_100493674 165
301 3300025914 Ga0207671_10549286 Ga0207671_105492862 165
302 3300025924 Ga0207694_10448149 Ga0207694_104481492 165
303 3300025924 Ga0207694_10469346 Ga0207694_104693461 165
304 3300025925 Ga0207650_10000056 Ga0207650_1000005677 165
305 3300025941 Ga0207711_10000004 Ga0207711_10000004136 165
306 3300025949 Ga0207667_10008319 Ga0207667_100083197 165
307 3300025961 Ga0207712_10008880 Ga0207712_100088806 165
308 3300025961 Ga0207712_10739346 Ga0207712_107393461 165
309 3300025986 Ga0207658_10000251 Ga0207658_1000025156 165
310 3300026035 Ga0207703_10003560 Ga0207703_1000356010 165
311 3300026035 Ga0207703_10470954 Ga0207703_104709543 165
312 3300026041 Ga0207639_10257499 Ga0207639_102574993 165
313 3300026067 Ga0207678_10033205 Ga0207678_100332055 165
314 3300026078 Ga0207702_10998322 Ga0207702_109983222 165
315 3300026088 Ga0207641_10000018 Ga0207641_10000018219 165
316 3300026095 Ga0207676_10000027 Ga0207676_10000027164 165
317 3300027907 Ga0207428_10002282 Ga0207428_100022823 165
318 3300027907 Ga0207428_10004991 Ga0207428_100049915 165
319 3300028379 Ga0268266_10003965 Ga0268266_100039655 165
320 3300028379 Ga0268266_10013709 Ga0268266_100137097 165
321 3300028379 Ga0268266_10130297 Ga0268266_101302975 165
322 3300028380 Ga0268265_10000042 Ga0268265_10000042106 165
323 3300028786 Ga0307517_10184159 Ga0307517_101841591 165
324 3300031507 Ga0307509_10000581 Ga0307509_1000058118 165
325 3300031824 Ga0307413_10487609 Ga0307413_104876091 165
326 3300031824 Ga0307413_10636527 Ga0307413_106365272 165
327 3300031852 Ga0307410_10252097 Ga0307410_102520971 165
328 3300031903 Ga0307407_10922397 Ga0307407_109223971 165
329 3300031995 Ga0307409_100227844 Ga0307409_1002278442 165
330 3300031995 Ga0307409_100944784 Ga0307409_1009447842 165
331 3300033180 Ga0307510_10000002 Ga0307510_10000002275 165
332 3300033180 Ga0307510_10036411 Ga0307510_100364113 165
333 3300035113 Ga0373936_0027513 Ga0373936_0027513_830_1345 165
334 3300035113 Ga0373936_0029937 Ga0373936_0029937_1467_1985 165
335 3300037466 Ga0395898_0002405 Ga0395898_0002405_2683_3192 165
336 3300042014 Ga0439457_083103 Ga0439457_083103_31_534 165
337 3300042439 Ga0439464_0127146 Ga0439464_0127146_216_719 165
338 3300042993 Ga0439440_0067146 Ga0439440_0067146_257_760 165
339 3300045049 Ga0466959_0117517 Ga0466959_0117517_189_698 165
340 3300046460 Ga0495638_0030893 Ga0495638_0030893_1447_1950 165
341 3300046500 Ga0495596_0000054 Ga0495596_0000054_23549_24049 165
342 3300046501 Ga0495607_0355277 Ga0495607_0355277_62_562 165
343 3300046507 Ga0495606_0180422 Ga0495606_0180422_209_721 165
344 3300046519 Ga0495632_0062224 Ga0495632_0062224_1041_1556 165
345 3300046519 Ga0495632_0096853 Ga0495632_0096853_618_1118 165
346 3300046524 Ga0495648_0061248 Ga0495648_0061248_848_1360 165
347 3300046538 Ga0495609_0004316 Ga0495609_0004316_5352_5852 165
348 3300046538 Ga0495609_0098583 Ga0495609_0098583_424_939 165
349 3300046648 Ga0495611_0224411 Ga0495611_0224411_238_741 165
350 3300046660 Ga0495625_0052793 Ga0495625_0052793_2194_2694 165
351 3300046660 Ga0495625_0052958 Ga0495625_0052958_1540_2052 165
352 3300046660 Ga0495625_0316987 Ga0495625_0316987_416_919 165
353 3300047443 Ga0495687_027325 Ga0495687_027325_19_534 165
354 3300048905 Ga0496102_0000529 Ga0496102_0000529_32853_33350 165
355 3300048905 Ga0496102_0535873 Ga0496102_0535873_390_902 165
356 3300048906 Ga0496103_0000358 Ga0496103_0000358_8008_8505 165
357 3300048906 Ga0496103_0026083 Ga0496103_0026083_206_718 165
358 3300048908 Ga0496105_0151623 Ga0496105_0151623_1307_1804 165
359 3300048919 Ga0496116_0000750 Ga0496116_0000750_32746_33243 165
360 3300048919 Ga0496116_0020341 Ga0496116_0020341_1892_2395 165
361 3300048919 Ga0496116_0020691 Ga0496116_0020691_3133_3645 165
362 3300048920 Ga0496117_0000054 Ga0496117_0000054_273648_274160 165
363 3300048920 Ga0496117_0001078 Ga0496117_0001078_8008_8505 165
364 3300048920 Ga0496117_0002463 Ga0496117_0002463_15814_16326 165
365 3300048920 Ga0496117_0070846 Ga0496117_0070846_1185_1688 165
366 3300048921 Ga0496118_0000195 Ga0496118_0000195_57796_58308 165
367 3300048921 Ga0496118_0000262 Ga0496118_0000262_2824_3336 165
368 3300048921 Ga0496118_0001124 Ga0496118_0001124_32853_33350 165
369 3300048921 Ga0496118_0042209 Ga0496118_0042209_2384_2887 165
370 3300048921 Ga0496118_0125979 Ga0496118_0125979_100_612 165
371 3300048922 Ga0496119_0002547 Ga0496119_0002547_5617_6129 165
372 3300048922 Ga0496119_0004480 Ga0496119_0004480_5814_6326 165
373 3300048922 Ga0496119_0090543 Ga0496119_0090543_1193_1690 165
374 3300048922 Ga0496119_0132838 Ga0496119_0132838_341_844 165
375 3300048923 Ga0496120_0000558 Ga0496120_0000558_45720_46232 165
376 3300048923 Ga0496120_0016551 Ga0496120_0016551_1049_1561 165
377 3300048924 Ga0496121_0013117 Ga0496121_0013117_6384_6896 165
378 3300048924 Ga0496121_0099223 Ga0496121_0099223_514_1026 165
379 3300048927 Ga0496124_0001157 Ga0496124_0001157_8008_8505 165
380 3300048927 Ga0496124_0007454 Ga0496124_0007454_4175_4687 165
381 3300048927 Ga0496124_0029380 Ga0496124_0029380_831_1334 165
382 3300048928 Ga0496125_0000289 Ga0496125_0000289_52558_53070 165
383 3300048928 Ga0496125_0044522 Ga0496125_0044522_2269_2781 165
384 3300048928 Ga0496125_0252224 Ga0496125_0252224_174_686 165
385 3300048929 Ga0496126_0007938 Ga0496126_0007938_3857_4369 165
386 3300048929 Ga0496126_0043879 Ga0496126_0043879_1556_2068 165
387 3300048929 Ga0496126_0050188 Ga0496126_0050188_3185_3697 165
388 3300049460 Ga0495682_0193952 Ga0495682_0193952_143_652 165
389 3300049580 Ga0501046_0125413 Ga0501046_0125413_1088_1648 165
390 3300049580 Ga0501046_1004023 Ga0501046_1004023_61_564 165
391 3300049581 Ga0501047_0207476 Ga0501047_0207476_284_787 165
392 3300049581 Ga0501047_0246750 Ga0501047_0246750_42_545 165
393 3300050507 nmdc:mga05p37_23502_c1 nmdc:mga05p37_23502_c1_2810_3313 165
394 3300050508 nmdc:mga09592_145_c1 nmdc:mga09592_145_c1_6120_6623 165
395 3300050509 nmdc:mga0qj67_56338_c1 nmdc:mga0qj67_56338_c1_729_1232 165
396 3300050510 nmdc:mga06r32_40_c1 nmdc:mga06r32_40_c1_54212_54715 165
397 3300050511 nmdc:mga08y16_148_c1 nmdc:mga08y16_148_c1_35975_36478 165
398 3300050511 nmdc:mga08y16_3044_c1 nmdc:mga08y16_3044_c1_6671_7180 165
399 3300053087 Ga0500643_000203 Ga0500643_000203_33939_34439 165
400 3300053118 Ga0500594_0004104 Ga0500594_0004104_851_1351 165
401 3300053131 Ga0500652_206735 Ga0500652_206735_223_726 165
402 3300053136 Ga0500559_0152841 Ga0500559_0152841_186_710 165
403 3300053136 Ga0500559_0246012 Ga0500559_0246012_29_529 165
404 3300053139 Ga0500568_0061295 Ga0500568_0061295_54_554 165
405 3300053146 Ga0500588_0010348 Ga0500588_0010348_662_1195 165
406 3300053146 Ga0500588_0242877 Ga0500588_0242877_110_625 165
407 3300053151 Ga0500604_0199910 Ga0500604_0199910_163_672 165
408 3300053153 Ga0500616_0065178 Ga0500616_0065178_630_1145 165
409 3300053156 Ga0500622_0002161 Ga0500622_0002161_12858_13361 165
410 3300053156 Ga0500622_0002233 Ga0500622_0002233_11085_11588 165
411 3300053159 Ga0500630_040713 Ga0500630_040713_999_1523 165
412 3300053178 Ga0500637_0116335 Ga0500637_0116335_463_981 165
413 iso_pu_bacteria 2818991438 2819550964 165
414 2162886007 SwRhRL2b_contig_3113019 SwRhRL2b_0805.00006540 166
415 3300003791 Ga0055530_10014187 Ga0055530_100141872 166
416 3300005289 Ga0065704_10000192 Ga0065704_10000192208 166
417 3300005329 Ga0070683_100234550 Ga0070683_1002345502 166
418 3300005329 Ga0070683_100502089 Ga0070683_1005020891 166
419 3300005336 Ga0070680_100013453 Ga0070680_1000134534 166
420 3300005339 Ga0070660_100505017 Ga0070660_1005050172 166
421 3300005535 Ga0070684_100162241 Ga0070684_1001622412 166
422 3300005535 Ga0070684_100773278 Ga0070684_1007732781 166
423 3300005564 Ga0070664_100459340 Ga0070664_1004593402 166
424 3300005834 Ga0068851_10204373 Ga0068851_102043732 166
425 3300005841 Ga0068863_100002872 Ga0068863_10000287212 166
426 3300005843 Ga0068860_100001916 Ga0068860_10000191617 166
427 3300006175 Ga0070712_100420746 Ga0070712_1004207462 166
428 3300006186 Ga0075369_10145918 Ga0075369_101459181 166
429 3300006237 Ga0097621_100454073 Ga0097621_1004540732 166
430 3300006353 Ga0075370_10018935 Ga0075370_100189353 166
431 3300006358 Ga0068871_100273202 Ga0068871_1002732023 166
432 3300006358 Ga0068871_100512604 Ga0068871_1005126042 166
433 3300006847 Ga0075431_100435183 Ga0075431_1004351832 166
434 3300006880 Ga0075429_100529122 Ga0075429_1005291222 166
435 3300009093 Ga0105240_10224601 Ga0105240_102246011 166
436 3300009093 Ga0105240_10491663 Ga0105240_104916632 166
437 3300009094 Ga0111539_10201076 Ga0111539_102010761 166
438 3300009545 Ga0105237_10161823 Ga0105237_101618232 166
439 3300009545 Ga0105237_10192919 Ga0105237_101929192 166
440 3300009545 Ga0105237_10302944 Ga0105237_103029443 166
441 3300009551 Ga0105238_10892862 Ga0105238_108928622 166
442 3300010375 Ga0105239_10192213 Ga0105239_101922135 166
443 3300013306 Ga0163162_10095269 Ga0163162_100952695 166
444 3300013307 Ga0157372_10705573 Ga0157372_107055732 166
445 3300014968 Ga0157379_11206770 Ga0157379_112067701 166
446 3300014969 Ga0157376_11936824 Ga0157376_119368241 166
447 3300025298 Ga0209050_1001236 Ga0209050_100123613 166
448 3300025913 Ga0207695_10021679 Ga0207695_100216794 166
449 3300025914 Ga0207671_10067425 Ga0207671_100674252 166
450 3300025917 Ga0207660_10063810 Ga0207660_100638104 166
451 3300025921 Ga0207652_10119313 Ga0207652_101193133 166
452 3300025924 Ga0207694_10489968 Ga0207694_104899682 166
453 3300025928 Ga0207700_10132368 Ga0207700_101323682 166
454 3300025944 Ga0207661_10073642 Ga0207661_100736422 166
455 3300025944 Ga0207661_10565260 Ga0207661_105652602 166
456 3300025986 Ga0207658_10033146 Ga0207658_100331464 166
457 3300026041 Ga0207639_10031464 Ga0207639_100314645 166
458 3300026078 Ga0207702_10029583 Ga0207702_100295832 166
459 3300026088 Ga0207641_10000117 Ga0207641_1000011759 166
460 3300028381 Ga0268264_10000183 Ga0268264_10000183102 166
461 3300028573 Ga0265334_10024393 Ga0265334_100243932 166
462 3300031250 Ga0265331_10162312 Ga0265331_101623122 166
463 3300032004 Ga0307414_10003057 Ga0307414_100030574 166
464 3300042005 Ga0439448_0073186 Ga0439448_0073186_234_749 166
465 3300044684 Ga0466966_0841423 Ga0466966_0841423_17_529 166
466 3300046500 Ga0495596_0004170 Ga0495596_0004170_5912_6424 166
467 3300046512 Ga0495610_0000436 Ga0495610_0000436_35694_36197 166
468 3300046512 Ga0495610_0003492 Ga0495610_0003492_4966_5478 166
469 3300046522 Ga0495643_0000042 Ga0495643_0000042_205657_206160 166
470 3300046558 Ga0495633_0042387 Ga0495633_0042387_1615_2118 166
471 3300048091 Ga0495626_0000436 Ga0495626_0000436_2478_2990 166
472 3300048918 Ga0496115_0084120 Ga0496115_0084120_80_667 166
473 3300048919 Ga0496116_0000017 Ga0496116_0000017_252666_253169 166
474 3300048920 Ga0496117_0140496 Ga0496117_0140496_756_1259 166
475 3300048921 Ga0496118_0010987 Ga0496118_0010987_7966_8469 166
476 3300048924 Ga0496121_0002831 Ga0496121_0002831_15472_15984 166
477 3300048925 Ga0496122_0026373 Ga0496122_0026373_2975_3478 166
478 3300048926 Ga0496123_0001455 Ga0496123_0001455_7123_7626 166
479 3300048927 Ga0496124_0022383 Ga0496124_0022383_2189_2692 166
480 3300048927 Ga0496124_0022420 Ga0496124_0022420_2154_2666 166
481 3300048928 Ga0496125_0003926 Ga0496125_0003926_15762_16265 166
482 3300048929 Ga0496126_0038029 Ga0496126_0038029_618_1121 166
483 3300048929 Ga0496126_0923759 Ga0496126_0923759_133_645 166
484 3300049581 Ga0501047_0176820 Ga0501047_0176820_1320_1820 166
485 3300050489 nmdc:mga03683_41_c1 nmdc:mga03683_41_c1_14727_15266 166
486 3300050491 nmdc:mga00v17_278110_c1 nmdc:mga00v17_278110_c1_199_738 166
487 3300050493 nmdc:mga0k408_6801_c1 nmdc:mga0k408_6801_c1_2345_2884 166
488 3300050496 nmdc:mga07m45_16_c1 nmdc:mga07m45_16_c1_68057_68596 166
489 3300050508 nmdc:mga09592_487304_c1 nmdc:mga09592_487304_c1_187_717 166
490 3300050510 nmdc:mga06r32_389424_c1 nmdc:mga06r32_389424_c1_232_762 166
491 3300053087 Ga0500643_000121 Ga0500643_000121_34576_35082 166
492 3300053138 Ga0500564_270193 Ga0500564_270193_78_602 166
493 3300053148 Ga0500590_000691 Ga0500590_000691_1844_2368 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00710

Asparaginase

Asparaginase, N-terminal

10

166

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6paa-assembly1.cif.gz_B-2 e. coli l-asparaginase ii mutant (t12v) in complex with l-asp at ph 5.5 0.8606 7 156
7r5q-assembly2.cif.gz_D-3 escherichia coli type ii asparaginase n24s mutant in complex with glu 0.8568 7 156
5b74-assembly1.cif.gz_A crystal structure of conjoined pyrococcus furiosus l-asparaginase with peptide 0.8528 7 165
6pab-assembly2.cif.gz_D-3 e. coli l-asparaginase ii in complex with l-asp at ph 7.0 0.8527 7 156
6pa4-assembly1.cif.gz_B-2 e. coli l-asparaginase ii double mutant (t89v,k162t) in complex with l-asp at ph 7.0 0.8521 7 155
ID Description Score Start End Superfamily
af_Q2FYF4_1_206_3.40.50.1170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8537 7 156 3.40.50.1170
1wnfB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8508 7 165 3.40.50.1170
af_Q9VH61_12_241_3.40.50.1170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8329 7 156 3.40.50.1170
2himB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8294 7 165 3.40.50.1170
af_P9WPX5_1_188_3.40.50.1170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;L-asparaginase, N-terminal domain 0.8141 7 166 3.40.50.1170
ID Description Score Start End GO Terms
AF-A0A3D2AR39-F1-model_v4 Asparaginase 0.9996 61 149 GO:0004067
AF-A0A3D2AR39-F1-model_v4 Asparaginase 0.9885 61 149 GO:0004067
AF-A0A286H7V7-F1-model_v4 Asparaginase 0.9864 91 166 GO:0004067
AF-A0A6I2JCW4-F1-model_v4 deleted 0.9829 43 131
AF-A0A356JBX2-F1-model_v4 deleted 0.9808 40 166

Feature Viewer

pLDDT pTM Quality
87.75 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map