F454290

General Info

Members Datasets Scaffolds Average Seq Length
492 239 486 194

Family's Representative Sequence

Representative Sequence 3300032126|Ga0307415_100049326|Ga0307415_1000493263
Length 213
Sequence MVYFSCAPHPRGLAKKTPDMYELFFQKLTGKVAFTPEEQEVIRHYLTPKKLRKRQYLLQEGDVCKHIAFVEKGVLRAYTVDDKGIEHIIQFAPEGWTISDLYSFMTGEGATYNIDALEDSELVLISRQAQEELLQKVPRYSDFIRLQITGAYLAMQKRLTSVLSLGVEERYSNLLKLYPDLVQRVPQHMIASYMGLTPETLSRVRRKMARKDS

Samples

Sample ID Description Type Environment
1 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
2 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
3 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
4 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
5 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
6 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
151 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
196 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
197 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
198 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
206 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
207 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
208 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
209 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
210 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
211 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
212 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
213 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
214 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
215 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
216 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
217 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
218 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
219 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
220 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
221 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
222 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
223 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
224 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
225 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
226 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
230 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
234 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
235 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
236 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
237 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
238 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 0
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 0
Rhizoplane 0.2
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 3.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10059655 3300003320 Bacteria 4283
2 rootL2_10047565 3300003322 Bacteria 4011
3 rootL2_10060049 3300003322 Bacteria 1655
4 rootL2_10066252 3300003322 Bacteria 3587
5 rootL2_10119527 3300003322 Unclassified 1476
6 rootL2_10269286 3300003322 Unclassified 1831
7 rootH1_10068010 3300003323 Bacteria 13848
8 rootH1_10201698 3300003323 Bacteria 2920
9 Ga0055531_10000547 3300003794 Bacteria 33330
10 Ga0055543_1032052 3300004625 Bacteria 914
11 Ga0065165_1000783 3300005262 Bacteria 42648
12 Ga0065714_10005223 3300005288 Bacteria 4341
13 Ga0065714_10141957 3300005288 Bacteria 1165
14 Ga0065704_10000434 3300005289 Bacteria 21011
15 Ga0065707_10279509 3300005295 Bacteria 1051
16 Ga0070658_10018091 3300005327 Bacteria 5637
17 Ga0070658_10073166 3300005327 Bacteria 2810
18 Ga0070658_10349552 3300005327 Bacteria 1265
19 Ga0070658_10493979 3300005327 Bacteria 1057
20 Ga0070658_10989651 3300005327 Bacteria 731
21 Ga0070676_10160171 3300005328 Bacteria 1448
22 Ga0070683_100194082 3300005329 Bacteria 1928
23 Ga0070683_100238624 3300005329 Unclassified 1729
24 Ga0070683_100397718 3300005329 Bacteria 1314
25 Ga0070690_100004064 3300005330 Bacteria 8098
26 Ga0070690_100074283 3300005330 Bacteria 2214
27 Ga0070670_100067183 3300005331 Bacteria 3077
28 Ga0070670_100548416 3300005331 Bacteria 1031
29 Ga0070677_10029966 3300005333 Unclassified 2068
30 Ga0070677_10206131 3300005333 Bacteria 952
31 Ga0068869_100025882 3300005334 Bacteria 4079
32 Ga0068869_100170529 3300005334 Bacteria 1700
33 Ga0070666_10086777 3300005335 Bacteria 2145
34 Ga0070666_10494669 3300005335 Unclassified 886
35 Ga0070680_100044464 3300005336 Bacteria 3608
36 Ga0070680_100055428 3300005336 Bacteria 3239
37 Ga0070680_100196788 3300005336 Bacteria 1699
38 Ga0070682_100042786 3300005337 Bacteria 2799
39 Ga0070682_100492581 3300005337 Bacteria 948
40 Ga0068868_100078830 3300005338 Bacteria 2637
41 Ga0068868_100608702 3300005338 Bacteria 969
42 Ga0070660_100023659 3300005339 Bacteria 4553
43 Ga0070660_100030483 3300005339 Bacteria 4047
44 Ga0070660_100032498 3300005339 Bacteria 3927
45 Ga0070660_100040290 3300005339 Bacteria 3554
46 Ga0070660_100489035 3300005339 Bacteria 1023
47 Ga0070660_100890760 3300005339 Unclassified 750
48 Ga0070689_100255521 3300005340 Bacteria 1447
49 Ga0070661_100346230 3300005344 Bacteria 1165
50 Ga0070661_100666069 3300005344 Bacteria 846
51 Ga0070668_100950148 3300005347 Bacteria 770
52 Ga0070669_101279287 3300005353 Bacteria 635
53 Ga0070675_100035329 3300005354 Bacteria 4061
54 Ga0070675_100106859 3300005354 Bacteria 2363
55 Ga0070675_100944169 3300005354 Bacteria 791
56 Ga0070671_100056337 3300005355 Unclassified 3270
57 Ga0070674_100344086 3300005356 Bacteria 1202
58 Ga0070674_100714547 3300005356 Bacteria 858
59 Ga0070673_100071639 3300005364 Bacteria 2785
60 Ga0070673_100239540 3300005364 Bacteria 1577
61 Ga0070659_100004616 3300005366 Bacteria 9841
62 Ga0070659_100040009 3300005366 Bacteria 3662
63 Ga0070667_100028100 3300005367 Bacteria 4682
64 Ga0070701_10066530 3300005438 Bacteria 1915
65 Ga0070700_100425656 3300005441 Bacteria 1004
66 Ga0070678_100020105 3300005456 Bacteria 4374
67 Ga0070678_100048430 3300005456 Unclassified 3061
68 Ga0070678_100850488 3300005456 Bacteria 831
69 Ga0070681_10017834 3300005458 Bacteria 7094
70 Ga0070681_10053622 3300005458 Bacteria 4019
71 Ga0070681_10094742 3300005458 Bacteria 2934
72 Ga0070681_10170269 3300005458 Bacteria 2100
73 Ga0068867_100268461 3300005459 Bacteria 1394
74 Ga0068867_100832229 3300005459 Bacteria 826
75 Ga0070685_10103462 3300005466 Bacteria 1742
76 Ga0070679_100008912 3300005530 Bacteria 9466
77 Ga0070679_100033073 3300005530 Bacteria 5118
78 Ga0070679_100038687 3300005530 Bacteria 4742
79 Ga0070679_100062854 3300005530 Bacteria 3701
80 Ga0070679_100127702 3300005530 Bacteria 2524
81 Ga0070679_100166661 3300005530 Bacteria 2176
82 Ga0070679_100667278 3300005530 Bacteria 982
83 Ga0070684_100089178 3300005535 Bacteria 2741
84 Ga0068853_100084514 3300005539 Bacteria 2781
85 Ga0068853_100304675 3300005539 Bacteria 1473
86 Ga0068853_100682633 3300005539 Bacteria 979
87 Ga0068853_100866113 3300005539 Bacteria 867
88 Ga0070672_100202181 3300005543 Bacteria 1662
89 Ga0070672_100243346 3300005543 Bacteria 1514
90 Ga0070672_100593137 3300005543 Unclassified 964
91 Ga0070686_100012608 3300005544 Bacteria 4819
92 Ga0070686_100107660 3300005544 Bacteria 1894
93 Ga0070686_100144421 3300005544 Unclassified 1660
94 Ga0070696_100991432 3300005546 Unclassified 701
95 Ga0070665_100521532 3300005548 Bacteria 1200
96 Ga0068855_100002929 3300005563 Bacteria 20890
97 Ga0068855_100016232 3300005563 Bacteria 8955
98 Ga0068855_100026613 3300005563 Bacteria 6920
99 Ga0068855_100698194 3300005563 Unclassified 1086
100 Ga0068855_100884616 3300005563 Bacteria 944
101 Ga0070664_100076806 3300005564 Unclassified 2871
102 Ga0070664_100577575 3300005564 Bacteria 1041
103 Ga0070664_100594217 3300005564 Bacteria 1026
104 Ga0068857_100358914 3300005577 Bacteria 1351
105 Ga0068857_100651302 3300005577 Bacteria 998
106 Ga0068854_100061147 3300005578 Unclassified 2727
107 Ga0068854_100094985 3300005578 Bacteria 2225
108 Ga0068856_100033276 3300005614 Bacteria 5047
109 Ga0068856_100859106 3300005614 Bacteria 926
110 Ga0068856_101175719 3300005614 Bacteria 784
111 Ga0070702_100064973 3300005615 Bacteria 2136
112 Ga0068852_100002674 3300005616 Bacteria 12316
113 Ga0068852_100094203 3300005616 Unclassified 2686
114 Ga0068852_100253275 3300005616 Bacteria 1688
115 Ga0068852_100294431 3300005616 Bacteria 1569
116 Ga0068852_100454428 3300005616 Unclassified 1269
117 Ga0068866_10575850 3300005718 Bacteria 756
118 Ga0068861_100326670 3300005719 Bacteria 1338
119 Ga0068861_101171396 3300005719 Bacteria 742
120 Ga0068851_10151404 3300005834 Bacteria 1268
121 Ga0068863_100174387 3300005841 Bacteria 2063
122 Ga0068863_100374239 3300005841 Bacteria 1390
123 Ga0068858_100181258 3300005842 Unclassified 1989
124 Ga0068858_101186595 3300005842 Bacteria 750
125 Ga0068860_100000103 3300005843 Bacteria 139076
126 Ga0070715_10148234 3300006163 Bacteria 1147
127 Ga0075366_10000267 3300006195 Bacteria 23116
128 Ga0075366_10002159 3300006195 Bacteria 10022
129 Ga0075366_10280698 3300006195 Bacteria 1018
130 Ga0097621_100417583 3300006237 Unclassified 1204
131 Ga0097621_100431744 3300006237 Unclassified 1184
132 Ga0097621_100945807 3300006237 Unclassified 804
133 Ga0068871_100048524 3300006358 Bacteria 3428
134 Ga0068871_100649874 3300006358 Unclassified 963
135 Ga0068871_101149623 3300006358 Bacteria 727
136 Ga0075429_100595884 3300006880 Bacteria 968
137 Ga0068865_100442794 3300006881 Bacteria 1073
138 Ga0105240_10031537 3300009093 Bacteria 6872
139 Ga0105240_10149391 3300009093 Bacteria 2785
140 Ga0111539_10162815 3300009094 Bacteria 2609
141 Ga0111539_11024817 3300009094 Bacteria 959
142 Ga0105241_10006659 3300009174 Bacteria 8501
143 Ga0105241_10557929 3300009174 Bacteria 1029
144 Ga0105242_10034759 3300009176 Bacteria 4041
145 Ga0105242_10096908 3300009176 Bacteria 2493
146 Ga0105242_10849262 3300009176 Bacteria 908
147 Ga0105248_10478351 3300009177 Bacteria 1404
148 Ga0105237_10034528 3300009545 Bacteria 5120
149 Ga0105239_10025624 3300010375 Bacteria 6494
150 Ga0105239_10088742 3300010375 Bacteria 3410
151 Ga0105239_10346824 3300010375 Bacteria 1676
152 Ga0105246_10131740 3300011119 Bacteria 1868
153 Ga0157373_10000715 3300013100 Bacteria 25990
154 Ga0157373_10000773 3300013100 Bacteria 24671
155 Ga0157373_10009211 3300013100 Bacteria 7301
156 Ga0157373_10013271 3300013100 Bacteria 6046
157 Ga0157373_10061230 3300013100 Bacteria 2666
158 Ga0157373_10137532 3300013100 Bacteria 1718
159 Ga0157373_10176881 3300013100 Bacteria 1502
160 Ga0157371_10000584 3300013102 Bacteria 43265
161 Ga0157371_10001101 3300013102 Bacteria 29303
162 Ga0157371_10001748 3300013102 Bacteria 22014
163 Ga0157371_10005044 3300013102 Bacteria 11291
164 Ga0157371_10038391 3300013102 Bacteria 3427
165 Ga0157371_10061701 3300013102 Unclassified 2658
166 Ga0157371_10125654 3300013102 Bacteria 1824
167 Ga0157371_10312601 3300013102 Bacteria 1139
168 Ga0157371_10336716 3300013102 Bacteria 1097
169 Ga0157370_10000821 3300013104 Bacteria 39240
170 Ga0157370_10003789 3300013104 Bacteria 17648
171 Ga0157370_10012968 3300013104 Bacteria 8614
172 Ga0157370_10067444 3300013104 Bacteria 3382
173 Ga0157370_10118858 3300013104 Bacteria 2468
174 Ga0157370_10126713 3300013104 Bacteria 2383
175 Ga0157370_10434975 3300013104 Bacteria 1206
176 Ga0157370_10475696 3300013104 Unclassified 1148
177 Ga0157369_10000403 3300013105 Bacteria 57592
178 Ga0157369_10003166 3300013105 Bacteria 19645
179 Ga0157369_10007205 3300013105 Bacteria 12816
180 Ga0157369_10045270 3300013105 Unclassified 4787
181 Ga0157369_10190657 3300013105 Bacteria 2154
182 Ga0157369_10452867 3300013105 Unclassified 1329
183 Ga0157369_10457844 3300013105 Bacteria 1321
184 Ga0157374_10090571 3300013296 Bacteria 2916
185 Ga0157374_10243555 3300013296 Bacteria 1768
186 Ga0157374_11183470 3300013296 Unclassified 785
187 Ga0157378_10005693 3300013297 Bacteria 10904
188 Ga0157378_10669740 3300013297 Bacteria 1055
189 Ga0163162_10000269 3300013306 Bacteria 47344
190 Ga0163162_10006296 3300013306 Bacteria 11495
191 Ga0163162_10037892 3300013306 Unclassified 4812
192 Ga0163162_10151838 3300013306 Bacteria 2435
193 Ga0163162_10276104 3300013306 Bacteria 1812
194 Ga0157372_10001337 3300013307 Bacteria 26657
195 Ga0157372_10008116 3300013307 Bacteria 11166
196 Ga0157372_10049206 3300013307 Bacteria 4687
197 Ga0157372_10050140 3300013307 Bacteria 4644
198 Ga0157372_10086712 3300013307 Bacteria 3552
199 Ga0157372_10113843 3300013307 Bacteria 3101
200 Ga0157372_10166304 3300013307 Bacteria 2551
201 Ga0157372_10225668 3300013307 Unclassified 2172
202 Ga0157372_10267520 3300013307 Bacteria 1986
203 Ga0157372_10410370 3300013307 Bacteria 1578
204 Ga0157372_10787987 3300013307 Unclassified 1105
205 Ga0157372_11760341 3300013307 Unclassified 713
206 Ga0157372_12005635 3300013307 Unclassified 665
207 Ga0157375_10069107 3300013308 Bacteria 3537
208 Ga0157375_10114919 3300013308 Bacteria 2794
209 Ga0157375_10208838 3300013308 Bacteria 2109
210 Ga0157375_11272453 3300013308 Bacteria 864
211 Ga0163163_10200698 3300014325 Unclassified 2043
212 Ga0157380_10170542 3300014326 Unclassified 1901
213 Ga0157380_10678250 3300014326 Bacteria 1032
214 Ga0157380_10929981 3300014326 Unclassified 898
215 Ga0157377_10099110 3300014745 Unclassified 1733
216 Ga0157377_10522961 3300014745 Unclassified 833
217 Ga0157379_10151750 3300014968 Bacteria 2090
218 Ga0157376_10100219 3300014969 Bacteria 2529
219 Ga0157376_10658249 3300014969 Bacteria 1048
220 Ga0157376_11406742 3300014969 Bacteria 729
221 Ga0182006_1015245 3300015261 Bacteria 3297
222 Ga0163161_10036180 3300017792 Bacteria 3536
223 Ga0163161_10396689 3300017792 Bacteria 1106
224 Ga0209257_1000008 3300025304 Bacteria 1294570
225 Ga0207682_10034226 3300025893 Bacteria 2047
226 Ga0207642_10760752 3300025899 Bacteria 614
227 Ga0207688_10046406 3300025901 Bacteria 2426
228 Ga0207680_10164704 3300025903 Bacteria 1489
229 Ga0207647_10073242 3300025904 Unclassified 2065
230 Ga0207647_10221644 3300025904 Unclassified 1090
231 Ga0207645_10034054 3300025907 Bacteria 3273
232 Ga0207645_10061658 3300025907 Unclassified 2396
233 Ga0207643_10140691 3300025908 Bacteria 1441
234 Ga0207643_10320118 3300025908 Bacteria 968
235 Ga0207705_10015359 3300025909 Bacteria 5493
236 Ga0207705_10042401 3300025909 Bacteria 3267
237 Ga0207705_10052154 3300025909 Unclassified 2944
238 Ga0207705_10250331 3300025909 Bacteria 1351
239 Ga0207705_10522677 3300025909 Bacteria 922
240 Ga0207705_10541175 3300025909 Bacteria 905
241 Ga0207705_10561211 3300025909 Bacteria 888
242 Ga0207654_10016950 3300025911 Unclassified 3802
243 Ga0207707_10035725 3300025912 Bacteria 4346
244 Ga0207707_10068590 3300025912 Bacteria 3090
245 Ga0207707_10226888 3300025912 Bacteria 1625
246 Ga0207707_10544497 3300025912 Unclassified 986
247 Ga0207707_10567092 3300025912 Bacteria 963
248 Ga0207695_10202691 3300025913 Bacteria 1897
249 Ga0207695_10208185 3300025913 Unclassified 1868
250 Ga0207695_10317856 3300025913 Bacteria 1447
251 Ga0207671_10004239 3300025914 Bacteria 13812
252 Ga0207671_10346423 3300025914 Bacteria 1178
253 Ga0207660_10046533 3300025917 Bacteria 3061
254 Ga0207660_10047899 3300025917 Bacteria 3024
255 Ga0207660_10537056 3300025917 Bacteria 950
256 Ga0207662_10025357 3300025918 Bacteria 3415
257 Ga0207657_10016002 3300025919 Bacteria 7241
258 Ga0207657_10023224 3300025919 Bacteria 5780
259 Ga0207657_10035971 3300025919 Bacteria 4435
260 Ga0207657_10048764 3300025919 Bacteria 3696
261 Ga0207657_10124824 3300025919 Bacteria 2115
262 Ga0207652_10000103 3300025921 Bacteria 91988
263 Ga0207652_10002216 3300025921 Bacteria 16580
264 Ga0207652_10098138 3300025921 Bacteria 2583
265 Ga0207652_10121463 3300025921 Bacteria 2324
266 Ga0207652_10253855 3300025921 Unclassified 1586
267 Ga0207652_10257070 3300025921 Bacteria 1575
268 Ga0207652_10394030 3300025921 Bacteria 1250
269 Ga0207652_10519489 3300025921 Bacteria 1071
270 Ga0207650_10125637 3300025925 Unclassified 2002
271 Ga0207650_10250600 3300025925 Bacteria 1433
272 Ga0207650_10782145 3300025925 Bacteria 808
273 Ga0207659_10442261 3300025926 Bacteria 1094
274 Ga0207659_10537890 3300025926 Bacteria 992
275 Ga0207659_10717334 3300025926 Bacteria 857
276 Ga0207644_10133843 3300025931 Bacteria 1901
277 Ga0207690_10128733 3300025932 Bacteria 1850
278 Ga0207690_10138474 3300025932 Bacteria 1790
279 Ga0207690_10393525 3300025932 Bacteria 1104
280 Ga0207706_10025883 3300025933 Bacteria 5254
281 Ga0207706_10309015 3300025933 Bacteria 1377
282 Ga0207686_10095357 3300025934 Bacteria 1974
283 Ga0207670_10699279 3300025936 Bacteria 839
284 Ga0207669_10135868 3300025937 Bacteria 1698
285 Ga0207704_10205299 3300025938 Bacteria 1446
286 Ga0207691_10058041 3300025940 Bacteria 3521
287 Ga0207691_10299610 3300025940 Unclassified 1381
288 Ga0207691_10316119 3300025940 Bacteria 1339
289 Ga0207691_11007321 3300025940 Bacteria 695
290 Ga0207689_10215436 3300025942 Bacteria 1587
291 Ga0207689_10450182 3300025942 Bacteria 1076
292 Ga0207689_10879480 3300025942 Bacteria 756
293 Ga0207661_10126202 3300025944 Bacteria 2186
294 Ga0207661_10370493 3300025944 Bacteria 1295
295 Ga0207667_10010940 3300025949 Bacteria 10574
296 Ga0207667_10147754 3300025949 Bacteria 2419
297 Ga0207667_10223496 3300025949 Bacteria 1929
298 Ga0207667_10465676 3300025949 Bacteria 1284
299 Ga0207667_10893091 3300025949 Bacteria 881
300 Ga0207667_11040786 3300025949 Bacteria 804
301 Ga0207651_10145319 3300025960 Bacteria 1838
302 Ga0207651_10168227 3300025960 Bacteria 1726
303 Ga0207712_10923977 3300025961 Bacteria 772
304 Ga0207640_10071303 3300025981 Unclassified 2340
305 Ga0207640_10107647 3300025981 Unclassified 1969
306 Ga0207703_10160187 3300026035 Bacteria 1970
307 Ga0207639_10050543 3300026041 Bacteria 3158
308 Ga0207639_10116674 3300026041 Bacteria 2186
309 Ga0207639_10168524 3300026041 Unclassified 1852
310 Ga0207678_10020096 3300026067 Bacteria 5866
311 Ga0207678_10448554 3300026067 Bacteria 1121
312 Ga0207702_10291757 3300026078 Bacteria 1545
313 Ga0207702_10697806 3300026078 Bacteria 1000
314 Ga0207702_10810299 3300026078 Bacteria 926
315 Ga0207641_10196924 3300026088 Bacteria 1855
316 Ga0207641_10217039 3300026088 Unclassified 1772
317 Ga0207641_11475271 3300026088 Bacteria 682
318 Ga0207648_10090349 3300026089 Bacteria 2676
319 Ga0207676_10103340 3300026095 Bacteria 2368
320 Ga0207674_10160942 3300026116 Bacteria 2199
321 Ga0207674_10194847 3300026116 Bacteria 1976
322 Ga0207675_100461791 3300026118 Bacteria 1260
323 Ga0207683_10061700 3300026121 Bacteria 3300
324 Ga0207683_10119901 3300026121 Bacteria 2361
325 Ga0207698_10210831 3300026142 Unclassified 1748
326 Ga0207698_10360050 3300026142 Bacteria 1377
327 Ga0207698_10440941 3300026142 Bacteria 1254
328 Ga0207698_10882300 3300026142 Bacteria 901
329 Ga0268264_10000013 3300028381 Bacteria 513859
330 Ga0307515_10001200 3300028794 Bacteria 59235
331 Ga0307515_10003151 3300028794 Bacteria 34898
332 Ga0265331_10039802 3300031250 Bacteria 2290
333 Ga0265327_10000090 3300031251 Bacteria 197158
334 Ga0307408_100122083 3300031548 Bacteria 2020
335 Ga0307516_10000750 3300031730 Bacteria 44208
336 Ga0307516_10108759 3300031730 Bacteria 2579
337 Ga0307413_10033480 3300031824 Bacteria 2927
338 Ga0307412_10000045 3300031911 Bacteria 165021
339 Ga0307412_10070427 3300031911 Bacteria 2384
340 Ga0307414_10010586 3300032004 Bacteria 5361
341 Ga0307414_10040587 3300032004 Bacteria 3145
342 Ga0307414_10065689 3300032004 Bacteria 2589
343 Ga0307414_10115768 3300032004 Bacteria 2051
344 Ga0307414_10263716 3300032004 Bacteria 1439
345 Ga0307414_10298692 3300032004 Unclassified 1361
346 Ga0307414_10303644 3300032004 Bacteria 1351
347 Ga0307414_10634199 3300032004 Unclassified 962
348 Ga0307414_10667733 3300032004 Unclassified 938
349 Ga0307414_11272229 3300032004 Bacteria 682
350 Ga0307411_10056388 3300032005 Unclassified 2590
351 Ga0307411_10272757 3300032005 Bacteria 1342
352 Ga0307415_100049326 3300032126 Bacteria 2846
353 Ga0373934_0016371 3300035086 Unclassified 2819
354 Ga0373944_0007847 3300035089 Bacteria 2871
355 Ga0373956_0127892 3300035119 Unclassified 1188
356 Ga0373955_0004521 3300035172 Bacteria 6161
357 Ga0373931_0268863 3300035691 Bacteria 1043
358 Ga0373935_0301566 3300035692 Unclassified 1132
359 Ga0373937_0025749 3300036401 Bacteria 5312
360 Ga0395899_0001903 3300037312 Bacteria 17213
361 Ga0395899_0012217 3300037312 Bacteria 6576
362 Ga0395899_0041997 3300037312 Bacteria 3415
363 Ga0395899_0061562 3300037312 Bacteria 2764
364 Ga0395899_0442568 3300037312 Unclassified 852
365 Ga0395900_0013876 3300037418 Bacteria 8221
366 Ga0395900_0026980 3300037418 Bacteria 5879
367 Ga0395900_0090633 3300037418 Bacteria 3143
368 Ga0395900_0091633 3300037418 Bacteria 3123
369 Ga0395900_0115678 3300037418 Bacteria 2752
370 Ga0395900_0143693 3300037418 Bacteria 2442
371 Ga0395900_0301136 3300037418 Bacteria 1589
372 Ga0395900_0828972 3300037418 Unclassified 851
373 Ga0395898_0004173 3300037466 Bacteria 15834
374 Ga0395898_0009255 3300037466 Bacteria 10358
375 Ga0395898_0035789 3300037466 Bacteria 4933
376 Ga0395898_0167565 3300037466 Bacteria 2100
377 Ga0395898_0268033 3300037466 Bacteria 1628
378 Ga0395905_0042319 3300037471 Bacteria 4274
379 Ga0395905_0058304 3300037471 Bacteria 3611
380 Ga0395901_0003994 3300038443 Bacteria 14853
381 Ga0395901_0009401 3300038443 Bacteria 9917
382 Ga0436365_1894240 3300039437 Bacteria 1093
383 Ga0439449_0002155 3300042007 Bacteria 7733
384 Ga0439449_0103545 3300042007 Bacteria 1053
385 Ga0439457_011430 3300042014 Bacteria 2020
386 Ga0451577_0151015 3300042876 Bacteria 2090
387 Ga0451577_0771116 3300042876 Unclassified 869
388 Ga0451577_0787798 3300042876 Bacteria 859
389 Ga0453684_0032353 3300044712 Bacteria 7323
390 Ga0453684_0050912 3300044712 Bacteria 5439
391 Ga0453684_0053964 3300044712 Bacteria 5241
392 Ga0466957_0001781 3300044842 Bacteria 11334
393 Ga0466957_0002689 3300044842 Bacteria 9609
394 Ga0466958_0362497 3300045836 Bacteria 934
395 Ga0495627_004415 3300046453 Bacteria 5893
396 Ga0495592_0011274 3300046454 Bacteria 6760
397 Ga0495638_0016688 3300046460 Bacteria 4912
398 Ga0495651_0239135 3300046462 Unclassified 1246
399 Ga0495653_0042268 3300046463 Unclassified 3551
400 Ga0495607_0028541 3300046501 Bacteria 3443
401 Ga0495608_0025634 3300046511 Unclassified 4026
402 Ga0495616_0011798 3300046513 Bacteria 4987
403 Ga0495616_0019098 3300046513 Bacteria 3746
404 Ga0495618_0099137 3300046514 Bacteria 1865
405 Ga0495618_0100385 3300046514 Unclassified 1852
406 Ga0495628_0019796 3300046516 Bacteria 5559
407 Ga0495630_0007562 3300046517 Bacteria 7766
408 Ga0495648_0015092 3300046524 Bacteria 5624
409 Ga0495652_0186988 3300046529 Unclassified 1584
410 Ga0495586_0051333 3300046535 Unclassified 2232
411 Ga0495587_0057095 3300046536 Unclassified 2296
412 Ga0495633_0000004 3300046558 Bacteria 370781
413 Ga0495667_0197500 3300046559 Unclassified 1288
414 Ga0495668_0002355 3300046616 Bacteria 15721
415 Ga0495625_0000691 3300046660 Bacteria 48010
416 Ga0495625_0001578 3300046660 Bacteria 27104
417 Ga0495661_0001005 3300046665 Bacteria 25358
418 Ga0495661_0139314 3300046665 Bacteria 1321
419 Ga0495613_0063552 3300046689 Unclassified 2701
420 Ga0495660_0095480 3300046810 Bacteria 1538
421 Ga0495684_0079011 3300047471 Unclassified 2497
422 Ga0495686_0000587 3300047472 Bacteria 51313
423 Ga0495686_0001710 3300047472 Bacteria 22659
424 Ga0496114_0446753 3300048917 Bacteria 1145
425 Ga0496126_0026400 3300048929 Bacteria 5569
426 Ga0495678_028959 3300049459 Unclassified 2330
427 Ga0501292_039786 3300049515 Bacteria 810
428 Ga0501297_001068 3300049520 Bacteria 2484
429 Ga0501298_000346 3300049521 Bacteria 6235
430 Ga0501299_045468 3300049522 Unclassified 893
431 Ga0501032_0184106 3300049569 Bacteria 1367
432 Ga0501033_0279448 3300049570 Unclassified 1179
433 Ga0501034_0111372 3300049571 Bacteria 2728
434 Ga0501034_0128350 3300049571 Unclassified 2520
435 Ga0501043_0339018 3300049579 Bacteria 1144
436 Ga0501047_0183121 3300049581 Bacteria 1961
437 Ga0501070_0027986 3300049586 Bacteria 4728
438 Ga0501198_001007 3300049649 Bacteria 3582
439 Ga0501201_000681 3300049651 Bacteria 3182
440 Ga0501202_000315 3300049652 Bacteria 6676
441 Ga0501206_007700 3300049653 Bacteria 1415
442 Ga0501207_003285 3300049654 Bacteria 2147
443 Ga0501217_001445 3300049661 Bacteria 4452
444 Ga0501222_009889 3300049662 Bacteria 1260
445 Ga0501223_000249 3300049663 Bacteria 13787
446 Ga0501223_000445 3300049663 Bacteria 9968
447 Ga0501223_055728 3300049663 Bacteria 769
448 Ga0501227_012996 3300049665 Bacteria 1829
449 Ga0501233_003190 3300049668 Bacteria 2942
450 Ga0501253_004210 3300049683 Bacteria 1798
451 Ga0501257_017430 3300049686 Bacteria 1671
452 Ga0501257_029647 3300049686 Bacteria 1315
453 Ga0501219_000018 3300049703 Bacteria 25770
454 Ga0501221_000242 3300049704 Bacteria 7912
455 Ga0501225_0000825 3300049705 Bacteria 9637
456 Ga0501225_0024564 3300049705 Unclassified 1659
457 Ga0501234_009583 3300049707 Bacteria 1512
458 Ga0501241_001740 3300049758 Bacteria 4326
459 Ga0501266_027792 3300049763 Bacteria 796
460 Ga0501268_043475 3300049765 Bacteria 852
461 Ga0501273_030021 3300049770 Bacteria 770
462 Ga0501275_013429 3300049772 Bacteria 917
463 Ga0501276_018010 3300049773 Bacteria 654
464 Ga0501035_0033880 3300049822 Unclassified 4643
465 Ga0501035_0161692 3300049822 Bacteria 1938
466 Ga0501035_0165947 3300049822 Bacteria 1910
467 Ga0501035_0414636 3300049822 Bacteria 1119
468 Ga0501044_0245633 3300049823 Bacteria 1733
469 Ga0501044_0731405 3300049823 Unclassified 873
470 Ga0501044_1035178 3300049823 Bacteria 692
471 Ga0501284_00010 3300050005 Bacteria 136120
472 nmdc:mga0k408_168_c2 3300050493 Bacteria 27329
473 nmdc:mga0k408_50701_c2 3300050493 Unclassified 1886
474 nmdc:mga0k408_83_c1 3300050493 Bacteria 44610
475 nmdc:mga09592_553549_c1 3300050508 Bacteria 988
476 nmdc:mga08y16_1338781_c1 3300050511 Bacteria 681
477 nmdc:mga08y16_224793_c1 3300050511 Bacteria 1942
478 nmdc:mga08y16_328190_c1 3300050511 Bacteria 1574
479 Ga0500646_0005478 3300053090 Bacteria 3210
480 Ga0500641_0000102 3300053096 Bacteria 33019
481 Ga0500561_0074546 3300053137 Unclassified 977
482 Ga0500622_0002517 3300053156 Bacteria 13158
483 Ga0500622_0003157 3300053156 Bacteria 11268
484 Ga0500637_0073082 3300053178 Bacteria 1974
485 Ga0500584_035009 3300053726 Bacteria 2322
486 Ga0466962_0062932 3300061719 Bacteria 1772

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0026400 Ga0496126_0026400_3634_4218 173
2 3300005719 Ga0068861_101171396 Ga0068861_1011713961 174
3 3300006880 Ga0075429_100595884 Ga0075429_1005958842 174
4 3300009094 Ga0111539_10162815 Ga0111539_101628155 174
5 3300050508 nmdc:mga09592_553549_c1 nmdc:mga09592_553549_c1_32_610 174
6 3300014745 Ga0157377_10522961 Ga0157377_105229611 175
7 3300005347 Ga0070668_100950148 Ga0070668_1009501481 176
8 3300025940 Ga0207691_10058041 Ga0207691_100580414 176
9 3300005333 Ga0070677_10206131 Ga0070677_102061311 177
10 3300005354 Ga0070675_100106859 Ga0070675_1001068593 177
11 3300005456 Ga0070678_100850488 Ga0070678_1008504881 177
12 3300005459 Ga0068867_100832229 Ga0068867_1008322291 177
13 3300005543 Ga0070672_100243346 Ga0070672_1002433462 177
14 3300006237 Ga0097621_100945807 Ga0097621_1009458071 177
15 3300005331 Ga0070670_100067183 Ga0070670_1000671832 178
16 3300005333 Ga0070677_10029966 Ga0070677_100299663 178
17 3300005456 Ga0070678_100020105 Ga0070678_1000201055 178
18 3300006237 Ga0097621_100417583 Ga0097621_1004175832 178
19 3300006358 Ga0068871_100649874 Ga0068871_1006498742 178
20 3300013104 Ga0157370_10003789 Ga0157370_100037895 178
21 3300013105 Ga0157369_10000403 Ga0157369_1000040335 178
22 3300013296 Ga0157374_11183470 Ga0157374_111834702 178
23 3300013308 Ga0157375_10069107 Ga0157375_100691072 178
24 3300014326 Ga0157380_10170542 Ga0157380_101705422 178
25 3300025893 Ga0207682_10034226 Ga0207682_100342262 178
26 3300025908 Ga0207643_10320118 Ga0207643_103201181 178
27 3300025925 Ga0207650_10250600 Ga0207650_102506001 178
28 3300025926 Ga0207659_10537890 Ga0207659_105378901 178
29 3300025940 Ga0207691_10299610 Ga0207691_102996101 178
30 3300026121 Ga0207683_10061700 Ga0207683_100617002 178
31 3300049579 Ga0501043_0339018 Ga0501043_0339018_494_1072 179
32 3300049581 Ga0501047_0183121 Ga0501047_0183121_1367_1945 179
33 3300049822 Ga0501035_0161692 Ga0501035_0161692_42_620 179
34 3300050511 nmdc:mga08y16_224793_c1 nmdc:mga08y16_224793_c1_510_1055 181
35 3300042876 Ga0451577_0787798 Ga0451577_0787798_136_714 183
36 3300044712 Ga0453684_0053964 Ga0453684_0053964_383_961 183
37 3300005329 Ga0070683_100397718 Ga0070683_1003977182 184
38 3300032004 Ga0307414_10667733 Ga0307414_106677331 184
39 iso_pu_bacteria 2585428060 2587749304 185
40 iso_pu_bacteria 2588253712 2588446690 185
41 3300046453 Ga0495627_004415 Ga0495627_004415_30_647 186
42 3300046501 Ga0495607_0028541 Ga0495607_0028541_1725_2342 186
43 3300046513 Ga0495616_0011798 Ga0495616_0011798_44_661 186
44 3300046810 Ga0495660_0095480 Ga0495660_0095480_320_937 186
45 3300053090 Ga0500646_0005478 Ga0500646_0005478_2330_2953 186
46 3300053096 Ga0500641_0000102 Ga0500641_0000102_6073_6696 186
47 3300053726 Ga0500584_035009 Ga0500584_035009_1274_1897 186
48 iso_pu_bacteria 2738541279 2738734554 186
49 iso_pu_bacteria 2738541285 2738767313 186
50 iso_pu_bacteria 2738543007 2739216136 186
51 iso_pu_bacteria 2910245624 2910247339 188
52 3300003322 rootL2_10047565 rootL2_100475652 189
53 3300003323 rootH1_10201698 rootH1_102016982 189
54 3300005288 Ga0065714_10005223 Ga0065714_100052233 189
55 3300005288 Ga0065714_10141957 Ga0065714_101419571 189
56 3300005616 Ga0068852_100454428 Ga0068852_1004544281 189
57 3300006195 Ga0075366_10000267 Ga0075366_1000026711 189
58 3300028794 Ga0307515_10003151 Ga0307515_1000315127 189
59 3300046558 Ga0495633_0000004 Ga0495633_0000004_326500_327084 189
60 3300046660 Ga0495625_0001578 Ga0495625_0001578_8654_9238 189
61 3300047472 Ga0495686_0001710 Ga0495686_0001710_11185_11754 189
62 3300050493 nmdc:mga0k408_83_c1 nmdc:mga0k408_83_c1_26673_27257 189
63 3300009093 Ga0105240_10031537 Ga0105240_100315378 190
64 3300025913 Ga0207695_10202691 Ga0207695_102026911 190
65 3300025926 Ga0207659_10442261 Ga0207659_104422612 190
66 3300047472 Ga0495686_0000587 Ga0495686_0000587_30459_31031 190
67 3300013307 Ga0157372_10787987 Ga0157372_107879871 191
68 3300026088 Ga0207641_10217039 Ga0207641_102170391 191
69 3300050493 nmdc:mga0k408_50701_c2 nmdc:mga0k408_50701_c2_1287_1862 191
70 3300053178 Ga0500637_0073082 Ga0500637_0073082_126_701 191
71 3300003322 rootL2_10066252 rootL2_100662522 192
72 3300003323 rootH1_10068010 rootH1_100680106 192
73 3300004625 Ga0055543_1032052 Ga0055543_10320521 192
74 3300005262 Ga0065165_1000783 Ga0065165_100078340 192
75 3300005289 Ga0065704_10000434 Ga0065704_1000043411 192
76 3300005331 Ga0070670_100548416 Ga0070670_1005484162 192
77 3300005354 Ga0070675_100035329 Ga0070675_1000353293 192
78 3300005354 Ga0070675_100944169 Ga0070675_1009441691 192
79 3300005356 Ga0070674_100344086 Ga0070674_1003440861 192
80 3300005564 Ga0070664_100594217 Ga0070664_1005942171 192
81 3300005843 Ga0068860_100000103 Ga0068860_10000010315 192
82 3300006237 Ga0097621_100431744 Ga0097621_1004317441 192
83 3300006358 Ga0068871_101149623 Ga0068871_1011496231 192
84 3300009094 Ga0111539_11024817 Ga0111539_110248172 192
85 3300009176 Ga0105242_10096908 Ga0105242_100969083 192
86 3300009176 Ga0105242_10849262 Ga0105242_108492621 192
87 3300010375 Ga0105239_10346824 Ga0105239_103468243 192
88 3300013100 Ga0157373_10000773 Ga0157373_100007734 192
89 3300013100 Ga0157373_10137532 Ga0157373_101375321 192
90 3300013102 Ga0157371_10125654 Ga0157371_101256541 192
91 3300013104 Ga0157370_10118858 Ga0157370_101188583 192
92 3300013306 Ga0163162_10000269 Ga0163162_1000026927 192
93 3300013306 Ga0163162_10151838 Ga0163162_101518382 192
94 3300013308 Ga0157375_10208838 Ga0157375_102088383 192
95 3300014326 Ga0157380_10678250 Ga0157380_106782503 192
96 3300015261 Ga0182006_1015245 Ga0182006_10152451 192
97 3300017792 Ga0163161_10396689 Ga0163161_103966891 192
98 3300025921 Ga0207652_10394030 Ga0207652_103940302 192
99 3300025926 Ga0207659_10717334 Ga0207659_107173341 192
100 3300025937 Ga0207669_10135868 Ga0207669_101358681 192
101 3300025961 Ga0207712_10923977 Ga0207712_109239771 192
102 3300028381 Ga0268264_10000013 Ga0268264_10000013305 192
103 3300028794 Ga0307515_10001200 Ga0307515_1000120046 192
104 3300031251 Ga0265327_10000090 Ga0265327_1000009068 192
105 3300031730 Ga0307516_10000750 Ga0307516_100007507 192
106 3300031730 Ga0307516_10108759 Ga0307516_101087593 192
107 3300031911 Ga0307412_10000045 Ga0307412_1000004536 192
108 3300032004 Ga0307414_10010586 Ga0307414_100105866 192
109 3300032004 Ga0307414_10065689 Ga0307414_100656894 192
110 3300032004 Ga0307414_10115768 Ga0307414_101157682 192
111 3300032004 Ga0307414_10263716 Ga0307414_102637162 192
112 3300032004 Ga0307414_10298692 Ga0307414_102986921 192
113 3300032004 Ga0307414_10303644 Ga0307414_103036442 192
114 3300032004 Ga0307414_10634199 Ga0307414_106341992 192
115 3300032005 Ga0307411_10272757 Ga0307411_102727572 192
116 3300037418 Ga0395900_0090633 Ga0395900_0090633_724_1302 192
117 3300042007 Ga0439449_0002155 Ga0439449_0002155_1934_2512 192
118 3300042014 Ga0439457_011430 Ga0439457_011430_71_649 192
119 3300046460 Ga0495638_0016688 Ga0495638_0016688_681_1274 192
120 3300046513 Ga0495616_0019098 Ga0495616_0019098_808_1410 192
121 3300046524 Ga0495648_0015092 Ga0495648_0015092_3095_3688 192
122 3300046616 Ga0495668_0002355 Ga0495668_0002355_13039_13617 192
123 3300046665 Ga0495661_0001005 Ga0495661_0001005_3883_4467 192
124 3300046665 Ga0495661_0139314 Ga0495661_0139314_682_1266 192
125 3300049459 Ga0495678_028959 Ga0495678_028959_566_1168 192
126 3300049515 Ga0501292_039786 Ga0501292_039786_213_791 192
127 3300049522 Ga0501299_045468 Ga0501299_045468_196_774 192
128 3300049683 Ga0501253_004210 Ga0501253_004210_977_1555 192
129 3300049686 Ga0501257_029647 Ga0501257_029647_193_771 192
130 3300049703 Ga0501219_000018 Ga0501219_000018_11953_12537 192
131 3300049765 Ga0501268_043475 Ga0501268_043475_16_594 192
132 3300049822 Ga0501035_0165947 Ga0501035_0165947_85_663 192
133 3300049823 Ga0501044_1035178 Ga0501044_1035178_91_669 192
134 3300050005 Ga0501284_00010 Ga0501284_00010_110519_111103 192
135 3300050511 nmdc:mga08y16_328190_c1 nmdc:mga08y16_328190_c1_540_1118 192
136 3300053137 Ga0500561_0074546 Ga0500561_0074546_308_886 192
137 3300053156 Ga0500622_0002517 Ga0500622_0002517_6152_6745 192
138 3300053156 Ga0500622_0003157 Ga0500622_0003157_5135_5713 192
139 3300003320 rootH2_10059655 rootH2_100596555 193
140 3300003322 rootL2_10060049 rootL2_100600492 193
141 3300003322 rootL2_10119527 rootL2_101195272 193
142 3300003322 rootL2_10269286 rootL2_102692863 193
143 3300003794 Ga0055531_10000547 Ga0055531_1000054720 193
144 3300005295 Ga0065707_10279509 Ga0065707_102795092 193
145 3300005327 Ga0070658_10018091 Ga0070658_100180912 193
146 3300005327 Ga0070658_10073166 Ga0070658_100731663 193
147 3300005327 Ga0070658_10349552 Ga0070658_103495522 193
148 3300005327 Ga0070658_10493979 Ga0070658_104939792 193
149 3300005327 Ga0070658_10989651 Ga0070658_109896511 193
150 3300005328 Ga0070676_10160171 Ga0070676_101601711 193
151 3300005329 Ga0070683_100194082 Ga0070683_1001940822 193
152 3300005329 Ga0070683_100238624 Ga0070683_1002386243 193
153 3300005330 Ga0070690_100004064 Ga0070690_1000040643 193
154 3300005330 Ga0070690_100074283 Ga0070690_1000742832 193
155 3300005334 Ga0068869_100025882 Ga0068869_1000258823 193
156 3300005334 Ga0068869_100170529 Ga0068869_1001705292 193
157 3300005335 Ga0070666_10086777 Ga0070666_100867771 193
158 3300005335 Ga0070666_10494669 Ga0070666_104946691 193
159 3300005336 Ga0070680_100044464 Ga0070680_1000444642 193
160 3300005336 Ga0070680_100055428 Ga0070680_1000554283 193
161 3300005336 Ga0070680_100196788 Ga0070680_1001967882 193
162 3300005337 Ga0070682_100042786 Ga0070682_1000427864 193
163 3300005337 Ga0070682_100492581 Ga0070682_1004925811 193
164 3300005338 Ga0068868_100078830 Ga0068868_1000788301 193
165 3300005338 Ga0068868_100608702 Ga0068868_1006087022 193
166 3300005339 Ga0070660_100023659 Ga0070660_1000236592 193
167 3300005339 Ga0070660_100030483 Ga0070660_1000304832 193
168 3300005339 Ga0070660_100032498 Ga0070660_1000324982 193
169 3300005339 Ga0070660_100040290 Ga0070660_1000402901 193
170 3300005339 Ga0070660_100489035 Ga0070660_1004890352 193
171 3300005339 Ga0070660_100890760 Ga0070660_1008907601 193
172 3300005340 Ga0070689_100255521 Ga0070689_1002555212 193
173 3300005344 Ga0070661_100346230 Ga0070661_1003462302 193
174 3300005344 Ga0070661_100666069 Ga0070661_1006660691 193
175 3300005353 Ga0070669_101279287 Ga0070669_1012792871 193
176 3300005355 Ga0070671_100056337 Ga0070671_1000563373 193
177 3300005356 Ga0070674_100714547 Ga0070674_1007145471 193
178 3300005364 Ga0070673_100071639 Ga0070673_1000716392 193
179 3300005364 Ga0070673_100239540 Ga0070673_1002395402 193
180 3300005366 Ga0070659_100004616 Ga0070659_1000046169 193
181 3300005366 Ga0070659_100040009 Ga0070659_1000400094 193
182 3300005367 Ga0070667_100028100 Ga0070667_1000281003 193
183 3300005438 Ga0070701_10066530 Ga0070701_100665301 193
184 3300005441 Ga0070700_100425656 Ga0070700_1004256562 193
185 3300005456 Ga0070678_100048430 Ga0070678_1000484302 193
186 3300005458 Ga0070681_10017834 Ga0070681_100178346 193
187 3300005458 Ga0070681_10053622 Ga0070681_100536226 193
188 3300005458 Ga0070681_10094742 Ga0070681_100947422 193
189 3300005458 Ga0070681_10170269 Ga0070681_101702692 193
190 3300005459 Ga0068867_100268461 Ga0068867_1002684611 193
191 3300005466 Ga0070685_10103462 Ga0070685_101034622 193
192 3300005530 Ga0070679_100008912 Ga0070679_1000089124 193
193 3300005530 Ga0070679_100033073 Ga0070679_1000330737 193
194 3300005530 Ga0070679_100038687 Ga0070679_1000386872 193
195 3300005530 Ga0070679_100062854 Ga0070679_1000628542 193
196 3300005530 Ga0070679_100127702 Ga0070679_1001277024 193
197 3300005530 Ga0070679_100166661 Ga0070679_1001666612 193
198 3300005530 Ga0070679_100667278 Ga0070679_1006672781 193
199 3300005535 Ga0070684_100089178 Ga0070684_1000891784 193
200 3300005539 Ga0068853_100084514 Ga0068853_1000845142 193
201 3300005539 Ga0068853_100304675 Ga0068853_1003046752 193
202 3300005539 Ga0068853_100682633 Ga0068853_1006826332 193
203 3300005539 Ga0068853_100866113 Ga0068853_1008661131 193
204 3300005543 Ga0070672_100202181 Ga0070672_1002021813 193
205 3300005543 Ga0070672_100593137 Ga0070672_1005931371 193
206 3300005544 Ga0070686_100012608 Ga0070686_1000126083 193
207 3300005544 Ga0070686_100107660 Ga0070686_1001076603 193
208 3300005544 Ga0070686_100144421 Ga0070686_1001444212 193
209 3300005546 Ga0070696_100991432 Ga0070696_1009914321 193
210 3300005548 Ga0070665_100521532 Ga0070665_1005215322 193
211 3300005563 Ga0068855_100002929 Ga0068855_10000292916 193
212 3300005563 Ga0068855_100016232 Ga0068855_1000162321 193
213 3300005563 Ga0068855_100026613 Ga0068855_1000266135 193
214 3300005563 Ga0068855_100698194 Ga0068855_1006981942 193
215 3300005563 Ga0068855_100884616 Ga0068855_1008846161 193
216 3300005564 Ga0070664_100076806 Ga0070664_1000768063 193
217 3300005564 Ga0070664_100577575 Ga0070664_1005775751 193
218 3300005577 Ga0068857_100358914 Ga0068857_1003589142 193
219 3300005577 Ga0068857_100651302 Ga0068857_1006513022 193
220 3300005578 Ga0068854_100061147 Ga0068854_1000611473 193
221 3300005578 Ga0068854_100094985 Ga0068854_1000949852 193
222 3300005614 Ga0068856_100033276 Ga0068856_1000332766 193
223 3300005614 Ga0068856_100859106 Ga0068856_1008591062 193
224 3300005614 Ga0068856_101175719 Ga0068856_1011757191 193
225 3300005615 Ga0070702_100064973 Ga0070702_1000649732 193
226 3300005616 Ga0068852_100002674 Ga0068852_1000026743 193
227 3300005616 Ga0068852_100094203 Ga0068852_1000942032 193
228 3300005616 Ga0068852_100253275 Ga0068852_1002532752 193
229 3300005616 Ga0068852_100294431 Ga0068852_1002944313 193
230 3300005718 Ga0068866_10575850 Ga0068866_105758501 193
231 3300005719 Ga0068861_100326670 Ga0068861_1003266703 193
232 3300005834 Ga0068851_10151404 Ga0068851_101514041 193
233 3300005841 Ga0068863_100174387 Ga0068863_1001743871 193
234 3300005841 Ga0068863_100374239 Ga0068863_1003742391 193
235 3300005842 Ga0068858_100181258 Ga0068858_1001812583 193
236 3300005842 Ga0068858_101186595 Ga0068858_1011865952 193
237 3300006163 Ga0070715_10148234 Ga0070715_101482342 193
238 3300006195 Ga0075366_10002159 Ga0075366_1000215911 193
239 3300006195 Ga0075366_10280698 Ga0075366_102806982 193
240 3300006358 Ga0068871_100048524 Ga0068871_1000485243 193
241 3300006881 Ga0068865_100442794 Ga0068865_1004427943 193
242 3300009093 Ga0105240_10149391 Ga0105240_101493912 193
243 3300009174 Ga0105241_10006659 Ga0105241_100066597 193
244 3300009174 Ga0105241_10557929 Ga0105241_105579292 193
245 3300009176 Ga0105242_10034759 Ga0105242_100347591 193
246 3300009177 Ga0105248_10478351 Ga0105248_104783512 193
247 3300009545 Ga0105237_10034528 Ga0105237_100345288 193
248 3300010375 Ga0105239_10025624 Ga0105239_100256246 193
249 3300010375 Ga0105239_10088742 Ga0105239_100887423 193
250 3300011119 Ga0105246_10131740 Ga0105246_101317402 193
251 3300013100 Ga0157373_10000715 Ga0157373_1000071520 193
252 3300013100 Ga0157373_10009211 Ga0157373_100092118 193
253 3300013100 Ga0157373_10013271 Ga0157373_100132715 193
254 3300013100 Ga0157373_10061230 Ga0157373_100612302 193
255 3300013100 Ga0157373_10176881 Ga0157373_101768812 193
256 3300013102 Ga0157371_10000584 Ga0157371_1000058423 193
257 3300013102 Ga0157371_10001101 Ga0157371_100011012 193
258 3300013102 Ga0157371_10001748 Ga0157371_1000174817 193
259 3300013102 Ga0157371_10005044 Ga0157371_100050443 193
260 3300013102 Ga0157371_10038391 Ga0157371_100383915 193
261 3300013102 Ga0157371_10061701 Ga0157371_100617011 193
262 3300013102 Ga0157371_10312601 Ga0157371_103126012 193
263 3300013102 Ga0157371_10336716 Ga0157371_103367162 193
264 3300013104 Ga0157370_10000821 Ga0157370_100008212 193
265 3300013104 Ga0157370_10012968 Ga0157370_100129688 193
266 3300013104 Ga0157370_10067444 Ga0157370_100674443 193
267 3300013104 Ga0157370_10126713 Ga0157370_101267131 193
268 3300013104 Ga0157370_10434975 Ga0157370_104349752 193
269 3300013104 Ga0157370_10475696 Ga0157370_104756961 193
270 3300013105 Ga0157369_10003166 Ga0157369_1000316614 193
271 3300013105 Ga0157369_10007205 Ga0157369_100072053 193
272 3300013105 Ga0157369_10045270 Ga0157369_100452705 193
273 3300013105 Ga0157369_10190657 Ga0157369_101906572 193
274 3300013105 Ga0157369_10452867 Ga0157369_104528671 193
275 3300013105 Ga0157369_10457844 Ga0157369_104578442 193
276 3300013296 Ga0157374_10090571 Ga0157374_100905712 193
277 3300013296 Ga0157374_10243555 Ga0157374_102435553 193
278 3300013297 Ga0157378_10005693 Ga0157378_100056938 193
279 3300013297 Ga0157378_10669740 Ga0157378_106697402 193
280 3300013306 Ga0163162_10006296 Ga0163162_100062964 193
281 3300013306 Ga0163162_10037892 Ga0163162_100378922 193
282 3300013306 Ga0163162_10276104 Ga0163162_102761041 193
283 3300013307 Ga0157372_10001337 Ga0157372_1000133723 193
284 3300013307 Ga0157372_10008116 Ga0157372_100081167 193
285 3300013307 Ga0157372_10049206 Ga0157372_100492062 193
286 3300013307 Ga0157372_10050140 Ga0157372_100501404 193
287 3300013307 Ga0157372_10086712 Ga0157372_100867121 193
288 3300013307 Ga0157372_10113843 Ga0157372_101138432 193
289 3300013307 Ga0157372_10166304 Ga0157372_101663042 193
290 3300013307 Ga0157372_10225668 Ga0157372_102256681 193
291 3300013307 Ga0157372_10267520 Ga0157372_102675202 193
292 3300013307 Ga0157372_10410370 Ga0157372_104103702 193
293 3300013307 Ga0157372_11760341 Ga0157372_117603411 193
294 3300013307 Ga0157372_12005635 Ga0157372_120056351 193
295 3300013308 Ga0157375_10114919 Ga0157375_101149192 193
296 3300013308 Ga0157375_11272453 Ga0157375_112724531 193
297 3300014325 Ga0163163_10200698 Ga0163163_102006983 193
298 3300014326 Ga0157380_10929981 Ga0157380_109299811 193
299 3300014745 Ga0157377_10099110 Ga0157377_100991101 193
300 3300014968 Ga0157379_10151750 Ga0157379_101517502 193
301 3300014969 Ga0157376_10100219 Ga0157376_101002193 193
302 3300014969 Ga0157376_10658249 Ga0157376_106582491 193
303 3300014969 Ga0157376_11406742 Ga0157376_114067421 193
304 3300017792 Ga0163161_10036180 Ga0163161_100361804 193
305 3300025304 Ga0209257_1000008 Ga0209257_1000008926 193
306 3300025899 Ga0207642_10760752 Ga0207642_107607521 193
307 3300025901 Ga0207688_10046406 Ga0207688_100464063 193
308 3300025903 Ga0207680_10164704 Ga0207680_101647042 193
309 3300025904 Ga0207647_10073242 Ga0207647_100732422 193
310 3300025904 Ga0207647_10221644 Ga0207647_102216442 193
311 3300025907 Ga0207645_10034054 Ga0207645_100340543 193
312 3300025907 Ga0207645_10061658 Ga0207645_100616582 193
313 3300025908 Ga0207643_10140691 Ga0207643_101406912 193
314 3300025909 Ga0207705_10015359 Ga0207705_100153595 193
315 3300025909 Ga0207705_10042401 Ga0207705_100424011 193
316 3300025909 Ga0207705_10052154 Ga0207705_100521542 193
317 3300025909 Ga0207705_10250331 Ga0207705_102503311 193
318 3300025909 Ga0207705_10522677 Ga0207705_105226771 193
319 3300025909 Ga0207705_10541175 Ga0207705_105411752 193
320 3300025909 Ga0207705_10561211 Ga0207705_105612112 193
321 3300025911 Ga0207654_10016950 Ga0207654_100169505 193
322 3300025912 Ga0207707_10035725 Ga0207707_100357257 193
323 3300025912 Ga0207707_10068590 Ga0207707_100685905 193
324 3300025912 Ga0207707_10226888 Ga0207707_102268882 193
325 3300025912 Ga0207707_10544497 Ga0207707_105444972 193
326 3300025912 Ga0207707_10567092 Ga0207707_105670921 193
327 3300025913 Ga0207695_10208185 Ga0207695_102081852 193
328 3300025913 Ga0207695_10317856 Ga0207695_103178561 193
329 3300025914 Ga0207671_10004239 Ga0207671_100042398 193
330 3300025914 Ga0207671_10346423 Ga0207671_103464232 193
331 3300025917 Ga0207660_10046533 Ga0207660_100465331 193
332 3300025917 Ga0207660_10047899 Ga0207660_100478992 193
333 3300025917 Ga0207660_10537056 Ga0207660_105370561 193
334 3300025918 Ga0207662_10025357 Ga0207662_100253572 193
335 3300025919 Ga0207657_10016002 Ga0207657_100160024 193
336 3300025919 Ga0207657_10023224 Ga0207657_100232247 193
337 3300025919 Ga0207657_10035971 Ga0207657_100359711 193
338 3300025919 Ga0207657_10048764 Ga0207657_100487642 193
339 3300025919 Ga0207657_10124824 Ga0207657_101248243 193
340 3300025921 Ga0207652_10000103 Ga0207652_100001039 193
341 3300025921 Ga0207652_10002216 Ga0207652_100022162 193
342 3300025921 Ga0207652_10098138 Ga0207652_100981382 193
343 3300025921 Ga0207652_10121463 Ga0207652_101214632 193
344 3300025921 Ga0207652_10253855 Ga0207652_102538551 193
345 3300025921 Ga0207652_10257070 Ga0207652_102570701 193
346 3300025921 Ga0207652_10519489 Ga0207652_105194892 193
347 3300025925 Ga0207650_10125637 Ga0207650_101256373 193
348 3300025925 Ga0207650_10782145 Ga0207650_107821451 193
349 3300025931 Ga0207644_10133843 Ga0207644_101338431 193
350 3300025932 Ga0207690_10128733 Ga0207690_101287332 193
351 3300025932 Ga0207690_10138474 Ga0207690_101384742 193
352 3300025932 Ga0207690_10393525 Ga0207690_103935252 193
353 3300025933 Ga0207706_10025883 Ga0207706_100258834 193
354 3300025933 Ga0207706_10309015 Ga0207706_103090152 193
355 3300025934 Ga0207686_10095357 Ga0207686_100953573 193
356 3300025936 Ga0207670_10699279 Ga0207670_106992791 193
357 3300025938 Ga0207704_10205299 Ga0207704_102052992 193
358 3300025940 Ga0207691_10316119 Ga0207691_103161191 193
359 3300025940 Ga0207691_11007321 Ga0207691_110073211 193
360 3300025942 Ga0207689_10215436 Ga0207689_102154361 193
361 3300025942 Ga0207689_10450182 Ga0207689_104501821 193
362 3300025942 Ga0207689_10879480 Ga0207689_108794801 193
363 3300025944 Ga0207661_10126202 Ga0207661_101262022 193
364 3300025944 Ga0207661_10370493 Ga0207661_103704932 193
365 3300025949 Ga0207667_10010940 Ga0207667_100109408 193
366 3300025949 Ga0207667_10147754 Ga0207667_101477542 193
367 3300025949 Ga0207667_10223496 Ga0207667_102234962 193
368 3300025949 Ga0207667_10465676 Ga0207667_104656761 193
369 3300025949 Ga0207667_10893091 Ga0207667_108930911 193
370 3300025949 Ga0207667_11040786 Ga0207667_110407862 193
371 3300025960 Ga0207651_10145319 Ga0207651_101453192 193
372 3300025960 Ga0207651_10168227 Ga0207651_101682272 193
373 3300025981 Ga0207640_10071303 Ga0207640_100713032 193
374 3300025981 Ga0207640_10107647 Ga0207640_101076472 193
375 3300026035 Ga0207703_10160187 Ga0207703_101601872 193
376 3300026041 Ga0207639_10050543 Ga0207639_100505432 193
377 3300026041 Ga0207639_10116674 Ga0207639_101166743 193
378 3300026041 Ga0207639_10168524 Ga0207639_101685242 193
379 3300026067 Ga0207678_10020096 Ga0207678_100200962 193
380 3300026067 Ga0207678_10448554 Ga0207678_104485543 193
381 3300026078 Ga0207702_10291757 Ga0207702_102917572 193
382 3300026078 Ga0207702_10697806 Ga0207702_106978061 193
383 3300026078 Ga0207702_10810299 Ga0207702_108102991 193
384 3300026088 Ga0207641_10196924 Ga0207641_101969241 193
385 3300026088 Ga0207641_11475271 Ga0207641_114752711 193
386 3300026089 Ga0207648_10090349 Ga0207648_100903492 193
387 3300026095 Ga0207676_10103340 Ga0207676_101033401 193
388 3300026116 Ga0207674_10160942 Ga0207674_101609423 193
389 3300026116 Ga0207674_10194847 Ga0207674_101948472 193
390 3300026118 Ga0207675_100461791 Ga0207675_1004617912 193
391 3300026121 Ga0207683_10119901 Ga0207683_101199012 193
392 3300026142 Ga0207698_10210831 Ga0207698_102108311 193
393 3300026142 Ga0207698_10360050 Ga0207698_103600502 193
394 3300026142 Ga0207698_10440941 Ga0207698_104409412 193
395 3300026142 Ga0207698_10882300 Ga0207698_108823001 193
396 3300031250 Ga0265331_10039802 Ga0265331_100398022 193
397 3300031548 Ga0307408_100122083 Ga0307408_1001220832 193
398 3300031824 Ga0307413_10033480 Ga0307413_100334802 193
399 3300031911 Ga0307412_10070427 Ga0307412_100704273 193
400 3300032004 Ga0307414_10040587 Ga0307414_100405874 193
401 3300032004 Ga0307414_11272229 Ga0307414_112722291 193
402 3300032005 Ga0307411_10056388 Ga0307411_100563882 193
403 3300032126 Ga0307415_100049326 Ga0307415_1000493263 193
404 3300035086 Ga0373934_0016371 Ga0373934_0016371_285_902 193
405 3300035089 Ga0373944_0007847 Ga0373944_0007847_1279_1893 193
406 3300035119 Ga0373956_0127892 Ga0373956_0127892_540_1157 193
407 3300035172 Ga0373955_0004521 Ga0373955_0004521_3197_3814 193
408 3300035691 Ga0373931_0268863 Ga0373931_0268863_336_920 193
409 3300035692 Ga0373935_0301566 Ga0373935_0301566_461_1078 193
410 3300036401 Ga0373937_0025749 Ga0373937_0025749_334_951 193
411 3300037312 Ga0395899_0001903 Ga0395899_0001903_16335_16916 193
412 3300037312 Ga0395899_0012217 Ga0395899_0012217_3097_3678 193
413 3300037312 Ga0395899_0041997 Ga0395899_0041997_139_720 193
414 3300037312 Ga0395899_0061562 Ga0395899_0061562_1931_2512 193
415 3300037312 Ga0395899_0442568 Ga0395899_0442568_60_641 193
416 3300037418 Ga0395900_0013876 Ga0395900_0013876_5512_6093 193
417 3300037418 Ga0395900_0026980 Ga0395900_0026980_3547_4128 193
418 3300037418 Ga0395900_0091633 Ga0395900_0091633_2126_2707 193
419 3300037418 Ga0395900_0115678 Ga0395900_0115678_274_855 193
420 3300037418 Ga0395900_0143693 Ga0395900_0143693_1486_2070 193
421 3300037418 Ga0395900_0301136 Ga0395900_0301136_902_1555 193
422 3300037418 Ga0395900_0828972 Ga0395900_0828972_28_609 193
423 3300037466 Ga0395898_0004173 Ga0395898_0004173_6214_6795 193
424 3300037466 Ga0395898_0009255 Ga0395898_0009255_6578_7231 193
425 3300037466 Ga0395898_0035789 Ga0395898_0035789_3291_3872 193
426 3300037466 Ga0395898_0167565 Ga0395898_0167565_1507_2088 193
427 3300037466 Ga0395898_0268033 Ga0395898_0268033_859_1440 193
428 3300037471 Ga0395905_0042319 Ga0395905_0042319_703_1284 193
429 3300037471 Ga0395905_0058304 Ga0395905_0058304_2898_3479 193
430 3300038443 Ga0395901_0003994 Ga0395901_0003994_8209_8862 193
431 3300038443 Ga0395901_0009401 Ga0395901_0009401_2967_3548 193
432 3300039437 Ga0436365_1894240 Ga0436365_1894240_77_658 193
433 3300042007 Ga0439449_0103545 Ga0439449_0103545_369_950 193
434 3300042876 Ga0451577_0151015 Ga0451577_0151015_279_860 193
435 3300042876 Ga0451577_0771116 Ga0451577_0771116_154_735 193
436 3300044712 Ga0453684_0032353 Ga0453684_0032353_1042_1623 193
437 3300044712 Ga0453684_0050912 Ga0453684_0050912_4630_5211 193
438 3300044842 Ga0466957_0001781 Ga0466957_0001781_1296_1880 193
439 3300044842 Ga0466957_0002689 Ga0466957_0002689_4154_4735 193
440 3300045836 Ga0466958_0362497 Ga0466958_0362497_316_906 193
441 3300046454 Ga0495592_0011274 Ga0495592_0011274_1100_1717 193
442 3300046462 Ga0495651_0239135 Ga0495651_0239135_192_782 193
443 3300046463 Ga0495653_0042268 Ga0495653_0042268_1776_2393 193
444 3300046511 Ga0495608_0025634 Ga0495608_0025634_1979_2596 193
445 3300046514 Ga0495618_0099137 Ga0495618_0099137_1038_1628 193
446 3300046514 Ga0495618_0100385 Ga0495618_0100385_800_1417 193
447 3300046516 Ga0495628_0019796 Ga0495628_0019796_802_1419 193
448 3300046517 Ga0495630_0007562 Ga0495630_0007562_6076_6693 193
449 3300046529 Ga0495652_0186988 Ga0495652_0186988_305_922 193
450 3300046535 Ga0495586_0051333 Ga0495586_0051333_984_1601 193
451 3300046536 Ga0495587_0057095 Ga0495587_0057095_566_1183 193
452 3300046559 Ga0495667_0197500 Ga0495667_0197500_173_790 193
453 3300046660 Ga0495625_0000691 Ga0495625_0000691_8333_8923 193
454 3300046689 Ga0495613_0063552 Ga0495613_0063552_61_678 193
455 3300047471 Ga0495684_0079011 Ga0495684_0079011_747_1364 193
456 3300048917 Ga0496114_0446753 Ga0496114_0446753_80_670 193
457 3300049520 Ga0501297_001068 Ga0501297_001068_1305_1886 193
458 3300049521 Ga0501298_000346 Ga0501298_000346_2940_3521 193
459 3300049569 Ga0501032_0184106 Ga0501032_0184106_321_911 193
460 3300049570 Ga0501033_0279448 Ga0501033_0279448_263_847 193
461 3300049571 Ga0501034_0111372 Ga0501034_0111372_1399_1980 193
462 3300049571 Ga0501034_0128350 Ga0501034_0128350_137_727 193
463 3300049586 Ga0501070_0027986 Ga0501070_0027986_183_770 193
464 3300049649 Ga0501198_001007 Ga0501198_001007_736_1317 193
465 3300049651 Ga0501201_000681 Ga0501201_000681_442_1023 193
466 3300049652 Ga0501202_000315 Ga0501202_000315_6024_6605 193
467 3300049653 Ga0501206_007700 Ga0501206_007700_228_809 193
468 3300049654 Ga0501207_003285 Ga0501207_003285_199_780 193
469 3300049661 Ga0501217_001445 Ga0501217_001445_1982_2563 193
470 3300049662 Ga0501222_009889 Ga0501222_009889_497_1078 193
471 3300049663 Ga0501223_000249 Ga0501223_000249_5308_5889 193
472 3300049663 Ga0501223_000445 Ga0501223_000445_2904_3485 193
473 3300049663 Ga0501223_055728 Ga0501223_055728_80_664 193
474 3300049665 Ga0501227_012996 Ga0501227_012996_720_1304 193
475 3300049668 Ga0501233_003190 Ga0501233_003190_268_849 193
476 3300049686 Ga0501257_017430 Ga0501257_017430_664_1248 193
477 3300049704 Ga0501221_000242 Ga0501221_000242_1506_2087 193
478 3300049705 Ga0501225_0000825 Ga0501225_0000825_7395_7976 193
479 3300049705 Ga0501225_0024564 Ga0501225_0024564_17_658 193
480 3300049707 Ga0501234_009583 Ga0501234_009583_790_1371 193
481 3300049758 Ga0501241_001740 Ga0501241_001740_1115_1696 193
482 3300049763 Ga0501266_027792 Ga0501266_027792_27_611 193
483 3300049770 Ga0501273_030021 Ga0501273_030021_141_725 193
484 3300049772 Ga0501275_013429 Ga0501275_013429_249_833 193
485 3300049773 Ga0501276_018010 Ga0501276_018010_20_604 193
486 3300049822 Ga0501035_0033880 Ga0501035_0033880_227_817 193
487 3300049822 Ga0501035_0414636 Ga0501035_0414636_448_1029 193
488 3300049823 Ga0501044_0245633 Ga0501044_0245633_989_1579 193
489 3300049823 Ga0501044_0731405 Ga0501044_0731405_134_721 193
490 3300050493 nmdc:mga0k408_168_c2 nmdc:mga0k408_168_c2_9571_10161 193
491 3300050511 nmdc:mga08y16_1338781_c1 nmdc:mga08y16_1338781_c1_18_599 193
492 3300061719 Ga0466962_0062932 Ga0466962_0062932_344_928 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

48

137

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.9554 1 137
3dn7-assembly1.cif.gz_A cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. 0.8925 1 137
3i54-assembly2.cif.gz_C crystal structure of mtbcrp in complex with camp 0.8878 20 192
5cvr-assembly1.cif.gz_A-2 crystal structure of fnr of a. fischeri in a partially degraded form 0.8725 28 192
4cyd-assembly2.cif.gz_A glxr bound to camp 0.8704 8 192
ID Description Score Start End Superfamily
3dn7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9574 3 137 2.60.120.10
3dn7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8931 3 137 2.60.120.10
af_P9WQK5_226_324_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8882 28 115 2.60.120.10
5cvrA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8754 28 147 2.60.120.10
3i54C01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8563 20 147 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A173MGJ9-F1-model_v4 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases 0.983 2 192 GO:0016301
AF-A0A1I5KK45-F1-model_v4 cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases 0.9827 2 188 GO:0016301
AF-A0A0F9NUW1-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9821 1 187
AF-A0A318VBC8-F1-model_v4 deleted 0.9818 15 187
AF-A0A4U1BWR1-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9816 1 192

Feature Viewer

pLDDT pTM Quality
94.44 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map