F454290
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 492 | 239 | 486 | 194 |
Family's Representative Sequence
| Representative Sequence | 3300032126|Ga0307415_100049326|Ga0307415_1000493263 |
| Length | 213 |
| Sequence | MVYFSCAPHPRGLAKKTPDMYELFFQKLTGKVAFTPEEQEVIRHYLTPKKLRKRQYLLQEGDVCKHIAFVEKGVLRAYTVDDKGIEHIIQFAPEGWTISDLYSFMTGEGATYNIDALEDSELVLISRQAQEELLQKVPRYSDFIRLQITGAYLAMQKRLTSVLSLGVEERYSNLLKLYPDLVQRVPQHMIASYMGLTPETLSRVRRKMARKDS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 2 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 3 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 4 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 5 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 6 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 143 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 144 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 147 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 148 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 149 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 151 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 152 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 154 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 159 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 162 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 163 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 164 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 165 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 166 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 196 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 197 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 198 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 199 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 206 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 207 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 208 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 209 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 210 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 211 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 212 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 213 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 214 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 215 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 216 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 217 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 218 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 219 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 222 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 223 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 224 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 225 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 226 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 227 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 230 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 231 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 234 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 235 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 236 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 237 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 238 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 239 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.78 |
| Metatranscriptomes | 0 |
| Isolates | 1.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.46 |
| Nodule | 0 |
| Rhizoplane | 0.2 |
| Rhizosphere | 92.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10059655 | 3300003320 | Bacteria | 4283 |
| 2 | rootL2_10047565 | 3300003322 | Bacteria | 4011 |
| 3 | rootL2_10060049 | 3300003322 | Bacteria | 1655 |
| 4 | rootL2_10066252 | 3300003322 | Bacteria | 3587 |
| 5 | rootL2_10119527 | 3300003322 | Unclassified | 1476 |
| 6 | rootL2_10269286 | 3300003322 | Unclassified | 1831 |
| 7 | rootH1_10068010 | 3300003323 | Bacteria | 13848 |
| 8 | rootH1_10201698 | 3300003323 | Bacteria | 2920 |
| 9 | Ga0055531_10000547 | 3300003794 | Bacteria | 33330 |
| 10 | Ga0055543_1032052 | 3300004625 | Bacteria | 914 |
| 11 | Ga0065165_1000783 | 3300005262 | Bacteria | 42648 |
| 12 | Ga0065714_10005223 | 3300005288 | Bacteria | 4341 |
| 13 | Ga0065714_10141957 | 3300005288 | Bacteria | 1165 |
| 14 | Ga0065704_10000434 | 3300005289 | Bacteria | 21011 |
| 15 | Ga0065707_10279509 | 3300005295 | Bacteria | 1051 |
| 16 | Ga0070658_10018091 | 3300005327 | Bacteria | 5637 |
| 17 | Ga0070658_10073166 | 3300005327 | Bacteria | 2810 |
| 18 | Ga0070658_10349552 | 3300005327 | Bacteria | 1265 |
| 19 | Ga0070658_10493979 | 3300005327 | Bacteria | 1057 |
| 20 | Ga0070658_10989651 | 3300005327 | Bacteria | 731 |
| 21 | Ga0070676_10160171 | 3300005328 | Bacteria | 1448 |
| 22 | Ga0070683_100194082 | 3300005329 | Bacteria | 1928 |
| 23 | Ga0070683_100238624 | 3300005329 | Unclassified | 1729 |
| 24 | Ga0070683_100397718 | 3300005329 | Bacteria | 1314 |
| 25 | Ga0070690_100004064 | 3300005330 | Bacteria | 8098 |
| 26 | Ga0070690_100074283 | 3300005330 | Bacteria | 2214 |
| 27 | Ga0070670_100067183 | 3300005331 | Bacteria | 3077 |
| 28 | Ga0070670_100548416 | 3300005331 | Bacteria | 1031 |
| 29 | Ga0070677_10029966 | 3300005333 | Unclassified | 2068 |
| 30 | Ga0070677_10206131 | 3300005333 | Bacteria | 952 |
| 31 | Ga0068869_100025882 | 3300005334 | Bacteria | 4079 |
| 32 | Ga0068869_100170529 | 3300005334 | Bacteria | 1700 |
| 33 | Ga0070666_10086777 | 3300005335 | Bacteria | 2145 |
| 34 | Ga0070666_10494669 | 3300005335 | Unclassified | 886 |
| 35 | Ga0070680_100044464 | 3300005336 | Bacteria | 3608 |
| 36 | Ga0070680_100055428 | 3300005336 | Bacteria | 3239 |
| 37 | Ga0070680_100196788 | 3300005336 | Bacteria | 1699 |
| 38 | Ga0070682_100042786 | 3300005337 | Bacteria | 2799 |
| 39 | Ga0070682_100492581 | 3300005337 | Bacteria | 948 |
| 40 | Ga0068868_100078830 | 3300005338 | Bacteria | 2637 |
| 41 | Ga0068868_100608702 | 3300005338 | Bacteria | 969 |
| 42 | Ga0070660_100023659 | 3300005339 | Bacteria | 4553 |
| 43 | Ga0070660_100030483 | 3300005339 | Bacteria | 4047 |
| 44 | Ga0070660_100032498 | 3300005339 | Bacteria | 3927 |
| 45 | Ga0070660_100040290 | 3300005339 | Bacteria | 3554 |
| 46 | Ga0070660_100489035 | 3300005339 | Bacteria | 1023 |
| 47 | Ga0070660_100890760 | 3300005339 | Unclassified | 750 |
| 48 | Ga0070689_100255521 | 3300005340 | Bacteria | 1447 |
| 49 | Ga0070661_100346230 | 3300005344 | Bacteria | 1165 |
| 50 | Ga0070661_100666069 | 3300005344 | Bacteria | 846 |
| 51 | Ga0070668_100950148 | 3300005347 | Bacteria | 770 |
| 52 | Ga0070669_101279287 | 3300005353 | Bacteria | 635 |
| 53 | Ga0070675_100035329 | 3300005354 | Bacteria | 4061 |
| 54 | Ga0070675_100106859 | 3300005354 | Bacteria | 2363 |
| 55 | Ga0070675_100944169 | 3300005354 | Bacteria | 791 |
| 56 | Ga0070671_100056337 | 3300005355 | Unclassified | 3270 |
| 57 | Ga0070674_100344086 | 3300005356 | Bacteria | 1202 |
| 58 | Ga0070674_100714547 | 3300005356 | Bacteria | 858 |
| 59 | Ga0070673_100071639 | 3300005364 | Bacteria | 2785 |
| 60 | Ga0070673_100239540 | 3300005364 | Bacteria | 1577 |
| 61 | Ga0070659_100004616 | 3300005366 | Bacteria | 9841 |
| 62 | Ga0070659_100040009 | 3300005366 | Bacteria | 3662 |
| 63 | Ga0070667_100028100 | 3300005367 | Bacteria | 4682 |
| 64 | Ga0070701_10066530 | 3300005438 | Bacteria | 1915 |
| 65 | Ga0070700_100425656 | 3300005441 | Bacteria | 1004 |
| 66 | Ga0070678_100020105 | 3300005456 | Bacteria | 4374 |
| 67 | Ga0070678_100048430 | 3300005456 | Unclassified | 3061 |
| 68 | Ga0070678_100850488 | 3300005456 | Bacteria | 831 |
| 69 | Ga0070681_10017834 | 3300005458 | Bacteria | 7094 |
| 70 | Ga0070681_10053622 | 3300005458 | Bacteria | 4019 |
| 71 | Ga0070681_10094742 | 3300005458 | Bacteria | 2934 |
| 72 | Ga0070681_10170269 | 3300005458 | Bacteria | 2100 |
| 73 | Ga0068867_100268461 | 3300005459 | Bacteria | 1394 |
| 74 | Ga0068867_100832229 | 3300005459 | Bacteria | 826 |
| 75 | Ga0070685_10103462 | 3300005466 | Bacteria | 1742 |
| 76 | Ga0070679_100008912 | 3300005530 | Bacteria | 9466 |
| 77 | Ga0070679_100033073 | 3300005530 | Bacteria | 5118 |
| 78 | Ga0070679_100038687 | 3300005530 | Bacteria | 4742 |
| 79 | Ga0070679_100062854 | 3300005530 | Bacteria | 3701 |
| 80 | Ga0070679_100127702 | 3300005530 | Bacteria | 2524 |
| 81 | Ga0070679_100166661 | 3300005530 | Bacteria | 2176 |
| 82 | Ga0070679_100667278 | 3300005530 | Bacteria | 982 |
| 83 | Ga0070684_100089178 | 3300005535 | Bacteria | 2741 |
| 84 | Ga0068853_100084514 | 3300005539 | Bacteria | 2781 |
| 85 | Ga0068853_100304675 | 3300005539 | Bacteria | 1473 |
| 86 | Ga0068853_100682633 | 3300005539 | Bacteria | 979 |
| 87 | Ga0068853_100866113 | 3300005539 | Bacteria | 867 |
| 88 | Ga0070672_100202181 | 3300005543 | Bacteria | 1662 |
| 89 | Ga0070672_100243346 | 3300005543 | Bacteria | 1514 |
| 90 | Ga0070672_100593137 | 3300005543 | Unclassified | 964 |
| 91 | Ga0070686_100012608 | 3300005544 | Bacteria | 4819 |
| 92 | Ga0070686_100107660 | 3300005544 | Bacteria | 1894 |
| 93 | Ga0070686_100144421 | 3300005544 | Unclassified | 1660 |
| 94 | Ga0070696_100991432 | 3300005546 | Unclassified | 701 |
| 95 | Ga0070665_100521532 | 3300005548 | Bacteria | 1200 |
| 96 | Ga0068855_100002929 | 3300005563 | Bacteria | 20890 |
| 97 | Ga0068855_100016232 | 3300005563 | Bacteria | 8955 |
| 98 | Ga0068855_100026613 | 3300005563 | Bacteria | 6920 |
| 99 | Ga0068855_100698194 | 3300005563 | Unclassified | 1086 |
| 100 | Ga0068855_100884616 | 3300005563 | Bacteria | 944 |
| 101 | Ga0070664_100076806 | 3300005564 | Unclassified | 2871 |
| 102 | Ga0070664_100577575 | 3300005564 | Bacteria | 1041 |
| 103 | Ga0070664_100594217 | 3300005564 | Bacteria | 1026 |
| 104 | Ga0068857_100358914 | 3300005577 | Bacteria | 1351 |
| 105 | Ga0068857_100651302 | 3300005577 | Bacteria | 998 |
| 106 | Ga0068854_100061147 | 3300005578 | Unclassified | 2727 |
| 107 | Ga0068854_100094985 | 3300005578 | Bacteria | 2225 |
| 108 | Ga0068856_100033276 | 3300005614 | Bacteria | 5047 |
| 109 | Ga0068856_100859106 | 3300005614 | Bacteria | 926 |
| 110 | Ga0068856_101175719 | 3300005614 | Bacteria | 784 |
| 111 | Ga0070702_100064973 | 3300005615 | Bacteria | 2136 |
| 112 | Ga0068852_100002674 | 3300005616 | Bacteria | 12316 |
| 113 | Ga0068852_100094203 | 3300005616 | Unclassified | 2686 |
| 114 | Ga0068852_100253275 | 3300005616 | Bacteria | 1688 |
| 115 | Ga0068852_100294431 | 3300005616 | Bacteria | 1569 |
| 116 | Ga0068852_100454428 | 3300005616 | Unclassified | 1269 |
| 117 | Ga0068866_10575850 | 3300005718 | Bacteria | 756 |
| 118 | Ga0068861_100326670 | 3300005719 | Bacteria | 1338 |
| 119 | Ga0068861_101171396 | 3300005719 | Bacteria | 742 |
| 120 | Ga0068851_10151404 | 3300005834 | Bacteria | 1268 |
| 121 | Ga0068863_100174387 | 3300005841 | Bacteria | 2063 |
| 122 | Ga0068863_100374239 | 3300005841 | Bacteria | 1390 |
| 123 | Ga0068858_100181258 | 3300005842 | Unclassified | 1989 |
| 124 | Ga0068858_101186595 | 3300005842 | Bacteria | 750 |
| 125 | Ga0068860_100000103 | 3300005843 | Bacteria | 139076 |
| 126 | Ga0070715_10148234 | 3300006163 | Bacteria | 1147 |
| 127 | Ga0075366_10000267 | 3300006195 | Bacteria | 23116 |
| 128 | Ga0075366_10002159 | 3300006195 | Bacteria | 10022 |
| 129 | Ga0075366_10280698 | 3300006195 | Bacteria | 1018 |
| 130 | Ga0097621_100417583 | 3300006237 | Unclassified | 1204 |
| 131 | Ga0097621_100431744 | 3300006237 | Unclassified | 1184 |
| 132 | Ga0097621_100945807 | 3300006237 | Unclassified | 804 |
| 133 | Ga0068871_100048524 | 3300006358 | Bacteria | 3428 |
| 134 | Ga0068871_100649874 | 3300006358 | Unclassified | 963 |
| 135 | Ga0068871_101149623 | 3300006358 | Bacteria | 727 |
| 136 | Ga0075429_100595884 | 3300006880 | Bacteria | 968 |
| 137 | Ga0068865_100442794 | 3300006881 | Bacteria | 1073 |
| 138 | Ga0105240_10031537 | 3300009093 | Bacteria | 6872 |
| 139 | Ga0105240_10149391 | 3300009093 | Bacteria | 2785 |
| 140 | Ga0111539_10162815 | 3300009094 | Bacteria | 2609 |
| 141 | Ga0111539_11024817 | 3300009094 | Bacteria | 959 |
| 142 | Ga0105241_10006659 | 3300009174 | Bacteria | 8501 |
| 143 | Ga0105241_10557929 | 3300009174 | Bacteria | 1029 |
| 144 | Ga0105242_10034759 | 3300009176 | Bacteria | 4041 |
| 145 | Ga0105242_10096908 | 3300009176 | Bacteria | 2493 |
| 146 | Ga0105242_10849262 | 3300009176 | Bacteria | 908 |
| 147 | Ga0105248_10478351 | 3300009177 | Bacteria | 1404 |
| 148 | Ga0105237_10034528 | 3300009545 | Bacteria | 5120 |
| 149 | Ga0105239_10025624 | 3300010375 | Bacteria | 6494 |
| 150 | Ga0105239_10088742 | 3300010375 | Bacteria | 3410 |
| 151 | Ga0105239_10346824 | 3300010375 | Bacteria | 1676 |
| 152 | Ga0105246_10131740 | 3300011119 | Bacteria | 1868 |
| 153 | Ga0157373_10000715 | 3300013100 | Bacteria | 25990 |
| 154 | Ga0157373_10000773 | 3300013100 | Bacteria | 24671 |
| 155 | Ga0157373_10009211 | 3300013100 | Bacteria | 7301 |
| 156 | Ga0157373_10013271 | 3300013100 | Bacteria | 6046 |
| 157 | Ga0157373_10061230 | 3300013100 | Bacteria | 2666 |
| 158 | Ga0157373_10137532 | 3300013100 | Bacteria | 1718 |
| 159 | Ga0157373_10176881 | 3300013100 | Bacteria | 1502 |
| 160 | Ga0157371_10000584 | 3300013102 | Bacteria | 43265 |
| 161 | Ga0157371_10001101 | 3300013102 | Bacteria | 29303 |
| 162 | Ga0157371_10001748 | 3300013102 | Bacteria | 22014 |
| 163 | Ga0157371_10005044 | 3300013102 | Bacteria | 11291 |
| 164 | Ga0157371_10038391 | 3300013102 | Bacteria | 3427 |
| 165 | Ga0157371_10061701 | 3300013102 | Unclassified | 2658 |
| 166 | Ga0157371_10125654 | 3300013102 | Bacteria | 1824 |
| 167 | Ga0157371_10312601 | 3300013102 | Bacteria | 1139 |
| 168 | Ga0157371_10336716 | 3300013102 | Bacteria | 1097 |
| 169 | Ga0157370_10000821 | 3300013104 | Bacteria | 39240 |
| 170 | Ga0157370_10003789 | 3300013104 | Bacteria | 17648 |
| 171 | Ga0157370_10012968 | 3300013104 | Bacteria | 8614 |
| 172 | Ga0157370_10067444 | 3300013104 | Bacteria | 3382 |
| 173 | Ga0157370_10118858 | 3300013104 | Bacteria | 2468 |
| 174 | Ga0157370_10126713 | 3300013104 | Bacteria | 2383 |
| 175 | Ga0157370_10434975 | 3300013104 | Bacteria | 1206 |
| 176 | Ga0157370_10475696 | 3300013104 | Unclassified | 1148 |
| 177 | Ga0157369_10000403 | 3300013105 | Bacteria | 57592 |
| 178 | Ga0157369_10003166 | 3300013105 | Bacteria | 19645 |
| 179 | Ga0157369_10007205 | 3300013105 | Bacteria | 12816 |
| 180 | Ga0157369_10045270 | 3300013105 | Unclassified | 4787 |
| 181 | Ga0157369_10190657 | 3300013105 | Bacteria | 2154 |
| 182 | Ga0157369_10452867 | 3300013105 | Unclassified | 1329 |
| 183 | Ga0157369_10457844 | 3300013105 | Bacteria | 1321 |
| 184 | Ga0157374_10090571 | 3300013296 | Bacteria | 2916 |
| 185 | Ga0157374_10243555 | 3300013296 | Bacteria | 1768 |
| 186 | Ga0157374_11183470 | 3300013296 | Unclassified | 785 |
| 187 | Ga0157378_10005693 | 3300013297 | Bacteria | 10904 |
| 188 | Ga0157378_10669740 | 3300013297 | Bacteria | 1055 |
| 189 | Ga0163162_10000269 | 3300013306 | Bacteria | 47344 |
| 190 | Ga0163162_10006296 | 3300013306 | Bacteria | 11495 |
| 191 | Ga0163162_10037892 | 3300013306 | Unclassified | 4812 |
| 192 | Ga0163162_10151838 | 3300013306 | Bacteria | 2435 |
| 193 | Ga0163162_10276104 | 3300013306 | Bacteria | 1812 |
| 194 | Ga0157372_10001337 | 3300013307 | Bacteria | 26657 |
| 195 | Ga0157372_10008116 | 3300013307 | Bacteria | 11166 |
| 196 | Ga0157372_10049206 | 3300013307 | Bacteria | 4687 |
| 197 | Ga0157372_10050140 | 3300013307 | Bacteria | 4644 |
| 198 | Ga0157372_10086712 | 3300013307 | Bacteria | 3552 |
| 199 | Ga0157372_10113843 | 3300013307 | Bacteria | 3101 |
| 200 | Ga0157372_10166304 | 3300013307 | Bacteria | 2551 |
| 201 | Ga0157372_10225668 | 3300013307 | Unclassified | 2172 |
| 202 | Ga0157372_10267520 | 3300013307 | Bacteria | 1986 |
| 203 | Ga0157372_10410370 | 3300013307 | Bacteria | 1578 |
| 204 | Ga0157372_10787987 | 3300013307 | Unclassified | 1105 |
| 205 | Ga0157372_11760341 | 3300013307 | Unclassified | 713 |
| 206 | Ga0157372_12005635 | 3300013307 | Unclassified | 665 |
| 207 | Ga0157375_10069107 | 3300013308 | Bacteria | 3537 |
| 208 | Ga0157375_10114919 | 3300013308 | Bacteria | 2794 |
| 209 | Ga0157375_10208838 | 3300013308 | Bacteria | 2109 |
| 210 | Ga0157375_11272453 | 3300013308 | Bacteria | 864 |
| 211 | Ga0163163_10200698 | 3300014325 | Unclassified | 2043 |
| 212 | Ga0157380_10170542 | 3300014326 | Unclassified | 1901 |
| 213 | Ga0157380_10678250 | 3300014326 | Bacteria | 1032 |
| 214 | Ga0157380_10929981 | 3300014326 | Unclassified | 898 |
| 215 | Ga0157377_10099110 | 3300014745 | Unclassified | 1733 |
| 216 | Ga0157377_10522961 | 3300014745 | Unclassified | 833 |
| 217 | Ga0157379_10151750 | 3300014968 | Bacteria | 2090 |
| 218 | Ga0157376_10100219 | 3300014969 | Bacteria | 2529 |
| 219 | Ga0157376_10658249 | 3300014969 | Bacteria | 1048 |
| 220 | Ga0157376_11406742 | 3300014969 | Bacteria | 729 |
| 221 | Ga0182006_1015245 | 3300015261 | Bacteria | 3297 |
| 222 | Ga0163161_10036180 | 3300017792 | Bacteria | 3536 |
| 223 | Ga0163161_10396689 | 3300017792 | Bacteria | 1106 |
| 224 | Ga0209257_1000008 | 3300025304 | Bacteria | 1294570 |
| 225 | Ga0207682_10034226 | 3300025893 | Bacteria | 2047 |
| 226 | Ga0207642_10760752 | 3300025899 | Bacteria | 614 |
| 227 | Ga0207688_10046406 | 3300025901 | Bacteria | 2426 |
| 228 | Ga0207680_10164704 | 3300025903 | Bacteria | 1489 |
| 229 | Ga0207647_10073242 | 3300025904 | Unclassified | 2065 |
| 230 | Ga0207647_10221644 | 3300025904 | Unclassified | 1090 |
| 231 | Ga0207645_10034054 | 3300025907 | Bacteria | 3273 |
| 232 | Ga0207645_10061658 | 3300025907 | Unclassified | 2396 |
| 233 | Ga0207643_10140691 | 3300025908 | Bacteria | 1441 |
| 234 | Ga0207643_10320118 | 3300025908 | Bacteria | 968 |
| 235 | Ga0207705_10015359 | 3300025909 | Bacteria | 5493 |
| 236 | Ga0207705_10042401 | 3300025909 | Bacteria | 3267 |
| 237 | Ga0207705_10052154 | 3300025909 | Unclassified | 2944 |
| 238 | Ga0207705_10250331 | 3300025909 | Bacteria | 1351 |
| 239 | Ga0207705_10522677 | 3300025909 | Bacteria | 922 |
| 240 | Ga0207705_10541175 | 3300025909 | Bacteria | 905 |
| 241 | Ga0207705_10561211 | 3300025909 | Bacteria | 888 |
| 242 | Ga0207654_10016950 | 3300025911 | Unclassified | 3802 |
| 243 | Ga0207707_10035725 | 3300025912 | Bacteria | 4346 |
| 244 | Ga0207707_10068590 | 3300025912 | Bacteria | 3090 |
| 245 | Ga0207707_10226888 | 3300025912 | Bacteria | 1625 |
| 246 | Ga0207707_10544497 | 3300025912 | Unclassified | 986 |
| 247 | Ga0207707_10567092 | 3300025912 | Bacteria | 963 |
| 248 | Ga0207695_10202691 | 3300025913 | Bacteria | 1897 |
| 249 | Ga0207695_10208185 | 3300025913 | Unclassified | 1868 |
| 250 | Ga0207695_10317856 | 3300025913 | Bacteria | 1447 |
| 251 | Ga0207671_10004239 | 3300025914 | Bacteria | 13812 |
| 252 | Ga0207671_10346423 | 3300025914 | Bacteria | 1178 |
| 253 | Ga0207660_10046533 | 3300025917 | Bacteria | 3061 |
| 254 | Ga0207660_10047899 | 3300025917 | Bacteria | 3024 |
| 255 | Ga0207660_10537056 | 3300025917 | Bacteria | 950 |
| 256 | Ga0207662_10025357 | 3300025918 | Bacteria | 3415 |
| 257 | Ga0207657_10016002 | 3300025919 | Bacteria | 7241 |
| 258 | Ga0207657_10023224 | 3300025919 | Bacteria | 5780 |
| 259 | Ga0207657_10035971 | 3300025919 | Bacteria | 4435 |
| 260 | Ga0207657_10048764 | 3300025919 | Bacteria | 3696 |
| 261 | Ga0207657_10124824 | 3300025919 | Bacteria | 2115 |
| 262 | Ga0207652_10000103 | 3300025921 | Bacteria | 91988 |
| 263 | Ga0207652_10002216 | 3300025921 | Bacteria | 16580 |
| 264 | Ga0207652_10098138 | 3300025921 | Bacteria | 2583 |
| 265 | Ga0207652_10121463 | 3300025921 | Bacteria | 2324 |
| 266 | Ga0207652_10253855 | 3300025921 | Unclassified | 1586 |
| 267 | Ga0207652_10257070 | 3300025921 | Bacteria | 1575 |
| 268 | Ga0207652_10394030 | 3300025921 | Bacteria | 1250 |
| 269 | Ga0207652_10519489 | 3300025921 | Bacteria | 1071 |
| 270 | Ga0207650_10125637 | 3300025925 | Unclassified | 2002 |
| 271 | Ga0207650_10250600 | 3300025925 | Bacteria | 1433 |
| 272 | Ga0207650_10782145 | 3300025925 | Bacteria | 808 |
| 273 | Ga0207659_10442261 | 3300025926 | Bacteria | 1094 |
| 274 | Ga0207659_10537890 | 3300025926 | Bacteria | 992 |
| 275 | Ga0207659_10717334 | 3300025926 | Bacteria | 857 |
| 276 | Ga0207644_10133843 | 3300025931 | Bacteria | 1901 |
| 277 | Ga0207690_10128733 | 3300025932 | Bacteria | 1850 |
| 278 | Ga0207690_10138474 | 3300025932 | Bacteria | 1790 |
| 279 | Ga0207690_10393525 | 3300025932 | Bacteria | 1104 |
| 280 | Ga0207706_10025883 | 3300025933 | Bacteria | 5254 |
| 281 | Ga0207706_10309015 | 3300025933 | Bacteria | 1377 |
| 282 | Ga0207686_10095357 | 3300025934 | Bacteria | 1974 |
| 283 | Ga0207670_10699279 | 3300025936 | Bacteria | 839 |
| 284 | Ga0207669_10135868 | 3300025937 | Bacteria | 1698 |
| 285 | Ga0207704_10205299 | 3300025938 | Bacteria | 1446 |
| 286 | Ga0207691_10058041 | 3300025940 | Bacteria | 3521 |
| 287 | Ga0207691_10299610 | 3300025940 | Unclassified | 1381 |
| 288 | Ga0207691_10316119 | 3300025940 | Bacteria | 1339 |
| 289 | Ga0207691_11007321 | 3300025940 | Bacteria | 695 |
| 290 | Ga0207689_10215436 | 3300025942 | Bacteria | 1587 |
| 291 | Ga0207689_10450182 | 3300025942 | Bacteria | 1076 |
| 292 | Ga0207689_10879480 | 3300025942 | Bacteria | 756 |
| 293 | Ga0207661_10126202 | 3300025944 | Bacteria | 2186 |
| 294 | Ga0207661_10370493 | 3300025944 | Bacteria | 1295 |
| 295 | Ga0207667_10010940 | 3300025949 | Bacteria | 10574 |
| 296 | Ga0207667_10147754 | 3300025949 | Bacteria | 2419 |
| 297 | Ga0207667_10223496 | 3300025949 | Bacteria | 1929 |
| 298 | Ga0207667_10465676 | 3300025949 | Bacteria | 1284 |
| 299 | Ga0207667_10893091 | 3300025949 | Bacteria | 881 |
| 300 | Ga0207667_11040786 | 3300025949 | Bacteria | 804 |
| 301 | Ga0207651_10145319 | 3300025960 | Bacteria | 1838 |
| 302 | Ga0207651_10168227 | 3300025960 | Bacteria | 1726 |
| 303 | Ga0207712_10923977 | 3300025961 | Bacteria | 772 |
| 304 | Ga0207640_10071303 | 3300025981 | Unclassified | 2340 |
| 305 | Ga0207640_10107647 | 3300025981 | Unclassified | 1969 |
| 306 | Ga0207703_10160187 | 3300026035 | Bacteria | 1970 |
| 307 | Ga0207639_10050543 | 3300026041 | Bacteria | 3158 |
| 308 | Ga0207639_10116674 | 3300026041 | Bacteria | 2186 |
| 309 | Ga0207639_10168524 | 3300026041 | Unclassified | 1852 |
| 310 | Ga0207678_10020096 | 3300026067 | Bacteria | 5866 |
| 311 | Ga0207678_10448554 | 3300026067 | Bacteria | 1121 |
| 312 | Ga0207702_10291757 | 3300026078 | Bacteria | 1545 |
| 313 | Ga0207702_10697806 | 3300026078 | Bacteria | 1000 |
| 314 | Ga0207702_10810299 | 3300026078 | Bacteria | 926 |
| 315 | Ga0207641_10196924 | 3300026088 | Bacteria | 1855 |
| 316 | Ga0207641_10217039 | 3300026088 | Unclassified | 1772 |
| 317 | Ga0207641_11475271 | 3300026088 | Bacteria | 682 |
| 318 | Ga0207648_10090349 | 3300026089 | Bacteria | 2676 |
| 319 | Ga0207676_10103340 | 3300026095 | Bacteria | 2368 |
| 320 | Ga0207674_10160942 | 3300026116 | Bacteria | 2199 |
| 321 | Ga0207674_10194847 | 3300026116 | Bacteria | 1976 |
| 322 | Ga0207675_100461791 | 3300026118 | Bacteria | 1260 |
| 323 | Ga0207683_10061700 | 3300026121 | Bacteria | 3300 |
| 324 | Ga0207683_10119901 | 3300026121 | Bacteria | 2361 |
| 325 | Ga0207698_10210831 | 3300026142 | Unclassified | 1748 |
| 326 | Ga0207698_10360050 | 3300026142 | Bacteria | 1377 |
| 327 | Ga0207698_10440941 | 3300026142 | Bacteria | 1254 |
| 328 | Ga0207698_10882300 | 3300026142 | Bacteria | 901 |
| 329 | Ga0268264_10000013 | 3300028381 | Bacteria | 513859 |
| 330 | Ga0307515_10001200 | 3300028794 | Bacteria | 59235 |
| 331 | Ga0307515_10003151 | 3300028794 | Bacteria | 34898 |
| 332 | Ga0265331_10039802 | 3300031250 | Bacteria | 2290 |
| 333 | Ga0265327_10000090 | 3300031251 | Bacteria | 197158 |
| 334 | Ga0307408_100122083 | 3300031548 | Bacteria | 2020 |
| 335 | Ga0307516_10000750 | 3300031730 | Bacteria | 44208 |
| 336 | Ga0307516_10108759 | 3300031730 | Bacteria | 2579 |
| 337 | Ga0307413_10033480 | 3300031824 | Bacteria | 2927 |
| 338 | Ga0307412_10000045 | 3300031911 | Bacteria | 165021 |
| 339 | Ga0307412_10070427 | 3300031911 | Bacteria | 2384 |
| 340 | Ga0307414_10010586 | 3300032004 | Bacteria | 5361 |
| 341 | Ga0307414_10040587 | 3300032004 | Bacteria | 3145 |
| 342 | Ga0307414_10065689 | 3300032004 | Bacteria | 2589 |
| 343 | Ga0307414_10115768 | 3300032004 | Bacteria | 2051 |
| 344 | Ga0307414_10263716 | 3300032004 | Bacteria | 1439 |
| 345 | Ga0307414_10298692 | 3300032004 | Unclassified | 1361 |
| 346 | Ga0307414_10303644 | 3300032004 | Bacteria | 1351 |
| 347 | Ga0307414_10634199 | 3300032004 | Unclassified | 962 |
| 348 | Ga0307414_10667733 | 3300032004 | Unclassified | 938 |
| 349 | Ga0307414_11272229 | 3300032004 | Bacteria | 682 |
| 350 | Ga0307411_10056388 | 3300032005 | Unclassified | 2590 |
| 351 | Ga0307411_10272757 | 3300032005 | Bacteria | 1342 |
| 352 | Ga0307415_100049326 | 3300032126 | Bacteria | 2846 |
| 353 | Ga0373934_0016371 | 3300035086 | Unclassified | 2819 |
| 354 | Ga0373944_0007847 | 3300035089 | Bacteria | 2871 |
| 355 | Ga0373956_0127892 | 3300035119 | Unclassified | 1188 |
| 356 | Ga0373955_0004521 | 3300035172 | Bacteria | 6161 |
| 357 | Ga0373931_0268863 | 3300035691 | Bacteria | 1043 |
| 358 | Ga0373935_0301566 | 3300035692 | Unclassified | 1132 |
| 359 | Ga0373937_0025749 | 3300036401 | Bacteria | 5312 |
| 360 | Ga0395899_0001903 | 3300037312 | Bacteria | 17213 |
| 361 | Ga0395899_0012217 | 3300037312 | Bacteria | 6576 |
| 362 | Ga0395899_0041997 | 3300037312 | Bacteria | 3415 |
| 363 | Ga0395899_0061562 | 3300037312 | Bacteria | 2764 |
| 364 | Ga0395899_0442568 | 3300037312 | Unclassified | 852 |
| 365 | Ga0395900_0013876 | 3300037418 | Bacteria | 8221 |
| 366 | Ga0395900_0026980 | 3300037418 | Bacteria | 5879 |
| 367 | Ga0395900_0090633 | 3300037418 | Bacteria | 3143 |
| 368 | Ga0395900_0091633 | 3300037418 | Bacteria | 3123 |
| 369 | Ga0395900_0115678 | 3300037418 | Bacteria | 2752 |
| 370 | Ga0395900_0143693 | 3300037418 | Bacteria | 2442 |
| 371 | Ga0395900_0301136 | 3300037418 | Bacteria | 1589 |
| 372 | Ga0395900_0828972 | 3300037418 | Unclassified | 851 |
| 373 | Ga0395898_0004173 | 3300037466 | Bacteria | 15834 |
| 374 | Ga0395898_0009255 | 3300037466 | Bacteria | 10358 |
| 375 | Ga0395898_0035789 | 3300037466 | Bacteria | 4933 |
| 376 | Ga0395898_0167565 | 3300037466 | Bacteria | 2100 |
| 377 | Ga0395898_0268033 | 3300037466 | Bacteria | 1628 |
| 378 | Ga0395905_0042319 | 3300037471 | Bacteria | 4274 |
| 379 | Ga0395905_0058304 | 3300037471 | Bacteria | 3611 |
| 380 | Ga0395901_0003994 | 3300038443 | Bacteria | 14853 |
| 381 | Ga0395901_0009401 | 3300038443 | Bacteria | 9917 |
| 382 | Ga0436365_1894240 | 3300039437 | Bacteria | 1093 |
| 383 | Ga0439449_0002155 | 3300042007 | Bacteria | 7733 |
| 384 | Ga0439449_0103545 | 3300042007 | Bacteria | 1053 |
| 385 | Ga0439457_011430 | 3300042014 | Bacteria | 2020 |
| 386 | Ga0451577_0151015 | 3300042876 | Bacteria | 2090 |
| 387 | Ga0451577_0771116 | 3300042876 | Unclassified | 869 |
| 388 | Ga0451577_0787798 | 3300042876 | Bacteria | 859 |
| 389 | Ga0453684_0032353 | 3300044712 | Bacteria | 7323 |
| 390 | Ga0453684_0050912 | 3300044712 | Bacteria | 5439 |
| 391 | Ga0453684_0053964 | 3300044712 | Bacteria | 5241 |
| 392 | Ga0466957_0001781 | 3300044842 | Bacteria | 11334 |
| 393 | Ga0466957_0002689 | 3300044842 | Bacteria | 9609 |
| 394 | Ga0466958_0362497 | 3300045836 | Bacteria | 934 |
| 395 | Ga0495627_004415 | 3300046453 | Bacteria | 5893 |
| 396 | Ga0495592_0011274 | 3300046454 | Bacteria | 6760 |
| 397 | Ga0495638_0016688 | 3300046460 | Bacteria | 4912 |
| 398 | Ga0495651_0239135 | 3300046462 | Unclassified | 1246 |
| 399 | Ga0495653_0042268 | 3300046463 | Unclassified | 3551 |
| 400 | Ga0495607_0028541 | 3300046501 | Bacteria | 3443 |
| 401 | Ga0495608_0025634 | 3300046511 | Unclassified | 4026 |
| 402 | Ga0495616_0011798 | 3300046513 | Bacteria | 4987 |
| 403 | Ga0495616_0019098 | 3300046513 | Bacteria | 3746 |
| 404 | Ga0495618_0099137 | 3300046514 | Bacteria | 1865 |
| 405 | Ga0495618_0100385 | 3300046514 | Unclassified | 1852 |
| 406 | Ga0495628_0019796 | 3300046516 | Bacteria | 5559 |
| 407 | Ga0495630_0007562 | 3300046517 | Bacteria | 7766 |
| 408 | Ga0495648_0015092 | 3300046524 | Bacteria | 5624 |
| 409 | Ga0495652_0186988 | 3300046529 | Unclassified | 1584 |
| 410 | Ga0495586_0051333 | 3300046535 | Unclassified | 2232 |
| 411 | Ga0495587_0057095 | 3300046536 | Unclassified | 2296 |
| 412 | Ga0495633_0000004 | 3300046558 | Bacteria | 370781 |
| 413 | Ga0495667_0197500 | 3300046559 | Unclassified | 1288 |
| 414 | Ga0495668_0002355 | 3300046616 | Bacteria | 15721 |
| 415 | Ga0495625_0000691 | 3300046660 | Bacteria | 48010 |
| 416 | Ga0495625_0001578 | 3300046660 | Bacteria | 27104 |
| 417 | Ga0495661_0001005 | 3300046665 | Bacteria | 25358 |
| 418 | Ga0495661_0139314 | 3300046665 | Bacteria | 1321 |
| 419 | Ga0495613_0063552 | 3300046689 | Unclassified | 2701 |
| 420 | Ga0495660_0095480 | 3300046810 | Bacteria | 1538 |
| 421 | Ga0495684_0079011 | 3300047471 | Unclassified | 2497 |
| 422 | Ga0495686_0000587 | 3300047472 | Bacteria | 51313 |
| 423 | Ga0495686_0001710 | 3300047472 | Bacteria | 22659 |
| 424 | Ga0496114_0446753 | 3300048917 | Bacteria | 1145 |
| 425 | Ga0496126_0026400 | 3300048929 | Bacteria | 5569 |
| 426 | Ga0495678_028959 | 3300049459 | Unclassified | 2330 |
| 427 | Ga0501292_039786 | 3300049515 | Bacteria | 810 |
| 428 | Ga0501297_001068 | 3300049520 | Bacteria | 2484 |
| 429 | Ga0501298_000346 | 3300049521 | Bacteria | 6235 |
| 430 | Ga0501299_045468 | 3300049522 | Unclassified | 893 |
| 431 | Ga0501032_0184106 | 3300049569 | Bacteria | 1367 |
| 432 | Ga0501033_0279448 | 3300049570 | Unclassified | 1179 |
| 433 | Ga0501034_0111372 | 3300049571 | Bacteria | 2728 |
| 434 | Ga0501034_0128350 | 3300049571 | Unclassified | 2520 |
| 435 | Ga0501043_0339018 | 3300049579 | Bacteria | 1144 |
| 436 | Ga0501047_0183121 | 3300049581 | Bacteria | 1961 |
| 437 | Ga0501070_0027986 | 3300049586 | Bacteria | 4728 |
| 438 | Ga0501198_001007 | 3300049649 | Bacteria | 3582 |
| 439 | Ga0501201_000681 | 3300049651 | Bacteria | 3182 |
| 440 | Ga0501202_000315 | 3300049652 | Bacteria | 6676 |
| 441 | Ga0501206_007700 | 3300049653 | Bacteria | 1415 |
| 442 | Ga0501207_003285 | 3300049654 | Bacteria | 2147 |
| 443 | Ga0501217_001445 | 3300049661 | Bacteria | 4452 |
| 444 | Ga0501222_009889 | 3300049662 | Bacteria | 1260 |
| 445 | Ga0501223_000249 | 3300049663 | Bacteria | 13787 |
| 446 | Ga0501223_000445 | 3300049663 | Bacteria | 9968 |
| 447 | Ga0501223_055728 | 3300049663 | Bacteria | 769 |
| 448 | Ga0501227_012996 | 3300049665 | Bacteria | 1829 |
| 449 | Ga0501233_003190 | 3300049668 | Bacteria | 2942 |
| 450 | Ga0501253_004210 | 3300049683 | Bacteria | 1798 |
| 451 | Ga0501257_017430 | 3300049686 | Bacteria | 1671 |
| 452 | Ga0501257_029647 | 3300049686 | Bacteria | 1315 |
| 453 | Ga0501219_000018 | 3300049703 | Bacteria | 25770 |
| 454 | Ga0501221_000242 | 3300049704 | Bacteria | 7912 |
| 455 | Ga0501225_0000825 | 3300049705 | Bacteria | 9637 |
| 456 | Ga0501225_0024564 | 3300049705 | Unclassified | 1659 |
| 457 | Ga0501234_009583 | 3300049707 | Bacteria | 1512 |
| 458 | Ga0501241_001740 | 3300049758 | Bacteria | 4326 |
| 459 | Ga0501266_027792 | 3300049763 | Bacteria | 796 |
| 460 | Ga0501268_043475 | 3300049765 | Bacteria | 852 |
| 461 | Ga0501273_030021 | 3300049770 | Bacteria | 770 |
| 462 | Ga0501275_013429 | 3300049772 | Bacteria | 917 |
| 463 | Ga0501276_018010 | 3300049773 | Bacteria | 654 |
| 464 | Ga0501035_0033880 | 3300049822 | Unclassified | 4643 |
| 465 | Ga0501035_0161692 | 3300049822 | Bacteria | 1938 |
| 466 | Ga0501035_0165947 | 3300049822 | Bacteria | 1910 |
| 467 | Ga0501035_0414636 | 3300049822 | Bacteria | 1119 |
| 468 | Ga0501044_0245633 | 3300049823 | Bacteria | 1733 |
| 469 | Ga0501044_0731405 | 3300049823 | Unclassified | 873 |
| 470 | Ga0501044_1035178 | 3300049823 | Bacteria | 692 |
| 471 | Ga0501284_00010 | 3300050005 | Bacteria | 136120 |
| 472 | nmdc:mga0k408_168_c2 | 3300050493 | Bacteria | 27329 |
| 473 | nmdc:mga0k408_50701_c2 | 3300050493 | Unclassified | 1886 |
| 474 | nmdc:mga0k408_83_c1 | 3300050493 | Bacteria | 44610 |
| 475 | nmdc:mga09592_553549_c1 | 3300050508 | Bacteria | 988 |
| 476 | nmdc:mga08y16_1338781_c1 | 3300050511 | Bacteria | 681 |
| 477 | nmdc:mga08y16_224793_c1 | 3300050511 | Bacteria | 1942 |
| 478 | nmdc:mga08y16_328190_c1 | 3300050511 | Bacteria | 1574 |
| 479 | Ga0500646_0005478 | 3300053090 | Bacteria | 3210 |
| 480 | Ga0500641_0000102 | 3300053096 | Bacteria | 33019 |
| 481 | Ga0500561_0074546 | 3300053137 | Unclassified | 977 |
| 482 | Ga0500622_0002517 | 3300053156 | Bacteria | 13158 |
| 483 | Ga0500622_0003157 | 3300053156 | Bacteria | 11268 |
| 484 | Ga0500637_0073082 | 3300053178 | Bacteria | 1974 |
| 485 | Ga0500584_035009 | 3300053726 | Bacteria | 2322 |
| 486 | Ga0466962_0062932 | 3300061719 | Bacteria | 1772 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048929 | Ga0496126_0026400 | Ga0496126_0026400_3634_4218 | 173 |
| 2 | 3300005719 | Ga0068861_101171396 | Ga0068861_1011713961 | 174 |
| 3 | 3300006880 | Ga0075429_100595884 | Ga0075429_1005958842 | 174 |
| 4 | 3300009094 | Ga0111539_10162815 | Ga0111539_101628155 | 174 |
| 5 | 3300050508 | nmdc:mga09592_553549_c1 | nmdc:mga09592_553549_c1_32_610 | 174 |
| 6 | 3300014745 | Ga0157377_10522961 | Ga0157377_105229611 | 175 |
| 7 | 3300005347 | Ga0070668_100950148 | Ga0070668_1009501481 | 176 |
| 8 | 3300025940 | Ga0207691_10058041 | Ga0207691_100580414 | 176 |
| 9 | 3300005333 | Ga0070677_10206131 | Ga0070677_102061311 | 177 |
| 10 | 3300005354 | Ga0070675_100106859 | Ga0070675_1001068593 | 177 |
| 11 | 3300005456 | Ga0070678_100850488 | Ga0070678_1008504881 | 177 |
| 12 | 3300005459 | Ga0068867_100832229 | Ga0068867_1008322291 | 177 |
| 13 | 3300005543 | Ga0070672_100243346 | Ga0070672_1002433462 | 177 |
| 14 | 3300006237 | Ga0097621_100945807 | Ga0097621_1009458071 | 177 |
| 15 | 3300005331 | Ga0070670_100067183 | Ga0070670_1000671832 | 178 |
| 16 | 3300005333 | Ga0070677_10029966 | Ga0070677_100299663 | 178 |
| 17 | 3300005456 | Ga0070678_100020105 | Ga0070678_1000201055 | 178 |
| 18 | 3300006237 | Ga0097621_100417583 | Ga0097621_1004175832 | 178 |
| 19 | 3300006358 | Ga0068871_100649874 | Ga0068871_1006498742 | 178 |
| 20 | 3300013104 | Ga0157370_10003789 | Ga0157370_100037895 | 178 |
| 21 | 3300013105 | Ga0157369_10000403 | Ga0157369_1000040335 | 178 |
| 22 | 3300013296 | Ga0157374_11183470 | Ga0157374_111834702 | 178 |
| 23 | 3300013308 | Ga0157375_10069107 | Ga0157375_100691072 | 178 |
| 24 | 3300014326 | Ga0157380_10170542 | Ga0157380_101705422 | 178 |
| 25 | 3300025893 | Ga0207682_10034226 | Ga0207682_100342262 | 178 |
| 26 | 3300025908 | Ga0207643_10320118 | Ga0207643_103201181 | 178 |
| 27 | 3300025925 | Ga0207650_10250600 | Ga0207650_102506001 | 178 |
| 28 | 3300025926 | Ga0207659_10537890 | Ga0207659_105378901 | 178 |
| 29 | 3300025940 | Ga0207691_10299610 | Ga0207691_102996101 | 178 |
| 30 | 3300026121 | Ga0207683_10061700 | Ga0207683_100617002 | 178 |
| 31 | 3300049579 | Ga0501043_0339018 | Ga0501043_0339018_494_1072 | 179 |
| 32 | 3300049581 | Ga0501047_0183121 | Ga0501047_0183121_1367_1945 | 179 |
| 33 | 3300049822 | Ga0501035_0161692 | Ga0501035_0161692_42_620 | 179 |
| 34 | 3300050511 | nmdc:mga08y16_224793_c1 | nmdc:mga08y16_224793_c1_510_1055 | 181 |
| 35 | 3300042876 | Ga0451577_0787798 | Ga0451577_0787798_136_714 | 183 |
| 36 | 3300044712 | Ga0453684_0053964 | Ga0453684_0053964_383_961 | 183 |
| 37 | 3300005329 | Ga0070683_100397718 | Ga0070683_1003977182 | 184 |
| 38 | 3300032004 | Ga0307414_10667733 | Ga0307414_106677331 | 184 |
| 39 | iso_pu_bacteria | 2585428060 | 2587749304 | 185 |
| 40 | iso_pu_bacteria | 2588253712 | 2588446690 | 185 |
| 41 | 3300046453 | Ga0495627_004415 | Ga0495627_004415_30_647 | 186 |
| 42 | 3300046501 | Ga0495607_0028541 | Ga0495607_0028541_1725_2342 | 186 |
| 43 | 3300046513 | Ga0495616_0011798 | Ga0495616_0011798_44_661 | 186 |
| 44 | 3300046810 | Ga0495660_0095480 | Ga0495660_0095480_320_937 | 186 |
| 45 | 3300053090 | Ga0500646_0005478 | Ga0500646_0005478_2330_2953 | 186 |
| 46 | 3300053096 | Ga0500641_0000102 | Ga0500641_0000102_6073_6696 | 186 |
| 47 | 3300053726 | Ga0500584_035009 | Ga0500584_035009_1274_1897 | 186 |
| 48 | iso_pu_bacteria | 2738541279 | 2738734554 | 186 |
| 49 | iso_pu_bacteria | 2738541285 | 2738767313 | 186 |
| 50 | iso_pu_bacteria | 2738543007 | 2739216136 | 186 |
| 51 | iso_pu_bacteria | 2910245624 | 2910247339 | 188 |
| 52 | 3300003322 | rootL2_10047565 | rootL2_100475652 | 189 |
| 53 | 3300003323 | rootH1_10201698 | rootH1_102016982 | 189 |
| 54 | 3300005288 | Ga0065714_10005223 | Ga0065714_100052233 | 189 |
| 55 | 3300005288 | Ga0065714_10141957 | Ga0065714_101419571 | 189 |
| 56 | 3300005616 | Ga0068852_100454428 | Ga0068852_1004544281 | 189 |
| 57 | 3300006195 | Ga0075366_10000267 | Ga0075366_1000026711 | 189 |
| 58 | 3300028794 | Ga0307515_10003151 | Ga0307515_1000315127 | 189 |
| 59 | 3300046558 | Ga0495633_0000004 | Ga0495633_0000004_326500_327084 | 189 |
| 60 | 3300046660 | Ga0495625_0001578 | Ga0495625_0001578_8654_9238 | 189 |
| 61 | 3300047472 | Ga0495686_0001710 | Ga0495686_0001710_11185_11754 | 189 |
| 62 | 3300050493 | nmdc:mga0k408_83_c1 | nmdc:mga0k408_83_c1_26673_27257 | 189 |
| 63 | 3300009093 | Ga0105240_10031537 | Ga0105240_100315378 | 190 |
| 64 | 3300025913 | Ga0207695_10202691 | Ga0207695_102026911 | 190 |
| 65 | 3300025926 | Ga0207659_10442261 | Ga0207659_104422612 | 190 |
| 66 | 3300047472 | Ga0495686_0000587 | Ga0495686_0000587_30459_31031 | 190 |
| 67 | 3300013307 | Ga0157372_10787987 | Ga0157372_107879871 | 191 |
| 68 | 3300026088 | Ga0207641_10217039 | Ga0207641_102170391 | 191 |
| 69 | 3300050493 | nmdc:mga0k408_50701_c2 | nmdc:mga0k408_50701_c2_1287_1862 | 191 |
| 70 | 3300053178 | Ga0500637_0073082 | Ga0500637_0073082_126_701 | 191 |
| 71 | 3300003322 | rootL2_10066252 | rootL2_100662522 | 192 |
| 72 | 3300003323 | rootH1_10068010 | rootH1_100680106 | 192 |
| 73 | 3300004625 | Ga0055543_1032052 | Ga0055543_10320521 | 192 |
| 74 | 3300005262 | Ga0065165_1000783 | Ga0065165_100078340 | 192 |
| 75 | 3300005289 | Ga0065704_10000434 | Ga0065704_1000043411 | 192 |
| 76 | 3300005331 | Ga0070670_100548416 | Ga0070670_1005484162 | 192 |
| 77 | 3300005354 | Ga0070675_100035329 | Ga0070675_1000353293 | 192 |
| 78 | 3300005354 | Ga0070675_100944169 | Ga0070675_1009441691 | 192 |
| 79 | 3300005356 | Ga0070674_100344086 | Ga0070674_1003440861 | 192 |
| 80 | 3300005564 | Ga0070664_100594217 | Ga0070664_1005942171 | 192 |
| 81 | 3300005843 | Ga0068860_100000103 | Ga0068860_10000010315 | 192 |
| 82 | 3300006237 | Ga0097621_100431744 | Ga0097621_1004317441 | 192 |
| 83 | 3300006358 | Ga0068871_101149623 | Ga0068871_1011496231 | 192 |
| 84 | 3300009094 | Ga0111539_11024817 | Ga0111539_110248172 | 192 |
| 85 | 3300009176 | Ga0105242_10096908 | Ga0105242_100969083 | 192 |
| 86 | 3300009176 | Ga0105242_10849262 | Ga0105242_108492621 | 192 |
| 87 | 3300010375 | Ga0105239_10346824 | Ga0105239_103468243 | 192 |
| 88 | 3300013100 | Ga0157373_10000773 | Ga0157373_100007734 | 192 |
| 89 | 3300013100 | Ga0157373_10137532 | Ga0157373_101375321 | 192 |
| 90 | 3300013102 | Ga0157371_10125654 | Ga0157371_101256541 | 192 |
| 91 | 3300013104 | Ga0157370_10118858 | Ga0157370_101188583 | 192 |
| 92 | 3300013306 | Ga0163162_10000269 | Ga0163162_1000026927 | 192 |
| 93 | 3300013306 | Ga0163162_10151838 | Ga0163162_101518382 | 192 |
| 94 | 3300013308 | Ga0157375_10208838 | Ga0157375_102088383 | 192 |
| 95 | 3300014326 | Ga0157380_10678250 | Ga0157380_106782503 | 192 |
| 96 | 3300015261 | Ga0182006_1015245 | Ga0182006_10152451 | 192 |
| 97 | 3300017792 | Ga0163161_10396689 | Ga0163161_103966891 | 192 |
| 98 | 3300025921 | Ga0207652_10394030 | Ga0207652_103940302 | 192 |
| 99 | 3300025926 | Ga0207659_10717334 | Ga0207659_107173341 | 192 |
| 100 | 3300025937 | Ga0207669_10135868 | Ga0207669_101358681 | 192 |
| 101 | 3300025961 | Ga0207712_10923977 | Ga0207712_109239771 | 192 |
| 102 | 3300028381 | Ga0268264_10000013 | Ga0268264_10000013305 | 192 |
| 103 | 3300028794 | Ga0307515_10001200 | Ga0307515_1000120046 | 192 |
| 104 | 3300031251 | Ga0265327_10000090 | Ga0265327_1000009068 | 192 |
| 105 | 3300031730 | Ga0307516_10000750 | Ga0307516_100007507 | 192 |
| 106 | 3300031730 | Ga0307516_10108759 | Ga0307516_101087593 | 192 |
| 107 | 3300031911 | Ga0307412_10000045 | Ga0307412_1000004536 | 192 |
| 108 | 3300032004 | Ga0307414_10010586 | Ga0307414_100105866 | 192 |
| 109 | 3300032004 | Ga0307414_10065689 | Ga0307414_100656894 | 192 |
| 110 | 3300032004 | Ga0307414_10115768 | Ga0307414_101157682 | 192 |
| 111 | 3300032004 | Ga0307414_10263716 | Ga0307414_102637162 | 192 |
| 112 | 3300032004 | Ga0307414_10298692 | Ga0307414_102986921 | 192 |
| 113 | 3300032004 | Ga0307414_10303644 | Ga0307414_103036442 | 192 |
| 114 | 3300032004 | Ga0307414_10634199 | Ga0307414_106341992 | 192 |
| 115 | 3300032005 | Ga0307411_10272757 | Ga0307411_102727572 | 192 |
| 116 | 3300037418 | Ga0395900_0090633 | Ga0395900_0090633_724_1302 | 192 |
| 117 | 3300042007 | Ga0439449_0002155 | Ga0439449_0002155_1934_2512 | 192 |
| 118 | 3300042014 | Ga0439457_011430 | Ga0439457_011430_71_649 | 192 |
| 119 | 3300046460 | Ga0495638_0016688 | Ga0495638_0016688_681_1274 | 192 |
| 120 | 3300046513 | Ga0495616_0019098 | Ga0495616_0019098_808_1410 | 192 |
| 121 | 3300046524 | Ga0495648_0015092 | Ga0495648_0015092_3095_3688 | 192 |
| 122 | 3300046616 | Ga0495668_0002355 | Ga0495668_0002355_13039_13617 | 192 |
| 123 | 3300046665 | Ga0495661_0001005 | Ga0495661_0001005_3883_4467 | 192 |
| 124 | 3300046665 | Ga0495661_0139314 | Ga0495661_0139314_682_1266 | 192 |
| 125 | 3300049459 | Ga0495678_028959 | Ga0495678_028959_566_1168 | 192 |
| 126 | 3300049515 | Ga0501292_039786 | Ga0501292_039786_213_791 | 192 |
| 127 | 3300049522 | Ga0501299_045468 | Ga0501299_045468_196_774 | 192 |
| 128 | 3300049683 | Ga0501253_004210 | Ga0501253_004210_977_1555 | 192 |
| 129 | 3300049686 | Ga0501257_029647 | Ga0501257_029647_193_771 | 192 |
| 130 | 3300049703 | Ga0501219_000018 | Ga0501219_000018_11953_12537 | 192 |
| 131 | 3300049765 | Ga0501268_043475 | Ga0501268_043475_16_594 | 192 |
| 132 | 3300049822 | Ga0501035_0165947 | Ga0501035_0165947_85_663 | 192 |
| 133 | 3300049823 | Ga0501044_1035178 | Ga0501044_1035178_91_669 | 192 |
| 134 | 3300050005 | Ga0501284_00010 | Ga0501284_00010_110519_111103 | 192 |
| 135 | 3300050511 | nmdc:mga08y16_328190_c1 | nmdc:mga08y16_328190_c1_540_1118 | 192 |
| 136 | 3300053137 | Ga0500561_0074546 | Ga0500561_0074546_308_886 | 192 |
| 137 | 3300053156 | Ga0500622_0002517 | Ga0500622_0002517_6152_6745 | 192 |
| 138 | 3300053156 | Ga0500622_0003157 | Ga0500622_0003157_5135_5713 | 192 |
| 139 | 3300003320 | rootH2_10059655 | rootH2_100596555 | 193 |
| 140 | 3300003322 | rootL2_10060049 | rootL2_100600492 | 193 |
| 141 | 3300003322 | rootL2_10119527 | rootL2_101195272 | 193 |
| 142 | 3300003322 | rootL2_10269286 | rootL2_102692863 | 193 |
| 143 | 3300003794 | Ga0055531_10000547 | Ga0055531_1000054720 | 193 |
| 144 | 3300005295 | Ga0065707_10279509 | Ga0065707_102795092 | 193 |
| 145 | 3300005327 | Ga0070658_10018091 | Ga0070658_100180912 | 193 |
| 146 | 3300005327 | Ga0070658_10073166 | Ga0070658_100731663 | 193 |
| 147 | 3300005327 | Ga0070658_10349552 | Ga0070658_103495522 | 193 |
| 148 | 3300005327 | Ga0070658_10493979 | Ga0070658_104939792 | 193 |
| 149 | 3300005327 | Ga0070658_10989651 | Ga0070658_109896511 | 193 |
| 150 | 3300005328 | Ga0070676_10160171 | Ga0070676_101601711 | 193 |
| 151 | 3300005329 | Ga0070683_100194082 | Ga0070683_1001940822 | 193 |
| 152 | 3300005329 | Ga0070683_100238624 | Ga0070683_1002386243 | 193 |
| 153 | 3300005330 | Ga0070690_100004064 | Ga0070690_1000040643 | 193 |
| 154 | 3300005330 | Ga0070690_100074283 | Ga0070690_1000742832 | 193 |
| 155 | 3300005334 | Ga0068869_100025882 | Ga0068869_1000258823 | 193 |
| 156 | 3300005334 | Ga0068869_100170529 | Ga0068869_1001705292 | 193 |
| 157 | 3300005335 | Ga0070666_10086777 | Ga0070666_100867771 | 193 |
| 158 | 3300005335 | Ga0070666_10494669 | Ga0070666_104946691 | 193 |
| 159 | 3300005336 | Ga0070680_100044464 | Ga0070680_1000444642 | 193 |
| 160 | 3300005336 | Ga0070680_100055428 | Ga0070680_1000554283 | 193 |
| 161 | 3300005336 | Ga0070680_100196788 | Ga0070680_1001967882 | 193 |
| 162 | 3300005337 | Ga0070682_100042786 | Ga0070682_1000427864 | 193 |
| 163 | 3300005337 | Ga0070682_100492581 | Ga0070682_1004925811 | 193 |
| 164 | 3300005338 | Ga0068868_100078830 | Ga0068868_1000788301 | 193 |
| 165 | 3300005338 | Ga0068868_100608702 | Ga0068868_1006087022 | 193 |
| 166 | 3300005339 | Ga0070660_100023659 | Ga0070660_1000236592 | 193 |
| 167 | 3300005339 | Ga0070660_100030483 | Ga0070660_1000304832 | 193 |
| 168 | 3300005339 | Ga0070660_100032498 | Ga0070660_1000324982 | 193 |
| 169 | 3300005339 | Ga0070660_100040290 | Ga0070660_1000402901 | 193 |
| 170 | 3300005339 | Ga0070660_100489035 | Ga0070660_1004890352 | 193 |
| 171 | 3300005339 | Ga0070660_100890760 | Ga0070660_1008907601 | 193 |
| 172 | 3300005340 | Ga0070689_100255521 | Ga0070689_1002555212 | 193 |
| 173 | 3300005344 | Ga0070661_100346230 | Ga0070661_1003462302 | 193 |
| 174 | 3300005344 | Ga0070661_100666069 | Ga0070661_1006660691 | 193 |
| 175 | 3300005353 | Ga0070669_101279287 | Ga0070669_1012792871 | 193 |
| 176 | 3300005355 | Ga0070671_100056337 | Ga0070671_1000563373 | 193 |
| 177 | 3300005356 | Ga0070674_100714547 | Ga0070674_1007145471 | 193 |
| 178 | 3300005364 | Ga0070673_100071639 | Ga0070673_1000716392 | 193 |
| 179 | 3300005364 | Ga0070673_100239540 | Ga0070673_1002395402 | 193 |
| 180 | 3300005366 | Ga0070659_100004616 | Ga0070659_1000046169 | 193 |
| 181 | 3300005366 | Ga0070659_100040009 | Ga0070659_1000400094 | 193 |
| 182 | 3300005367 | Ga0070667_100028100 | Ga0070667_1000281003 | 193 |
| 183 | 3300005438 | Ga0070701_10066530 | Ga0070701_100665301 | 193 |
| 184 | 3300005441 | Ga0070700_100425656 | Ga0070700_1004256562 | 193 |
| 185 | 3300005456 | Ga0070678_100048430 | Ga0070678_1000484302 | 193 |
| 186 | 3300005458 | Ga0070681_10017834 | Ga0070681_100178346 | 193 |
| 187 | 3300005458 | Ga0070681_10053622 | Ga0070681_100536226 | 193 |
| 188 | 3300005458 | Ga0070681_10094742 | Ga0070681_100947422 | 193 |
| 189 | 3300005458 | Ga0070681_10170269 | Ga0070681_101702692 | 193 |
| 190 | 3300005459 | Ga0068867_100268461 | Ga0068867_1002684611 | 193 |
| 191 | 3300005466 | Ga0070685_10103462 | Ga0070685_101034622 | 193 |
| 192 | 3300005530 | Ga0070679_100008912 | Ga0070679_1000089124 | 193 |
| 193 | 3300005530 | Ga0070679_100033073 | Ga0070679_1000330737 | 193 |
| 194 | 3300005530 | Ga0070679_100038687 | Ga0070679_1000386872 | 193 |
| 195 | 3300005530 | Ga0070679_100062854 | Ga0070679_1000628542 | 193 |
| 196 | 3300005530 | Ga0070679_100127702 | Ga0070679_1001277024 | 193 |
| 197 | 3300005530 | Ga0070679_100166661 | Ga0070679_1001666612 | 193 |
| 198 | 3300005530 | Ga0070679_100667278 | Ga0070679_1006672781 | 193 |
| 199 | 3300005535 | Ga0070684_100089178 | Ga0070684_1000891784 | 193 |
| 200 | 3300005539 | Ga0068853_100084514 | Ga0068853_1000845142 | 193 |
| 201 | 3300005539 | Ga0068853_100304675 | Ga0068853_1003046752 | 193 |
| 202 | 3300005539 | Ga0068853_100682633 | Ga0068853_1006826332 | 193 |
| 203 | 3300005539 | Ga0068853_100866113 | Ga0068853_1008661131 | 193 |
| 204 | 3300005543 | Ga0070672_100202181 | Ga0070672_1002021813 | 193 |
| 205 | 3300005543 | Ga0070672_100593137 | Ga0070672_1005931371 | 193 |
| 206 | 3300005544 | Ga0070686_100012608 | Ga0070686_1000126083 | 193 |
| 207 | 3300005544 | Ga0070686_100107660 | Ga0070686_1001076603 | 193 |
| 208 | 3300005544 | Ga0070686_100144421 | Ga0070686_1001444212 | 193 |
| 209 | 3300005546 | Ga0070696_100991432 | Ga0070696_1009914321 | 193 |
| 210 | 3300005548 | Ga0070665_100521532 | Ga0070665_1005215322 | 193 |
| 211 | 3300005563 | Ga0068855_100002929 | Ga0068855_10000292916 | 193 |
| 212 | 3300005563 | Ga0068855_100016232 | Ga0068855_1000162321 | 193 |
| 213 | 3300005563 | Ga0068855_100026613 | Ga0068855_1000266135 | 193 |
| 214 | 3300005563 | Ga0068855_100698194 | Ga0068855_1006981942 | 193 |
| 215 | 3300005563 | Ga0068855_100884616 | Ga0068855_1008846161 | 193 |
| 216 | 3300005564 | Ga0070664_100076806 | Ga0070664_1000768063 | 193 |
| 217 | 3300005564 | Ga0070664_100577575 | Ga0070664_1005775751 | 193 |
| 218 | 3300005577 | Ga0068857_100358914 | Ga0068857_1003589142 | 193 |
| 219 | 3300005577 | Ga0068857_100651302 | Ga0068857_1006513022 | 193 |
| 220 | 3300005578 | Ga0068854_100061147 | Ga0068854_1000611473 | 193 |
| 221 | 3300005578 | Ga0068854_100094985 | Ga0068854_1000949852 | 193 |
| 222 | 3300005614 | Ga0068856_100033276 | Ga0068856_1000332766 | 193 |
| 223 | 3300005614 | Ga0068856_100859106 | Ga0068856_1008591062 | 193 |
| 224 | 3300005614 | Ga0068856_101175719 | Ga0068856_1011757191 | 193 |
| 225 | 3300005615 | Ga0070702_100064973 | Ga0070702_1000649732 | 193 |
| 226 | 3300005616 | Ga0068852_100002674 | Ga0068852_1000026743 | 193 |
| 227 | 3300005616 | Ga0068852_100094203 | Ga0068852_1000942032 | 193 |
| 228 | 3300005616 | Ga0068852_100253275 | Ga0068852_1002532752 | 193 |
| 229 | 3300005616 | Ga0068852_100294431 | Ga0068852_1002944313 | 193 |
| 230 | 3300005718 | Ga0068866_10575850 | Ga0068866_105758501 | 193 |
| 231 | 3300005719 | Ga0068861_100326670 | Ga0068861_1003266703 | 193 |
| 232 | 3300005834 | Ga0068851_10151404 | Ga0068851_101514041 | 193 |
| 233 | 3300005841 | Ga0068863_100174387 | Ga0068863_1001743871 | 193 |
| 234 | 3300005841 | Ga0068863_100374239 | Ga0068863_1003742391 | 193 |
| 235 | 3300005842 | Ga0068858_100181258 | Ga0068858_1001812583 | 193 |
| 236 | 3300005842 | Ga0068858_101186595 | Ga0068858_1011865952 | 193 |
| 237 | 3300006163 | Ga0070715_10148234 | Ga0070715_101482342 | 193 |
| 238 | 3300006195 | Ga0075366_10002159 | Ga0075366_1000215911 | 193 |
| 239 | 3300006195 | Ga0075366_10280698 | Ga0075366_102806982 | 193 |
| 240 | 3300006358 | Ga0068871_100048524 | Ga0068871_1000485243 | 193 |
| 241 | 3300006881 | Ga0068865_100442794 | Ga0068865_1004427943 | 193 |
| 242 | 3300009093 | Ga0105240_10149391 | Ga0105240_101493912 | 193 |
| 243 | 3300009174 | Ga0105241_10006659 | Ga0105241_100066597 | 193 |
| 244 | 3300009174 | Ga0105241_10557929 | Ga0105241_105579292 | 193 |
| 245 | 3300009176 | Ga0105242_10034759 | Ga0105242_100347591 | 193 |
| 246 | 3300009177 | Ga0105248_10478351 | Ga0105248_104783512 | 193 |
| 247 | 3300009545 | Ga0105237_10034528 | Ga0105237_100345288 | 193 |
| 248 | 3300010375 | Ga0105239_10025624 | Ga0105239_100256246 | 193 |
| 249 | 3300010375 | Ga0105239_10088742 | Ga0105239_100887423 | 193 |
| 250 | 3300011119 | Ga0105246_10131740 | Ga0105246_101317402 | 193 |
| 251 | 3300013100 | Ga0157373_10000715 | Ga0157373_1000071520 | 193 |
| 252 | 3300013100 | Ga0157373_10009211 | Ga0157373_100092118 | 193 |
| 253 | 3300013100 | Ga0157373_10013271 | Ga0157373_100132715 | 193 |
| 254 | 3300013100 | Ga0157373_10061230 | Ga0157373_100612302 | 193 |
| 255 | 3300013100 | Ga0157373_10176881 | Ga0157373_101768812 | 193 |
| 256 | 3300013102 | Ga0157371_10000584 | Ga0157371_1000058423 | 193 |
| 257 | 3300013102 | Ga0157371_10001101 | Ga0157371_100011012 | 193 |
| 258 | 3300013102 | Ga0157371_10001748 | Ga0157371_1000174817 | 193 |
| 259 | 3300013102 | Ga0157371_10005044 | Ga0157371_100050443 | 193 |
| 260 | 3300013102 | Ga0157371_10038391 | Ga0157371_100383915 | 193 |
| 261 | 3300013102 | Ga0157371_10061701 | Ga0157371_100617011 | 193 |
| 262 | 3300013102 | Ga0157371_10312601 | Ga0157371_103126012 | 193 |
| 263 | 3300013102 | Ga0157371_10336716 | Ga0157371_103367162 | 193 |
| 264 | 3300013104 | Ga0157370_10000821 | Ga0157370_100008212 | 193 |
| 265 | 3300013104 | Ga0157370_10012968 | Ga0157370_100129688 | 193 |
| 266 | 3300013104 | Ga0157370_10067444 | Ga0157370_100674443 | 193 |
| 267 | 3300013104 | Ga0157370_10126713 | Ga0157370_101267131 | 193 |
| 268 | 3300013104 | Ga0157370_10434975 | Ga0157370_104349752 | 193 |
| 269 | 3300013104 | Ga0157370_10475696 | Ga0157370_104756961 | 193 |
| 270 | 3300013105 | Ga0157369_10003166 | Ga0157369_1000316614 | 193 |
| 271 | 3300013105 | Ga0157369_10007205 | Ga0157369_100072053 | 193 |
| 272 | 3300013105 | Ga0157369_10045270 | Ga0157369_100452705 | 193 |
| 273 | 3300013105 | Ga0157369_10190657 | Ga0157369_101906572 | 193 |
| 274 | 3300013105 | Ga0157369_10452867 | Ga0157369_104528671 | 193 |
| 275 | 3300013105 | Ga0157369_10457844 | Ga0157369_104578442 | 193 |
| 276 | 3300013296 | Ga0157374_10090571 | Ga0157374_100905712 | 193 |
| 277 | 3300013296 | Ga0157374_10243555 | Ga0157374_102435553 | 193 |
| 278 | 3300013297 | Ga0157378_10005693 | Ga0157378_100056938 | 193 |
| 279 | 3300013297 | Ga0157378_10669740 | Ga0157378_106697402 | 193 |
| 280 | 3300013306 | Ga0163162_10006296 | Ga0163162_100062964 | 193 |
| 281 | 3300013306 | Ga0163162_10037892 | Ga0163162_100378922 | 193 |
| 282 | 3300013306 | Ga0163162_10276104 | Ga0163162_102761041 | 193 |
| 283 | 3300013307 | Ga0157372_10001337 | Ga0157372_1000133723 | 193 |
| 284 | 3300013307 | Ga0157372_10008116 | Ga0157372_100081167 | 193 |
| 285 | 3300013307 | Ga0157372_10049206 | Ga0157372_100492062 | 193 |
| 286 | 3300013307 | Ga0157372_10050140 | Ga0157372_100501404 | 193 |
| 287 | 3300013307 | Ga0157372_10086712 | Ga0157372_100867121 | 193 |
| 288 | 3300013307 | Ga0157372_10113843 | Ga0157372_101138432 | 193 |
| 289 | 3300013307 | Ga0157372_10166304 | Ga0157372_101663042 | 193 |
| 290 | 3300013307 | Ga0157372_10225668 | Ga0157372_102256681 | 193 |
| 291 | 3300013307 | Ga0157372_10267520 | Ga0157372_102675202 | 193 |
| 292 | 3300013307 | Ga0157372_10410370 | Ga0157372_104103702 | 193 |
| 293 | 3300013307 | Ga0157372_11760341 | Ga0157372_117603411 | 193 |
| 294 | 3300013307 | Ga0157372_12005635 | Ga0157372_120056351 | 193 |
| 295 | 3300013308 | Ga0157375_10114919 | Ga0157375_101149192 | 193 |
| 296 | 3300013308 | Ga0157375_11272453 | Ga0157375_112724531 | 193 |
| 297 | 3300014325 | Ga0163163_10200698 | Ga0163163_102006983 | 193 |
| 298 | 3300014326 | Ga0157380_10929981 | Ga0157380_109299811 | 193 |
| 299 | 3300014745 | Ga0157377_10099110 | Ga0157377_100991101 | 193 |
| 300 | 3300014968 | Ga0157379_10151750 | Ga0157379_101517502 | 193 |
| 301 | 3300014969 | Ga0157376_10100219 | Ga0157376_101002193 | 193 |
| 302 | 3300014969 | Ga0157376_10658249 | Ga0157376_106582491 | 193 |
| 303 | 3300014969 | Ga0157376_11406742 | Ga0157376_114067421 | 193 |
| 304 | 3300017792 | Ga0163161_10036180 | Ga0163161_100361804 | 193 |
| 305 | 3300025304 | Ga0209257_1000008 | Ga0209257_1000008926 | 193 |
| 306 | 3300025899 | Ga0207642_10760752 | Ga0207642_107607521 | 193 |
| 307 | 3300025901 | Ga0207688_10046406 | Ga0207688_100464063 | 193 |
| 308 | 3300025903 | Ga0207680_10164704 | Ga0207680_101647042 | 193 |
| 309 | 3300025904 | Ga0207647_10073242 | Ga0207647_100732422 | 193 |
| 310 | 3300025904 | Ga0207647_10221644 | Ga0207647_102216442 | 193 |
| 311 | 3300025907 | Ga0207645_10034054 | Ga0207645_100340543 | 193 |
| 312 | 3300025907 | Ga0207645_10061658 | Ga0207645_100616582 | 193 |
| 313 | 3300025908 | Ga0207643_10140691 | Ga0207643_101406912 | 193 |
| 314 | 3300025909 | Ga0207705_10015359 | Ga0207705_100153595 | 193 |
| 315 | 3300025909 | Ga0207705_10042401 | Ga0207705_100424011 | 193 |
| 316 | 3300025909 | Ga0207705_10052154 | Ga0207705_100521542 | 193 |
| 317 | 3300025909 | Ga0207705_10250331 | Ga0207705_102503311 | 193 |
| 318 | 3300025909 | Ga0207705_10522677 | Ga0207705_105226771 | 193 |
| 319 | 3300025909 | Ga0207705_10541175 | Ga0207705_105411752 | 193 |
| 320 | 3300025909 | Ga0207705_10561211 | Ga0207705_105612112 | 193 |
| 321 | 3300025911 | Ga0207654_10016950 | Ga0207654_100169505 | 193 |
| 322 | 3300025912 | Ga0207707_10035725 | Ga0207707_100357257 | 193 |
| 323 | 3300025912 | Ga0207707_10068590 | Ga0207707_100685905 | 193 |
| 324 | 3300025912 | Ga0207707_10226888 | Ga0207707_102268882 | 193 |
| 325 | 3300025912 | Ga0207707_10544497 | Ga0207707_105444972 | 193 |
| 326 | 3300025912 | Ga0207707_10567092 | Ga0207707_105670921 | 193 |
| 327 | 3300025913 | Ga0207695_10208185 | Ga0207695_102081852 | 193 |
| 328 | 3300025913 | Ga0207695_10317856 | Ga0207695_103178561 | 193 |
| 329 | 3300025914 | Ga0207671_10004239 | Ga0207671_100042398 | 193 |
| 330 | 3300025914 | Ga0207671_10346423 | Ga0207671_103464232 | 193 |
| 331 | 3300025917 | Ga0207660_10046533 | Ga0207660_100465331 | 193 |
| 332 | 3300025917 | Ga0207660_10047899 | Ga0207660_100478992 | 193 |
| 333 | 3300025917 | Ga0207660_10537056 | Ga0207660_105370561 | 193 |
| 334 | 3300025918 | Ga0207662_10025357 | Ga0207662_100253572 | 193 |
| 335 | 3300025919 | Ga0207657_10016002 | Ga0207657_100160024 | 193 |
| 336 | 3300025919 | Ga0207657_10023224 | Ga0207657_100232247 | 193 |
| 337 | 3300025919 | Ga0207657_10035971 | Ga0207657_100359711 | 193 |
| 338 | 3300025919 | Ga0207657_10048764 | Ga0207657_100487642 | 193 |
| 339 | 3300025919 | Ga0207657_10124824 | Ga0207657_101248243 | 193 |
| 340 | 3300025921 | Ga0207652_10000103 | Ga0207652_100001039 | 193 |
| 341 | 3300025921 | Ga0207652_10002216 | Ga0207652_100022162 | 193 |
| 342 | 3300025921 | Ga0207652_10098138 | Ga0207652_100981382 | 193 |
| 343 | 3300025921 | Ga0207652_10121463 | Ga0207652_101214632 | 193 |
| 344 | 3300025921 | Ga0207652_10253855 | Ga0207652_102538551 | 193 |
| 345 | 3300025921 | Ga0207652_10257070 | Ga0207652_102570701 | 193 |
| 346 | 3300025921 | Ga0207652_10519489 | Ga0207652_105194892 | 193 |
| 347 | 3300025925 | Ga0207650_10125637 | Ga0207650_101256373 | 193 |
| 348 | 3300025925 | Ga0207650_10782145 | Ga0207650_107821451 | 193 |
| 349 | 3300025931 | Ga0207644_10133843 | Ga0207644_101338431 | 193 |
| 350 | 3300025932 | Ga0207690_10128733 | Ga0207690_101287332 | 193 |
| 351 | 3300025932 | Ga0207690_10138474 | Ga0207690_101384742 | 193 |
| 352 | 3300025932 | Ga0207690_10393525 | Ga0207690_103935252 | 193 |
| 353 | 3300025933 | Ga0207706_10025883 | Ga0207706_100258834 | 193 |
| 354 | 3300025933 | Ga0207706_10309015 | Ga0207706_103090152 | 193 |
| 355 | 3300025934 | Ga0207686_10095357 | Ga0207686_100953573 | 193 |
| 356 | 3300025936 | Ga0207670_10699279 | Ga0207670_106992791 | 193 |
| 357 | 3300025938 | Ga0207704_10205299 | Ga0207704_102052992 | 193 |
| 358 | 3300025940 | Ga0207691_10316119 | Ga0207691_103161191 | 193 |
| 359 | 3300025940 | Ga0207691_11007321 | Ga0207691_110073211 | 193 |
| 360 | 3300025942 | Ga0207689_10215436 | Ga0207689_102154361 | 193 |
| 361 | 3300025942 | Ga0207689_10450182 | Ga0207689_104501821 | 193 |
| 362 | 3300025942 | Ga0207689_10879480 | Ga0207689_108794801 | 193 |
| 363 | 3300025944 | Ga0207661_10126202 | Ga0207661_101262022 | 193 |
| 364 | 3300025944 | Ga0207661_10370493 | Ga0207661_103704932 | 193 |
| 365 | 3300025949 | Ga0207667_10010940 | Ga0207667_100109408 | 193 |
| 366 | 3300025949 | Ga0207667_10147754 | Ga0207667_101477542 | 193 |
| 367 | 3300025949 | Ga0207667_10223496 | Ga0207667_102234962 | 193 |
| 368 | 3300025949 | Ga0207667_10465676 | Ga0207667_104656761 | 193 |
| 369 | 3300025949 | Ga0207667_10893091 | Ga0207667_108930911 | 193 |
| 370 | 3300025949 | Ga0207667_11040786 | Ga0207667_110407862 | 193 |
| 371 | 3300025960 | Ga0207651_10145319 | Ga0207651_101453192 | 193 |
| 372 | 3300025960 | Ga0207651_10168227 | Ga0207651_101682272 | 193 |
| 373 | 3300025981 | Ga0207640_10071303 | Ga0207640_100713032 | 193 |
| 374 | 3300025981 | Ga0207640_10107647 | Ga0207640_101076472 | 193 |
| 375 | 3300026035 | Ga0207703_10160187 | Ga0207703_101601872 | 193 |
| 376 | 3300026041 | Ga0207639_10050543 | Ga0207639_100505432 | 193 |
| 377 | 3300026041 | Ga0207639_10116674 | Ga0207639_101166743 | 193 |
| 378 | 3300026041 | Ga0207639_10168524 | Ga0207639_101685242 | 193 |
| 379 | 3300026067 | Ga0207678_10020096 | Ga0207678_100200962 | 193 |
| 380 | 3300026067 | Ga0207678_10448554 | Ga0207678_104485543 | 193 |
| 381 | 3300026078 | Ga0207702_10291757 | Ga0207702_102917572 | 193 |
| 382 | 3300026078 | Ga0207702_10697806 | Ga0207702_106978061 | 193 |
| 383 | 3300026078 | Ga0207702_10810299 | Ga0207702_108102991 | 193 |
| 384 | 3300026088 | Ga0207641_10196924 | Ga0207641_101969241 | 193 |
| 385 | 3300026088 | Ga0207641_11475271 | Ga0207641_114752711 | 193 |
| 386 | 3300026089 | Ga0207648_10090349 | Ga0207648_100903492 | 193 |
| 387 | 3300026095 | Ga0207676_10103340 | Ga0207676_101033401 | 193 |
| 388 | 3300026116 | Ga0207674_10160942 | Ga0207674_101609423 | 193 |
| 389 | 3300026116 | Ga0207674_10194847 | Ga0207674_101948472 | 193 |
| 390 | 3300026118 | Ga0207675_100461791 | Ga0207675_1004617912 | 193 |
| 391 | 3300026121 | Ga0207683_10119901 | Ga0207683_101199012 | 193 |
| 392 | 3300026142 | Ga0207698_10210831 | Ga0207698_102108311 | 193 |
| 393 | 3300026142 | Ga0207698_10360050 | Ga0207698_103600502 | 193 |
| 394 | 3300026142 | Ga0207698_10440941 | Ga0207698_104409412 | 193 |
| 395 | 3300026142 | Ga0207698_10882300 | Ga0207698_108823001 | 193 |
| 396 | 3300031250 | Ga0265331_10039802 | Ga0265331_100398022 | 193 |
| 397 | 3300031548 | Ga0307408_100122083 | Ga0307408_1001220832 | 193 |
| 398 | 3300031824 | Ga0307413_10033480 | Ga0307413_100334802 | 193 |
| 399 | 3300031911 | Ga0307412_10070427 | Ga0307412_100704273 | 193 |
| 400 | 3300032004 | Ga0307414_10040587 | Ga0307414_100405874 | 193 |
| 401 | 3300032004 | Ga0307414_11272229 | Ga0307414_112722291 | 193 |
| 402 | 3300032005 | Ga0307411_10056388 | Ga0307411_100563882 | 193 |
| 403 | 3300032126 | Ga0307415_100049326 | Ga0307415_1000493263 | 193 |
| 404 | 3300035086 | Ga0373934_0016371 | Ga0373934_0016371_285_902 | 193 |
| 405 | 3300035089 | Ga0373944_0007847 | Ga0373944_0007847_1279_1893 | 193 |
| 406 | 3300035119 | Ga0373956_0127892 | Ga0373956_0127892_540_1157 | 193 |
| 407 | 3300035172 | Ga0373955_0004521 | Ga0373955_0004521_3197_3814 | 193 |
| 408 | 3300035691 | Ga0373931_0268863 | Ga0373931_0268863_336_920 | 193 |
| 409 | 3300035692 | Ga0373935_0301566 | Ga0373935_0301566_461_1078 | 193 |
| 410 | 3300036401 | Ga0373937_0025749 | Ga0373937_0025749_334_951 | 193 |
| 411 | 3300037312 | Ga0395899_0001903 | Ga0395899_0001903_16335_16916 | 193 |
| 412 | 3300037312 | Ga0395899_0012217 | Ga0395899_0012217_3097_3678 | 193 |
| 413 | 3300037312 | Ga0395899_0041997 | Ga0395899_0041997_139_720 | 193 |
| 414 | 3300037312 | Ga0395899_0061562 | Ga0395899_0061562_1931_2512 | 193 |
| 415 | 3300037312 | Ga0395899_0442568 | Ga0395899_0442568_60_641 | 193 |
| 416 | 3300037418 | Ga0395900_0013876 | Ga0395900_0013876_5512_6093 | 193 |
| 417 | 3300037418 | Ga0395900_0026980 | Ga0395900_0026980_3547_4128 | 193 |
| 418 | 3300037418 | Ga0395900_0091633 | Ga0395900_0091633_2126_2707 | 193 |
| 419 | 3300037418 | Ga0395900_0115678 | Ga0395900_0115678_274_855 | 193 |
| 420 | 3300037418 | Ga0395900_0143693 | Ga0395900_0143693_1486_2070 | 193 |
| 421 | 3300037418 | Ga0395900_0301136 | Ga0395900_0301136_902_1555 | 193 |
| 422 | 3300037418 | Ga0395900_0828972 | Ga0395900_0828972_28_609 | 193 |
| 423 | 3300037466 | Ga0395898_0004173 | Ga0395898_0004173_6214_6795 | 193 |
| 424 | 3300037466 | Ga0395898_0009255 | Ga0395898_0009255_6578_7231 | 193 |
| 425 | 3300037466 | Ga0395898_0035789 | Ga0395898_0035789_3291_3872 | 193 |
| 426 | 3300037466 | Ga0395898_0167565 | Ga0395898_0167565_1507_2088 | 193 |
| 427 | 3300037466 | Ga0395898_0268033 | Ga0395898_0268033_859_1440 | 193 |
| 428 | 3300037471 | Ga0395905_0042319 | Ga0395905_0042319_703_1284 | 193 |
| 429 | 3300037471 | Ga0395905_0058304 | Ga0395905_0058304_2898_3479 | 193 |
| 430 | 3300038443 | Ga0395901_0003994 | Ga0395901_0003994_8209_8862 | 193 |
| 431 | 3300038443 | Ga0395901_0009401 | Ga0395901_0009401_2967_3548 | 193 |
| 432 | 3300039437 | Ga0436365_1894240 | Ga0436365_1894240_77_658 | 193 |
| 433 | 3300042007 | Ga0439449_0103545 | Ga0439449_0103545_369_950 | 193 |
| 434 | 3300042876 | Ga0451577_0151015 | Ga0451577_0151015_279_860 | 193 |
| 435 | 3300042876 | Ga0451577_0771116 | Ga0451577_0771116_154_735 | 193 |
| 436 | 3300044712 | Ga0453684_0032353 | Ga0453684_0032353_1042_1623 | 193 |
| 437 | 3300044712 | Ga0453684_0050912 | Ga0453684_0050912_4630_5211 | 193 |
| 438 | 3300044842 | Ga0466957_0001781 | Ga0466957_0001781_1296_1880 | 193 |
| 439 | 3300044842 | Ga0466957_0002689 | Ga0466957_0002689_4154_4735 | 193 |
| 440 | 3300045836 | Ga0466958_0362497 | Ga0466958_0362497_316_906 | 193 |
| 441 | 3300046454 | Ga0495592_0011274 | Ga0495592_0011274_1100_1717 | 193 |
| 442 | 3300046462 | Ga0495651_0239135 | Ga0495651_0239135_192_782 | 193 |
| 443 | 3300046463 | Ga0495653_0042268 | Ga0495653_0042268_1776_2393 | 193 |
| 444 | 3300046511 | Ga0495608_0025634 | Ga0495608_0025634_1979_2596 | 193 |
| 445 | 3300046514 | Ga0495618_0099137 | Ga0495618_0099137_1038_1628 | 193 |
| 446 | 3300046514 | Ga0495618_0100385 | Ga0495618_0100385_800_1417 | 193 |
| 447 | 3300046516 | Ga0495628_0019796 | Ga0495628_0019796_802_1419 | 193 |
| 448 | 3300046517 | Ga0495630_0007562 | Ga0495630_0007562_6076_6693 | 193 |
| 449 | 3300046529 | Ga0495652_0186988 | Ga0495652_0186988_305_922 | 193 |
| 450 | 3300046535 | Ga0495586_0051333 | Ga0495586_0051333_984_1601 | 193 |
| 451 | 3300046536 | Ga0495587_0057095 | Ga0495587_0057095_566_1183 | 193 |
| 452 | 3300046559 | Ga0495667_0197500 | Ga0495667_0197500_173_790 | 193 |
| 453 | 3300046660 | Ga0495625_0000691 | Ga0495625_0000691_8333_8923 | 193 |
| 454 | 3300046689 | Ga0495613_0063552 | Ga0495613_0063552_61_678 | 193 |
| 455 | 3300047471 | Ga0495684_0079011 | Ga0495684_0079011_747_1364 | 193 |
| 456 | 3300048917 | Ga0496114_0446753 | Ga0496114_0446753_80_670 | 193 |
| 457 | 3300049520 | Ga0501297_001068 | Ga0501297_001068_1305_1886 | 193 |
| 458 | 3300049521 | Ga0501298_000346 | Ga0501298_000346_2940_3521 | 193 |
| 459 | 3300049569 | Ga0501032_0184106 | Ga0501032_0184106_321_911 | 193 |
| 460 | 3300049570 | Ga0501033_0279448 | Ga0501033_0279448_263_847 | 193 |
| 461 | 3300049571 | Ga0501034_0111372 | Ga0501034_0111372_1399_1980 | 193 |
| 462 | 3300049571 | Ga0501034_0128350 | Ga0501034_0128350_137_727 | 193 |
| 463 | 3300049586 | Ga0501070_0027986 | Ga0501070_0027986_183_770 | 193 |
| 464 | 3300049649 | Ga0501198_001007 | Ga0501198_001007_736_1317 | 193 |
| 465 | 3300049651 | Ga0501201_000681 | Ga0501201_000681_442_1023 | 193 |
| 466 | 3300049652 | Ga0501202_000315 | Ga0501202_000315_6024_6605 | 193 |
| 467 | 3300049653 | Ga0501206_007700 | Ga0501206_007700_228_809 | 193 |
| 468 | 3300049654 | Ga0501207_003285 | Ga0501207_003285_199_780 | 193 |
| 469 | 3300049661 | Ga0501217_001445 | Ga0501217_001445_1982_2563 | 193 |
| 470 | 3300049662 | Ga0501222_009889 | Ga0501222_009889_497_1078 | 193 |
| 471 | 3300049663 | Ga0501223_000249 | Ga0501223_000249_5308_5889 | 193 |
| 472 | 3300049663 | Ga0501223_000445 | Ga0501223_000445_2904_3485 | 193 |
| 473 | 3300049663 | Ga0501223_055728 | Ga0501223_055728_80_664 | 193 |
| 474 | 3300049665 | Ga0501227_012996 | Ga0501227_012996_720_1304 | 193 |
| 475 | 3300049668 | Ga0501233_003190 | Ga0501233_003190_268_849 | 193 |
| 476 | 3300049686 | Ga0501257_017430 | Ga0501257_017430_664_1248 | 193 |
| 477 | 3300049704 | Ga0501221_000242 | Ga0501221_000242_1506_2087 | 193 |
| 478 | 3300049705 | Ga0501225_0000825 | Ga0501225_0000825_7395_7976 | 193 |
| 479 | 3300049705 | Ga0501225_0024564 | Ga0501225_0024564_17_658 | 193 |
| 480 | 3300049707 | Ga0501234_009583 | Ga0501234_009583_790_1371 | 193 |
| 481 | 3300049758 | Ga0501241_001740 | Ga0501241_001740_1115_1696 | 193 |
| 482 | 3300049763 | Ga0501266_027792 | Ga0501266_027792_27_611 | 193 |
| 483 | 3300049770 | Ga0501273_030021 | Ga0501273_030021_141_725 | 193 |
| 484 | 3300049772 | Ga0501275_013429 | Ga0501275_013429_249_833 | 193 |
| 485 | 3300049773 | Ga0501276_018010 | Ga0501276_018010_20_604 | 193 |
| 486 | 3300049822 | Ga0501035_0033880 | Ga0501035_0033880_227_817 | 193 |
| 487 | 3300049822 | Ga0501035_0414636 | Ga0501035_0414636_448_1029 | 193 |
| 488 | 3300049823 | Ga0501044_0245633 | Ga0501044_0245633_989_1579 | 193 |
| 489 | 3300049823 | Ga0501044_0731405 | Ga0501044_0731405_134_721 | 193 |
| 490 | 3300050493 | nmdc:mga0k408_168_c2 | nmdc:mga0k408_168_c2_9571_10161 | 193 |
| 491 | 3300050511 | nmdc:mga08y16_1338781_c1 | nmdc:mga08y16_1338781_c1_18_599 | 193 |
| 492 | 3300061719 | Ga0466962_0062932 | Ga0466962_0062932_344_928 | 193 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dn7-assembly1.cif.gz_A | cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. | 0.9554 | 1 | 137 |
| 3dn7-assembly1.cif.gz_A | cyclic nucleotide binding regulatory protein from cytophaga hutchinsonii. | 0.8925 | 1 | 137 |
| 3i54-assembly2.cif.gz_C | crystal structure of mtbcrp in complex with camp | 0.8878 | 20 | 192 |
| 5cvr-assembly1.cif.gz_A-2 | crystal structure of fnr of a. fischeri in a partially degraded form | 0.8725 | 28 | 192 |
| 4cyd-assembly2.cif.gz_A | glxr bound to camp | 0.8704 | 8 | 192 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dn7A00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9574 | 3 | 137 | 2.60.120.10 |
| 3dn7A00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8931 | 3 | 137 | 2.60.120.10 |
| af_P9WQK5_226_324_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8882 | 28 | 115 | 2.60.120.10 |
| 5cvrA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8754 | 28 | 147 | 2.60.120.10 |
| 3i54C01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8563 | 20 | 147 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A173MGJ9-F1-model_v4 | cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases | 0.983 | 2 | 192 |
GO:0016301
|
| AF-A0A1I5KK45-F1-model_v4 | cAMP-binding domain of CRP or a regulatory subunit of cAMP-dependent protein kinases | 0.9827 | 2 | 188 |
GO:0016301
|
| AF-A0A0F9NUW1-F1-model_v4 | Cyclic nucleotide-binding domain-containing protein | 0.9821 | 1 | 187 |
|
| AF-A0A318VBC8-F1-model_v4 | deleted | 0.9818 | 15 | 187 |
|
| AF-A0A4U1BWR1-F1-model_v4 | Crp/Fnr family transcriptional regulator | 0.9816 | 1 | 192 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar