F454225

General Info

Members Datasets Scaffolds Average Seq Length
492 268 471 326

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10091484|Ga0070709_100914842
Length 388
Sequence MQRREEARGRPALADESCVPIKRPQTLLQRRKSARPLAAFDMSLGRLQWFAARDKNSKGNPMIWTRRQAMIGISGGLIGVAVPRARAQAAYPSRNIKLLVPYPAGGTTDLLGRLVADQIKSGLNAVVVVENKPGAATTIGAEQVARSEPDGYTIMIATSTTLAINKTLYKKLPYDPVKDFAPISLVAAVPFALIINPGIPAKTLAEFIAYAKANPGLAYGSAGNGSPHHLGAEMLRSAAGIDIRHVPYRGSVPAMLDVIAGHIPFMVVDLQPALQQIKEGKVRVLGVTTSKRVTAAPDIPTIAEGGLPGYELVAWQGIVAPAGTPRAVVDALAGQIAKLLSDPETKARLTTLSLEALPGSTPDSFAAFIKTEVDRWADIVKKSGAELE

Samples

Sample ID Description Type Environment
1 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
2 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
3 2643221569 Achromobacter sp. Root565 Isolate Unclassified
4 2643221594 Achromobacter sp. Root170 Isolate Unclassified
5 2643221621 Achromobacter sp. Root83 Isolate Unclassified
6 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
7 2855730933 Achromobacter sp. HZ28 Isolate Nodule
8 2855767633 Achromobacter sp. HZ34 Isolate Nodule
9 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
10 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
11 2858950400 Achromobacter sp. K91 Isolate Unclassified
12 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
13 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
96 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
238 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
268 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.73
Metatranscriptomes 0
Isolates 4.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 1.02
Rhizoplane 5.28
Rhizosphere 75.81
Stem 0
Stem Tuber 0
Unclassified 10.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000197 3300003187 Bacteria 74387
2 JGI25151J46595_10005497 3300003187 Bacteria 6532
3 JGI25151J46595_10007324 3300003187 Bacteria 5424
4 Ga0055526_1005010 3300003771 Bacteria 7749
5 Ga0055526_1006918 3300003771 Bacteria 6034
6 Ga0055537_1007788 3300003773 Bacteria 2538
7 Ga0055524_1012589 3300003775 Bacteria 3237
8 Ga0055536_1001494 3300003781 Bacteria 14054
9 Ga0055536_1006276 3300003781 Bacteria 5598
10 Ga0055534_1003201 3300003784 Bacteria 5281
11 Ga0055534_1004774 3300003784 Bacteria 3817
12 Ga0065707_10093648 3300005295 Bacteria 3598
13 Ga0070658_10277131 3300005327 Bacteria 1427
14 Ga0070676_10122891 3300005328 Unclassified 1632
15 Ga0070683_100005693 3300005329 Bacteria 10408
16 Ga0070683_100051877 3300005329 Bacteria 3799
17 Ga0070683_100131854 3300005329 Bacteria 2365
18 Ga0070683_100491610 3300005329 Bacteria 1172
19 Ga0070670_100070779 3300005331 Plasmid 2994
20 Ga0070670_100400858 3300005331 Bacteria 1211
21 Ga0070677_10038161 3300005333 Unclassified 1878
22 Ga0070666_10153610 3300005335 Bacteria 1606
23 Ga0070680_100042526 3300005336 Bacteria 3687
24 Ga0070680_100089319 3300005336 Bacteria 2549
25 Ga0070682_100051695 3300005337 Bacteria 2569
26 Ga0068868_100002518 3300005338 Bacteria 12728
27 Ga0068868_100057893 3300005338 Bacteria 3063
28 Ga0070660_100045098 3300005339 Bacteria 3374
29 Ga0070661_100014615 3300005344 Bacteria 5534
30 Ga0070661_100306541 3300005344 Bacteria 1237
31 Ga0070675_100076585 3300005354 Unclassified 2783
32 Ga0070671_100007534 3300005355 Bacteria 8705
33 Ga0070671_100286668 3300005355 Bacteria 1401
34 Ga0070674_100033443 3300005356 Bacteria 3423
35 Ga0070673_100096599 3300005364 Bacteria 2425
36 Ga0070673_100435079 3300005364 Bacteria 1178
37 Ga0070659_100029568 3300005366 Bacteria 4235
38 Ga0070667_100076684 3300005367 Bacteria 2854
39 Ga0070709_10000242 3300005434 Bacteria 35190
40 Ga0070709_10001452 3300005434 Bacteria 12769
41 Ga0070709_10091484 3300005434 Bacteria 2008
42 Ga0070714_100012753 3300005435 Bacteria 6715
43 Ga0070714_100013124 3300005435 Bacteria 6633
44 Ga0070714_100311905 3300005435 Bacteria 1469
45 Ga0070714_100367864 3300005435 Bacteria 1353
46 Ga0070713_100042486 3300005436 Bacteria 3710
47 Ga0070713_100103245 3300005436 Bacteria 2473
48 Ga0070713_100127959 3300005436 Unclassified 2237
49 Ga0070710_10009035 3300005437 Bacteria 4872
50 Ga0070711_100005644 3300005439 Bacteria 7491
51 Ga0070711_100022470 3300005439 Bacteria 4089
52 Ga0070663_100004885 3300005455 Bacteria 7913
53 Ga0070678_100001132 3300005456 Bacteria 14056
54 Ga0070681_10039604 3300005458 Bacteria 4723
55 Ga0070681_10164395 3300005458 Bacteria 2142
56 Ga0070681_10235746 3300005458 Bacteria 1744
57 Ga0068867_100315418 3300005459 Bacteria 1293
58 Ga0070679_100011762 3300005530 Bacteria 8342
59 Ga0070679_100388849 3300005530 Bacteria 1341
60 Ga0070679_100398968 3300005530 Bacteria 1321
61 Ga0070684_100041060 3300005535 Bacteria 3986
62 Ga0070684_100262686 3300005535 Bacteria 1579
63 Ga0068853_100002311 3300005539 Bacteria 14266
64 Ga0070672_100033064 3300005543 Bacteria 3913
65 Ga0070672_100098428 3300005543 Bacteria 2369
66 Ga0070665_100235628 3300005548 Bacteria 1831
67 Ga0068855_100062055 3300005563 Bacteria 4364
68 Ga0068855_100065281 3300005563 Bacteria 4243
69 Ga0068855_100065971 3300005563 Bacteria 4220
70 Ga0070664_100005855 3300005564 Bacteria 9918
71 Ga0070664_100040356 3300005564 Bacteria 3934
72 Ga0070664_100259007 3300005564 Bacteria 1565
73 Ga0070664_100409186 3300005564 Bacteria 1241
74 Ga0068854_100084548 3300005578 Unclassified 2348
75 Ga0068854_100161443 3300005578 Bacteria 1736
76 Ga0068852_100018605 3300005616 Bacteria 5475
77 Ga0068852_100027714 3300005616 Bacteria 4621
78 Ga0068864_100014255 3300005618 Bacteria 6601
79 Ga0068851_10130084 3300005834 Unclassified 1360
80 Ga0068863_100279160 3300005841 Unclassified 1618
81 Ga0068863_100319481 3300005841 Bacteria 1508
82 Ga0081455_10055668 3300005937 Bacteria 3364
83 Ga0081540_1023132 3300005983 Bacteria 3646
84 Ga0081540_1097557 3300005983 Bacteria 1275
85 Ga0070717_10000411 3300006028 Bacteria 27417
86 Ga0070717_10024502 3300006028 Bacteria 4792
87 Ga0070717_10102844 3300006028 Bacteria 2428
88 Ga0070717_10232353 3300006028 Bacteria 1624
89 Ga0075364_10003656 3300006051 Bacteria 8774
90 Ga0075364_10014581 3300006051 Bacteria 4859
91 Ga0070716_100003995 3300006173 Bacteria 7001
92 Ga0070712_100020002 3300006175 Bacteria 4377
93 Ga0070712_100058016 3300006175 Bacteria 2722
94 Ga0075367_10004965 3300006178 Bacteria 6560
95 Ga0075366_10029155 3300006195 Bacteria 3242
96 Ga0097621_100008516 3300006237 Bacteria 7386
97 Ga0097621_100063608 3300006237 Bacteria 3033
98 Ga0097621_100166890 3300006237 Bacteria 1896
99 Ga0097621_100266873 3300006237 Bacteria 1503
100 Ga0075370_10013842 3300006353 Bacteria 4292
101 Ga0068871_100035589 3300006358 Bacteria 3958
102 Ga0068871_100038538 3300006358 Unclassified 3818
103 Ga0075428_100000280 3300006844 Bacteria 50009
104 Ga0075428_100000448 3300006844 Bacteria 41130
105 Ga0075428_100000787 3300006844 Bacteria 33063
106 Ga0075429_100010798 3300006880 Bacteria 7898
107 Ga0075429_100029183 3300006880 Bacteria 4791
108 Ga0075429_100035808 3300006880 Bacteria 4317
109 Ga0075436_100301138 3300006914 Bacteria 1149
110 Ga0075435_100220363 3300007076 Bacteria 1611
111 Ga0099794_10027334 3300007265 Bacteria 2644
112 Ga0105244_10051068 3300009036 Bacteria 2108
113 Ga0105240_10014220 3300009093 Bacteria 10871
114 Ga0105240_10032568 3300009093 Bacteria 6749
115 Ga0105240_10253977 3300009093 Bacteria 2031
116 Ga0111539_10023514 3300009094 Bacteria 7572
117 Ga0111539_10033296 3300009094 Bacteria 6257
118 Ga0111539_10072340 3300009094 Bacteria 4066
119 Ga0105245_10015489 3300009098 Bacteria 6648
120 Ga0105245_10217999 3300009098 Bacteria 1840
121 Ga0114129_10265061 3300009147 Unclassified 2301
122 Ga0105248_10034860 3300009177 Bacteria 5632
123 Ga0105237_10014622 3300009545 Bacteria 8199
124 Ga0105237_10015939 3300009545 Bacteria 7813
125 Ga0105237_10039885 3300009545 Bacteria 4738
126 Ga0105238_10052003 3300009551 Bacteria 4118
127 Ga0105239_10045793 3300010375 Bacteria 4793
128 Ga0105239_10051052 3300010375 Bacteria 4534
129 Ga0105246_10081804 3300011119 Bacteria 2303
130 Ga0157370_10096080 3300013104 Bacteria 2780
131 Ga0157370_10122499 3300013104 Bacteria 2428
132 Ga0157369_10039389 3300013105 Bacteria 5165
133 Ga0157374_10016728 3300013296 Bacteria 6453
134 Ga0157374_10033571 3300013296 Bacteria 4682
135 Ga0157374_10055492 3300013296 Bacteria 3697
136 Ga0157378_10033271 3300013297 Bacteria 4556
137 Ga0157378_10217173 3300013297 Bacteria 1816
138 Ga0163162_10014739 3300013306 Bacteria 7639
139 Ga0163162_10015981 3300013306 Bacteria 7336
140 Ga0163162_10088826 3300013306 Bacteria 3170
141 Ga0157375_10011582 3300013308 Bacteria 7791
142 Ga0157375_10020469 3300013308 Bacteria 6045
143 Ga0157375_10168788 3300013308 Bacteria 2335
144 Ga0157375_10492260 3300013308 Bacteria 1391
145 Ga0163163_10009587 3300014325 Bacteria 8653
146 Ga0157376_10007063 3300014969 Bacteria 7971
147 Ga0157376_10018358 3300014969 Bacteria 5361
148 Ga0213873_10025110 3300021358 Bacteria 1435
149 Ga0213872_10038932 3300021361 Bacteria 2170
150 Ga0213872_10045749 3300021361 Bacteria 1992
151 Ga0213871_10001199 3300021441 Bacteria 4184
152 Ga0209565_1000217 3300025263 Bacteria 65539
153 Ga0209675_1000479 3300025291 Bacteria 30333
154 Ga0209675_1013780 3300025291 Bacteria 2504
155 Ga0209676_1000066 3300025292 Bacteria 317897
156 Ga0209676_1012614 3300025292 Bacteria 3303
157 Ga0209025_1000003 3300025294 Bacteria 1366495
158 Ga0209025_1001052 3300025294 Bacteria 40294
159 Ga0209025_1002731 3300025294 Bacteria 17877
160 Ga0209564_1001346 3300025295 Bacteria 26078
161 Ga0209050_1000827 3300025298 Bacteria 42937
162 Ga0209050_1001957 3300025298 Bacteria 19493
163 Ga0209256_1001626 3300025299 Bacteria 21896
164 Ga0207682_10067567 3300025893 Unclassified 1509
165 Ga0207692_10000769 3300025898 Bacteria 11391
166 Ga0207692_10039366 3300025898 Bacteria 2325
167 Ga0207710_10142805 3300025900 Bacteria 1157
168 Ga0207699_10001448 3300025906 Bacteria 11271
169 Ga0207699_10073068 3300025906 Bacteria 2102
170 Ga0207643_10100664 3300025908 Bacteria 1695
171 Ga0207705_10221357 3300025909 Bacteria 1438
172 Ga0207707_10008799 3300025912 Bacteria 8761
173 Ga0207707_10052347 3300025912 Bacteria 3555
174 Ga0207707_10195942 3300025912 Bacteria 1762
175 Ga0207695_10063797 3300025913 Bacteria 3796
176 Ga0207695_10093442 3300025913 Bacteria 3017
177 Ga0207693_10095827 3300025915 Bacteria 2326
178 Ga0207663_10011059 3300025916 Bacteria 4830
179 Ga0207663_10190295 3300025916 Bacteria 1473
180 Ga0207660_10014318 3300025917 Bacteria 5213
181 Ga0207660_10071757 3300025917 Bacteria 2520
182 Ga0207657_10014847 3300025919 Bacteria 7581
183 Ga0207649_10016683 3300025920 Bacteria 4149
184 Ga0207649_10227252 3300025920 Bacteria 1333
185 Ga0207652_10104069 3300025921 Bacteria 2510
186 Ga0207694_10097937 3300025924 Bacteria 2321
187 Ga0207650_10014268 3300025925 Bacteria 5520
188 Ga0207650_10291250 3300025925 Bacteria 1331
189 Ga0207700_10002105 3300025928 Bacteria 11366
190 Ga0207700_10025546 3300025928 Bacteria 4104
191 Ga0207700_10204728 3300025928 Bacteria 1665
192 Ga0207664_10004305 3300025929 Bacteria 9635
193 Ga0207664_10007374 3300025929 Bacteria 7623
194 Ga0207664_10408996 3300025929 Bacteria 1207
195 Ga0207644_10017980 3300025931 Bacteria 4780
196 Ga0207644_10041157 3300025931 Bacteria 3267
197 Ga0207644_10368224 3300025931 Bacteria 1170
198 Ga0207690_10018398 3300025932 Bacteria 4285
199 Ga0207706_10253711 3300025933 Unclassified 1536
200 Ga0207665_10003894 3300025939 Bacteria 9984
201 Ga0207691_10013453 3300025940 Bacteria 7831
202 Ga0207691_10024139 3300025940 Bacteria 5718
203 Ga0207691_10173948 3300025940 Bacteria 1884
204 Ga0207661_10008921 3300025944 Bacteria 7181
205 Ga0207661_10043226 3300025944 Bacteria 3555
206 Ga0207661_10271286 3300025944 Bacteria 1514
207 Ga0207661_10318740 3300025944 Bacteria 1397
208 Ga0207679_10114879 3300025945 Bacteria 2132
209 Ga0207679_10368286 3300025945 Bacteria 1257
210 Ga0207667_10127530 3300025949 Bacteria 2621
211 Ga0207667_10266329 3300025949 Bacteria 1752
212 Ga0207651_10103549 3300025960 Bacteria 2118
213 Ga0207640_10010704 3300025981 Bacteria 5175
214 Ga0207677_10288554 3300026023 Bacteria 1350
215 Ga0207678_10037307 3300026067 Bacteria 4227
216 Ga0207648_10048928 3300026089 Bacteria 3701
217 Ga0207648_10129875 3300026089 Bacteria 2218
218 Ga0207676_10008480 3300026095 Bacteria 7308
219 Ga0207683_10003934 3300026121 Bacteria 12888
220 Ga0207683_10004495 3300026121 Bacteria 12034
221 Ga0207698_10004216 3300026142 Bacteria 8743
222 Ga0207698_10093208 3300026142 Bacteria 2472
223 Ga0207698_10135810 3300026142 Bacteria 2110
224 Ga0209179_1001231 3300027512 Bacteria 3055
225 Ga0268266_10130057 3300028379 Bacteria 2251
226 Ga0307515_10009804 3300028794 Bacteria 18452
227 Ga0307515_10025690 3300028794 Bacteria 10178
228 Ga0265339_10046527 3300031249 Bacteria 2385
229 Ga0307513_10032426 3300031456 Bacteria 5891
230 Ga0307513_10071006 3300031456 Bacteria 3636
231 Ga0307508_10091438 3300031616 Bacteria 2631
232 Ga0307516_10000859 3300031730 Bacteria 41636
233 Ga0307516_10006663 3300031730 Bacteria 13500
234 Ga0307516_10086012 3300031730 Bacteria 2981
235 Ga0307412_10005148 3300031911 Bacteria 7323
236 Ga0307412_10079961 3300031911 Bacteria 2257
237 Ga0373926_0027717 3300035083 Bacteria 1986
238 Ga0373934_0010265 3300035086 Bacteria 3515
239 Ga0373944_0007426 3300035089 Bacteria 2939
240 Ga0373923_0012682 3300035111 Bacteria 3123
241 Ga0373923_0049056 3300035111 Bacteria 1765
242 Ga0373936_0004502 3300035113 Bacteria 5274
243 Ga0373936_0023307 3300035113 Bacteria 2412
244 Ga0373936_0051552 3300035113 Bacteria 1665
245 Ga0373945_0003644 3300035116 Bacteria 4855
246 Ga0373945_0052297 3300035116 Bacteria 1504
247 Ga0373953_0001480 3300035117 Bacteria 6816
248 Ga0373953_0003249 3300035117 Bacteria 5036
249 Ga0373954_0010708 3300035118 Bacteria 4053
250 Ga0373956_0001180 3300035119 Bacteria 10798
251 Ga0373956_0004561 3300035119 Bacteria 5529
252 Ga0373957_0000718 3300035120 Bacteria 8591
253 Ga0373943_0000069 3300035170 Bacteria 36572
254 Ga0373943_0010274 3300035170 Bacteria 4199
255 Ga0373943_0034299 3300035170 Bacteria 2421
256 Ga0373946_0007622 3300035171 Bacteria 3963
257 Ga0373946_0020228 3300035171 Bacteria 2571
258 Ga0373946_0029125 3300035171 Bacteria 2195
259 Ga0373955_0009765 3300035172 Bacteria 4508
260 Ga0373924_0018171 3300035410 Bacteria 2707
261 Ga0373924_0108368 3300035410 Bacteria 1199
262 Ga0373935_0000424 3300035692 Bacteria 22007
263 Ga0373935_0008729 3300035692 Bacteria 6071
264 Ga0373935_0012841 3300035692 Bacteria 5044
265 Ga0373927_0001241 3300035695 Bacteria 19353
266 Ga0373927_0001268 3300035695 Bacteria 19116
267 Ga0373927_0031103 3300035695 Bacteria 3481
268 Ga0373927_0031122 3300035695 Bacteria 3480
269 Ga0373927_0038759 3300035695 Bacteria 3093
270 Ga0373933_0004106 3300035724 Bacteria 8024
271 Ga0373933_0009290 3300035724 Bacteria 5369
272 Ga0373947_0001389 3300035725 Bacteria 14918
273 Ga0373947_0001572 3300035725 Bacteria 13996
274 Ga0373937_0037785 3300036401 Bacteria 4400
275 Ga0373937_0543228 3300036401 Unclassified 1104
276 Ga0373925_0000676 3300037068 Bacteria 32014
277 Ga0373925_0003644 3300037068 Bacteria 11873
278 Ga0373925_0093999 3300037068 Bacteria 2295
279 Ga0395898_0369725 3300037466 Bacteria 1367
280 Ga0395905_0004609 3300037471 Bacteria 14265
281 Ga0395901_0480101 3300038443 Bacteria 1268
282 Ga0436365_0981168 3300039437 Bacteria 1180
283 Ga0436365_1651590 3300039437 Bacteria 10441
284 Ga0436361_0722496 3300039447 Bacteria 2476
285 Ga0436361_0906288 3300039447 Bacteria 2714
286 Ga0436363_0219890 3300039450 Bacteria 1128
287 Ga0436362_0360566 3300039453 Bacteria 3772
288 Ga0439436_0025176 3300041404 Bacteria 1750
289 Ga0451853_4111325 3300041512 Bacteria 2864
290 Ga0495592_0018211 3300046454 Bacteria 5337
291 Ga0495592_0049096 3300046454 Bacteria 3138
292 Ga0495592_0116138 3300046454 Bacteria 1889
293 Ga0495603_0000003 3300046455 Bacteria 83533
294 Ga0495629_0000133 3300046459 Bacteria 64806
295 Ga0495629_0006180 3300046459 Bacteria 8892
296 Ga0495641_0002965 3300046461 Bacteria 13048
297 Ga0495651_0023870 3300046462 Bacteria 4755
298 Ga0495651_0096699 3300046462 Bacteria 2206
299 Ga0495653_0006099 3300046463 Bacteria 9878
300 Ga0495653_0022230 3300046463 Bacteria 5134
301 Ga0495653_0030975 3300046463 Bacteria 4255
302 Ga0495580_0003578 3300046472 Bacteria 13198
303 Ga0495582_0000016 3300046473 Bacteria 100714
304 Ga0495582_0049958 3300046473 Bacteria 2304
305 Ga0495639_0000014 3300046475 Bacteria 82866
306 Ga0495662_0010313 3300046476 Bacteria 4578
307 Ga0495664_0000262 3300046477 Bacteria 25289
308 Ga0495664_0008449 3300046477 Bacteria 5745
309 Ga0495664_0195216 3300046477 Bacteria 1227
310 Ga0495594_0001356 3300046499 Bacteria 12713
311 Ga0495606_0176777 3300046507 Bacteria 1234
312 Ga0495608_0006739 3300046511 Bacteria 8145
313 Ga0495618_0000259 3300046514 Bacteria 38359
314 Ga0495618_0026473 3300046514 Bacteria 3606
315 Ga0495618_0049099 3300046514 Bacteria 2665
316 Ga0495628_0010243 3300046516 Bacteria 7976
317 Ga0495630_0001016 3300046517 Bacteria 19452
318 Ga0495630_0001968 3300046517 Bacteria 14299
319 Ga0495630_0004644 3300046517 Bacteria 9638
320 Ga0495630_0039735 3300046517 Bacteria 3517
321 Ga0495666_0027560 3300046526 Bacteria 2796
322 Ga0495652_0011764 3300046529 Bacteria 7906
323 Ga0495652_0282752 3300046529 Bacteria 1214
324 Ga0495665_0000270 3300046531 Bacteria 26319
325 Ga0495665_0012883 3300046531 Bacteria 4526
326 Ga0495665_0027582 3300046531 Bacteria 3048
327 Ga0495640_0003390 3300046533 Bacteria 12825
328 Ga0495640_0005661 3300046533 Bacteria 9938
329 Ga0495640_0039997 3300046533 Bacteria 3286
330 Ga0495640_0041988 3300046533 Bacteria 3193
331 Ga0495586_0029891 3300046535 Bacteria 2916
332 Ga0495586_0054928 3300046535 Bacteria 2159
333 Ga0495645_0003743 3300046543 Bacteria 10335
334 Ga0495622_0003887 3300046557 Bacteria 6978
335 Ga0495667_0002585 3300046559 Bacteria 12090
336 Ga0495667_0009372 3300046559 Bacteria 6629
337 Ga0495656_0092352 3300046615 Bacteria 1386
338 Ga0495634_0000064 3300046642 Bacteria 85710
339 Ga0495634_0009185 3300046642 Bacteria 7300
340 Ga0495634_0038403 3300046642 Bacteria 3265
341 Ga0495634_0132260 3300046642 Bacteria 1589
342 Ga0495634_0187623 3300046642 Bacteria 1291
343 Ga0495635_0000280 3300046663 Bacteria 32788
344 Ga0495635_0001480 3300046663 Bacteria 15709
345 Ga0495635_0010498 3300046663 Bacteria 6481
346 Ga0495635_0134493 3300046663 Bacteria 1685
347 Ga0495657_0051155 3300046675 Bacteria 2774
348 Ga0495657_0055560 3300046675 Bacteria 2640
349 Ga0495599_0010366 3300046678 Bacteria 5700
350 Ga0495623_0012337 3300046679 Bacteria 5533
351 Ga0495646_0033854 3300046680 Bacteria 3176
352 Ga0495647_0001881 3300046681 Bacteria 6532
353 Ga0495647_0164241 3300046681 Unclassified 958
354 Ga0495613_0011986 3300046689 Bacteria 6443
355 Ga0495613_0021361 3300046689 Bacteria 4826
356 Ga0495613_0021810 3300046689 Bacteria 4774
357 Ga0495613_0061590 3300046689 Bacteria 2747
358 Ga0495613_0074613 3300046689 Bacteria 2470
359 Ga0495624_0000201 3300046690 Bacteria 45984
360 Ga0495624_0005340 3300046690 Bacteria 9274
361 Ga0495624_0115965 3300046690 Unclassified 1646
362 Ga0495670_0119799 3300046691 Bacteria 1367
363 Ga0495600_0002212 3300046809 Bacteria 11057
364 Ga0495600_0003588 3300046809 Bacteria 9139
365 Ga0495581_0000014 3300047315 Bacteria 60735
366 Ga0495581_0014851 3300047315 Bacteria 4517
367 Ga0495581_0018561 3300047315 Plasmid 4039
368 Ga0495581_0033363 3300047315 Bacteria 2981
369 Ga0495604_0029545 3300047317 Bacteria 4360
370 Ga0495674_0001491 3300047319 Bacteria 22945
371 Ga0495674_0018561 3300047319 Bacteria 6474
372 Ga0495674_0026694 3300047319 Bacteria 5282
373 Ga0495676_0011593 3300047321 Bacteria 7953
374 Ga0495676_0078744 3300047321 Bacteria 2508
375 Ga0495676_0213183 3300047321 Bacteria 1335
376 Ga0495680_0003924 3300047322 Bacteria 14386
377 Ga0495675_0019169 3300047444 Bacteria 4346
378 Ga0495684_0002799 3300047471 Bacteria 13757
379 Ga0495684_0003348 3300047471 Bacteria 12584
380 Ga0495684_0016277 3300047471 Bacteria 5725
381 Ga0495684_0016289 3300047471 Bacteria 5723
382 Ga0495684_0029151 3300047471 Bacteria 4236
383 Ga0495593_0000003 3300047673 Bacteria 120744
384 Ga0495593_0012203 3300047673 Bacteria 4913
385 Ga0495602_0070010 3300048088 Bacteria 3004
386 Ga0495614_0038624 3300048089 Bacteria 2049
387 Ga0496100_0001339 3300048903 Bacteria 12053
388 Ga0496101_0005846 3300048904 Bacteria 7870
389 Ga0496102_0011304 3300048905 Bacteria 7690
390 Ga0496103_0035181 3300048906 Bacteria 3066
391 Ga0496104_0069401 3300048907 Bacteria 3350
392 Ga0496105_0021644 3300048908 Bacteria 5203
393 Ga0496106_0010254 3300048909 Bacteria 6927
394 Ga0496106_0069199 3300048909 Bacteria 2694
395 Ga0496107_0090163 3300048910 Bacteria 2239
396 Ga0496108_0029875 3300048911 Bacteria 4516
397 Ga0496109_0010899 3300048912 Bacteria 7785
398 Ga0496109_0082886 3300048912 Unclassified 2957
399 Ga0496109_0293036 3300048912 Bacteria 1534
400 Ga0496110_0010993 3300048913 Bacteria 7386
401 Ga0496110_0215857 3300048913 Bacteria 1744
402 Ga0496111_0277491 3300048914 Bacteria 1243
403 Ga0496112_0016913 3300048915 Bacteria 6843
404 Ga0496112_0147729 3300048915 Bacteria 2319
405 Ga0496113_0110309 3300048916 Bacteria 2141
406 Ga0496113_0454190 3300048916 Unclassified 1030
407 Ga0496114_0012537 3300048917 Bacteria 6789
408 Ga0496114_0171134 3300048917 Bacteria 1893
409 Ga0496114_0321989 3300048917 Unclassified 1366
410 Ga0496115_0066448 3300048918 Bacteria 2914
411 Ga0496116_0000485 3300048919 Bacteria 54705
412 Ga0496116_0005759 3300048919 Bacteria 11395
413 Ga0496116_0040899 3300048919 Bacteria 3186
414 Ga0496117_0055218 3300048920 Bacteria 2777
415 Ga0496118_0008083 3300048921 Bacteria 10968
416 Ga0496118_0127945 3300048921 Bacteria 1637
417 Ga0496119_0008344 3300048922 Bacteria 9131
418 Ga0496121_0000041 3300048924 Bacteria 346686
419 Ga0496121_0000847 3300048924 Bacteria 55469
420 Ga0496121_0066820 3300048924 Bacteria 2917
421 Ga0496121_0138701 3300048924 Bacteria 1807
422 Ga0496122_0000017 3300048925 Bacteria 439553
423 Ga0496122_0000102 3300048925 Bacteria 197296
424 Ga0496122_0097221 3300048925 Bacteria 1982
425 Ga0496123_0000033 3300048926 Bacteria 274961
426 Ga0496123_0000742 3300048926 Bacteria 52830
427 Ga0496123_0082445 3300048926 Bacteria 1949
428 Ga0496124_0000103 3300048927 Bacteria 179162
429 Ga0496124_0000945 3300048927 Bacteria 46493
430 Ga0496124_0040428 3300048927 Bacteria 4032
431 Ga0496124_0177323 3300048927 Bacteria 1643
432 Ga0496125_0000005 3300048928 Bacteria 827598
433 Ga0496125_0014375 3300048928 Bacteria 7713
434 Ga0496125_0036584 3300048928 Bacteria 4282
435 Ga0496126_0015499 3300048929 Bacteria 7665
436 Ga0496126_0028923 3300048929 Bacteria 5270
437 Ga0496126_0323769 3300048929 Bacteria 1266
438 Ga0501047_0000950 3300049581 Bacteria 29378
439 Ga0501047_0010702 3300049581 Bacteria 8669
440 Ga0501067_0016353 3300049583 Bacteria 4100
441 Ga0501070_0010185 3300049586 Bacteria 7956
442 Ga0501073_0108584 3300049589 Bacteria 1925
443 Ga0501080_0100919 3300049742 Bacteria 2677
444 Ga0501035_0004018 3300049822 Bacteria 14031
445 Ga0501035_0289122 3300049822 Bacteria 1384
446 Ga0501035_0351635 3300049822 Bacteria 1233
447 Ga0501044_0000961 3300049823 Bacteria 34651
448 Ga0501044_0002477 3300049823 Bacteria 21066
449 Ga0501044_0016699 3300049823 Bacteria 7880
450 nmdc:mga00v17_141_c1 3300050491 Bacteria 41598
451 nmdc:mga00v17_221528_c1 3300050491 Bacteria 1225
452 nmdc:mga07m45_64607_c1 3300050496 Bacteria 2077
453 nmdc:mga09592_20547_c1 3300050508 Bacteria 5432
454 nmdc:mga09592_24746_c1 3300050508 Bacteria 4964
455 nmdc:mga08y16_17240_c1 3300050511 Bacteria 7603
456 nmdc:mga08y16_239150_c1 3300050511 Bacteria 1877
457 nmdc:mga08x19_131122_c1 3300050514 Bacteria 1686
458 Ga0495601_0004025 3300053077 Bacteria 8464
459 Ga0495612_0112373 3300053078 Bacteria 1167
460 Ga0495655_0004534 3300053083 Bacteria 2382
461 Ga0495595_0004367 3300053084 Bacteria 5691
462 Ga0495595_0046776 3300053084 Bacteria 1994
463 Ga0495595_0140603 3300053084 Bacteria 1184
464 Ga0495619_0002442 3300053085 Bacteria 12180
465 Ga0495619_0005906 3300053085 Bacteria 7758
466 Ga0495619_0073636 3300053085 Bacteria 2289
467 Ga0500651_0012975 3300053093 Bacteria 5062
468 Ga0500554_004508 3300053102 Bacteria 2958
469 Ga0500595_000898 3300053119 Bacteria 16951
470 Ga0500627_0030240 3300053158 Bacteria 2266
471 Ga0500638_002706 3300053162 Bacteria 6293

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046681 Ga0495647_0164241 Ga0495647_0164241_13_900 278
2 3300053078 Ga0495612_0112373 Ga0495612_0112373_225_1112 278
3 3300009177 Ga0105248_10034860 Ga0105248_100348603 282
4 3300046473 Ga0495582_0049958 Ga0495582_0049958_693_1823 284
5 3300047315 Ga0495581_0033363 Ga0495581_0033363_1621_2751 284
6 3300048929 Ga0496126_0323769 Ga0496126_0323769_344_1222 288
7 3300005331 Ga0070670_100070779 Ga0070670_1000707791 295
8 3300005333 Ga0070677_10038161 Ga0070677_100381613 295
9 3300005338 Ga0068868_100002518 Ga0068868_10000251812 295
10 3300005354 Ga0070675_100076585 Ga0070675_1000765851 295
11 3300005355 Ga0070671_100007534 Ga0070671_1000075346 295
12 3300005456 Ga0070678_100001132 Ga0070678_1000011325 295
13 3300005535 Ga0070684_100041060 Ga0070684_1000410603 295
14 3300005543 Ga0070672_100033064 Ga0070672_1000330643 295
15 3300005578 Ga0068854_100084548 Ga0068854_1000845483 295
16 3300005618 Ga0068864_100014255 Ga0068864_1000142555 295
17 3300005841 Ga0068863_100279160 Ga0068863_1002791602 295
18 3300006358 Ga0068871_100038538 Ga0068871_1000385384 295
19 3300013296 Ga0157374_10033571 Ga0157374_100335713 295
20 3300013306 Ga0163162_10015981 Ga0163162_100159815 295
21 3300013308 Ga0157375_10011582 Ga0157375_100115826 295
22 3300025893 Ga0207682_10067567 Ga0207682_100675671 295
23 3300025925 Ga0207650_10014268 Ga0207650_100142684 295
24 3300025931 Ga0207644_10017980 Ga0207644_100179803 295
25 3300026089 Ga0207648_10048928 Ga0207648_100489283 295
26 3300026095 Ga0207676_10008480 Ga0207676_100084805 295
27 3300026121 Ga0207683_10004495 Ga0207683_100044957 295
28 3300026142 Ga0207698_10004216 Ga0207698_100042163 295
29 3300048907 Ga0496104_0069401 Ga0496104_0069401_1008_1919 295
30 3300048911 Ga0496108_0029875 Ga0496108_0029875_966_1877 295
31 3300048912 Ga0496109_0082886 Ga0496109_0082886_576_1487 295
32 3300048913 Ga0496110_0010993 Ga0496110_0010993_2696_3607 295
33 3300048916 Ga0496113_0454190 Ga0496113_0454190_76_987 295
34 3300048917 Ga0496114_0321989 Ga0496114_0321989_258_1169 295
35 3300048929 Ga0496126_0015499 Ga0496126_0015499_6716_7642 297
36 3300025933 Ga0207706_10253711 Ga0207706_102537112 298
37 3300053085 Ga0495619_0073636 Ga0495619_0073636_954_2069 299
38 3300049823 Ga0501044_0000961 Ga0501044_0000961_12632_13846 300
39 3300025924 Ga0207694_10097937 Ga0207694_100979372 301
40 3300025944 Ga0207661_10318740 Ga0207661_103187402 301
41 3300026142 Ga0207698_10135810 Ga0207698_101358103 301
42 3300048924 Ga0496121_0138701 Ga0496121_0138701_17_940 302
43 3300035111 Ga0373923_0049056 Ga0373923_0049056_22_948 303
44 3300053102 Ga0500554_004508 Ga0500554_004508_540_1592 303
45 3300053119 Ga0500595_000898 Ga0500595_000898_14044_15096 303
46 3300053162 Ga0500638_002706 Ga0500638_002706_3625_4677 303
47 3300005435 Ga0070714_100012753 Ga0070714_1000127535 304
48 3300035089 Ga0373944_0007426 Ga0373944_0007426_101_1087 305
49 3300035116 Ga0373945_0003644 Ga0373945_0003644_2575_3561 305
50 3300035171 Ga0373946_0020228 Ga0373946_0020228_475_1461 305
51 3300046642 Ga0495634_0187623 Ga0495634_0187623_95_1081 305
52 3300046663 Ga0495635_0134493 Ga0495635_0134493_547_1533 305
53 3300046689 Ga0495613_0011986 Ga0495613_0011986_4949_5935 305
54 3300047321 Ga0495676_0078744 Ga0495676_0078744_109_1095 305
55 3300031730 Ga0307516_10006663 Ga0307516_1000666312 306
56 3300005327 Ga0070658_10277131 Ga0070658_102771311 307
57 3300005329 Ga0070683_100131854 Ga0070683_1001318542 307
58 3300005339 Ga0070660_100045098 Ga0070660_1000450983 307
59 3300005458 Ga0070681_10164395 Ga0070681_101643952 307
60 3300005530 Ga0070679_100398968 Ga0070679_1003989682 307
61 3300005535 Ga0070684_100262686 Ga0070684_1002626861 307
62 3300005539 Ga0068853_100002311 Ga0068853_10000231112 307
63 3300005616 Ga0068852_100018605 Ga0068852_1000186052 307
64 3300009093 Ga0105240_10014220 Ga0105240_100142205 307
65 3300009545 Ga0105237_10039885 Ga0105237_100398852 307
66 3300010375 Ga0105239_10045793 Ga0105239_100457935 307
67 3300025909 Ga0207705_10221357 Ga0207705_102213571 307
68 3300025912 Ga0207707_10008799 Ga0207707_100087991 307
69 3300025913 Ga0207695_10093442 Ga0207695_100934422 307
70 3300025919 Ga0207657_10014847 Ga0207657_1001484710 307
71 3300025944 Ga0207661_10008921 Ga0207661_1000892110 307
72 3300025949 Ga0207667_10266329 Ga0207667_102663291 307
73 3300035113 Ga0373936_0004502 Ga0373936_0004502_3467_4528 307
74 3300035113 Ga0373936_0051552 Ga0373936_0051552_344_1312 307
75 3300035692 Ga0373935_0012841 Ga0373935_0012841_1848_2816 307
76 3300035695 Ga0373927_0031122 Ga0373927_0031122_1124_2092 307
77 3300037068 Ga0373925_0093999 Ga0373925_0093999_71_1039 307
78 3300041404 Ga0439436_0025176 Ga0439436_0025176_236_1210 307
79 3300035410 Ga0373924_0108368 Ga0373924_0108368_102_1088 309
80 3300037471 Ga0395905_0004609 Ga0395905_0004609_5369_6355 309
81 3300049583 Ga0501067_0016353 Ga0501067_0016353_271_1293 309
82 3300049822 Ga0501035_0351635 Ga0501035_0351635_264_1217 309
83 3300009094 Ga0111539_10023514 Ga0111539_100235145 310
84 3300009147 Ga0114129_10265061 Ga0114129_102650613 310
85 3300046615 Ga0495656_0092352 Ga0495656_0092352_337_1284 310
86 3300050508 nmdc:mga09592_24746_c1 nmdc:mga09592_24746_c1_3158_4105 310
87 3300050511 nmdc:mga08y16_17240_c1 nmdc:mga08y16_17240_c1_1137_2084 310
88 iso_pu_bacteria 2855730933 2855734128 310
89 iso_pu_bacteria 2855767633 2855769718 310
90 3300005295 Ga0065707_10093648 Ga0065707_100936482 311
91 3300005336 Ga0070680_100089319 Ga0070680_1000893192 311
92 3300005366 Ga0070659_100029568 Ga0070659_1000295683 311
93 3300005435 Ga0070714_100367864 Ga0070714_1003678642 311
94 3300005530 Ga0070679_100388849 Ga0070679_1003888491 311
95 3300005563 Ga0068855_100065281 Ga0068855_1000652812 311
96 3300005564 Ga0070664_100409186 Ga0070664_1004091862 311
97 3300005616 Ga0068852_100027714 Ga0068852_1000277142 311
98 3300006914 Ga0075436_100301138 Ga0075436_1003011381 311
99 3300009093 Ga0105240_10032568 Ga0105240_100325685 311
100 3300025913 Ga0207695_10063797 Ga0207695_100637972 311
101 3300025929 Ga0207664_10408996 Ga0207664_104089962 311
102 3300025932 Ga0207690_10018398 Ga0207690_100183983 311
103 3300025945 Ga0207679_10368286 Ga0207679_103682862 311
104 3300026142 Ga0207698_10093208 Ga0207698_100932082 311
105 3300038443 Ga0395901_0480101 Ga0395901_0480101_288_1247 311
106 3300046514 Ga0495618_0049099 Ga0495618_0049099_244_1224 311
107 3300046531 Ga0495665_0012883 Ga0495665_0012883_1137_2117 311
108 3300046642 Ga0495634_0038403 Ga0495634_0038403_436_1416 311
109 3300047315 Ga0495581_0018561 Ga0495581_0018561_2889_3869 311
110 3300047471 Ga0495684_0029151 Ga0495684_0029151_1196_2176 311
111 3300048915 Ga0496112_0147729 Ga0496112_0147729_479_1438 311
112 3300048916 Ga0496113_0110309 Ga0496113_0110309_434_1393 311
113 3300048919 Ga0496116_0000485 Ga0496116_0000485_29368_30372 311
114 3300050511 nmdc:mga08y16_239150_c1 nmdc:mga08y16_239150_c1_245_1204 311
115 3300050514 nmdc:mga08x19_131122_c1 nmdc:mga08x19_131122_c1_103_1062 311
116 3300053084 Ga0495595_0140603 Ga0495595_0140603_26_1006 311
117 3300005436 Ga0070713_100127959 Ga0070713_1001279592 312
118 3300009036 Ga0105244_10051068 Ga0105244_100510682 312
119 3300013297 Ga0157378_10033271 Ga0157378_100332714 312
120 3300025944 Ga0207661_10271286 Ga0207661_102712862 312
121 3300027512 Ga0209179_1001231 Ga0209179_10012312 312
122 3300048925 Ga0496122_0000102 Ga0496122_0000102_50011_51000 312
123 3300048926 Ga0496123_0000742 Ga0496123_0000742_50011_51000 312
124 3300048928 Ga0496125_0014375 Ga0496125_0014375_46_1035 312
125 3300005335 Ga0070666_10153610 Ga0070666_101536102 313
126 3300005364 Ga0070673_100435079 Ga0070673_1004350791 313
127 3300005459 Ga0068867_100315418 Ga0068867_1003154181 313
128 3300005564 Ga0070664_100259007 Ga0070664_1002590072 313
129 3300007076 Ga0075435_100220363 Ga0075435_1002203632 313
130 3300025920 Ga0207649_10227252 Ga0207649_102272522 313
131 3300025931 Ga0207644_10368224 Ga0207644_103682241 313
132 3300026089 Ga0207648_10129875 Ga0207648_101298752 313
133 3300028794 Ga0307515_10025690 Ga0307515_1002569013 313
134 3300035113 Ga0373936_0023307 Ga0373936_0023307_715_1680 313
135 3300046462 Ga0495651_0096699 Ga0495651_0096699_1159_2124 313
136 3300046477 Ga0495664_0195216 Ga0495664_0195216_190_1155 313
137 3300046514 Ga0495618_0026473 Ga0495618_0026473_849_1814 313
138 3300046526 Ga0495666_0027560 Ga0495666_0027560_532_1497 313
139 3300046529 Ga0495652_0282752 Ga0495652_0282752_207_1172 313
140 3300046675 Ga0495657_0055560 Ga0495657_0055560_1575_2540 313
141 3300046689 Ga0495613_0074613 Ga0495613_0074613_1295_2260 313
142 3300047317 Ga0495604_0029545 Ga0495604_0029545_2407_3372 313
143 3300053084 Ga0495595_0046776 Ga0495595_0046776_329_1294 313
144 iso_pu_bacteria 2599185292 2599905366 313
145 iso_pu_bacteria 2643221569 2643858871 313
146 iso_pu_bacteria 2643221594 2643981964 313
147 iso_pu_bacteria 2643221621 2644122735 313
148 iso_pu_bacteria 2808606395 2809034067 313
149 3300005331 Ga0070670_100400858 Ga0070670_1004008581 314
150 3300006195 Ga0075366_10029155 Ga0075366_100291552 314
151 3300006844 Ga0075428_100000280 Ga0075428_10000028019 314
152 3300006844 Ga0075428_100000448 Ga0075428_10000044815 314
153 3300006844 Ga0075428_100000787 Ga0075428_10000078711 314
154 3300006880 Ga0075429_100010798 Ga0075429_1000107982 314
155 3300006880 Ga0075429_100029183 Ga0075429_1000291833 314
156 3300006880 Ga0075429_100035808 Ga0075429_1000358083 314
157 3300009094 Ga0111539_10033296 Ga0111539_100332964 314
158 3300009094 Ga0111539_10072340 Ga0111539_100723402 314
159 3300025925 Ga0207650_10291250 Ga0207650_102912502 314
160 3300031911 Ga0307412_10079961 Ga0307412_100799612 314
161 3300035170 Ga0373943_0034299 Ga0373943_0034299_648_1631 314
162 3300035692 Ga0373935_0000424 Ga0373935_0000424_20201_21184 314
163 3300035695 Ga0373927_0031103 Ga0373927_0031103_833_1816 314
164 3300035725 Ga0373947_0001572 Ga0373947_0001572_190_1173 314
165 3300037068 Ga0373925_0000676 Ga0373925_0000676_22236_23219 314
166 3300046455 Ga0495603_0000003 Ga0495603_0000003_30708_31691 314
167 3300046459 Ga0495629_0000133 Ga0495629_0000133_58689_59672 314
168 3300046461 Ga0495641_0002965 Ga0495641_0002965_11752_12735 314
169 3300046463 Ga0495653_0022230 Ga0495653_0022230_3303_4286 314
170 3300046472 Ga0495580_0003578 Ga0495580_0003578_5197_6180 314
171 3300046473 Ga0495582_0000016 Ga0495582_0000016_29527_30510 314
172 3300046475 Ga0495639_0000014 Ga0495639_0000014_77557_78540 314
173 3300046477 Ga0495664_0008449 Ga0495664_0008449_2446_3429 314
174 3300046499 Ga0495594_0001356 Ga0495594_0001356_650_1633 314
175 3300046516 Ga0495628_0010243 Ga0495628_0010243_3617_4600 314
176 3300046517 Ga0495630_0001968 Ga0495630_0001968_8836_9819 314
177 3300046531 Ga0495665_0000270 Ga0495665_0000270_15537_16520 314
178 3300046533 Ga0495640_0039997 Ga0495640_0039997_497_1480 314
179 3300046535 Ga0495586_0054928 Ga0495586_0054928_813_1796 314
180 3300046557 Ga0495622_0003887 Ga0495622_0003887_4167_5150 314
181 3300046559 Ga0495667_0009372 Ga0495667_0009372_872_1855 314
182 3300046642 Ga0495634_0000064 Ga0495634_0000064_46660_47643 314
183 3300046663 Ga0495635_0001480 Ga0495635_0001480_2977_3960 314
184 3300046680 Ga0495646_0033854 Ga0495646_0033854_1114_2097 314
185 3300046681 Ga0495647_0001881 Ga0495647_0001881_3177_4160 314
186 3300046689 Ga0495613_0021361 Ga0495613_0021361_965_1948 314
187 3300046690 Ga0495624_0000201 Ga0495624_0000201_30238_31221 314
188 3300047315 Ga0495581_0000014 Ga0495581_0000014_38000_38983 314
189 3300047319 Ga0495674_0018561 Ga0495674_0018561_3358_4341 314
190 3300047321 Ga0495676_0011593 Ga0495676_0011593_2474_3457 314
191 3300047673 Ga0495593_0000003 Ga0495593_0000003_66782_67765 314
192 3300048089 Ga0495614_0038624 Ga0495614_0038624_1004_1987 314
193 3300049822 Ga0501035_0289122 Ga0501035_0289122_18_989 314
194 3300050508 nmdc:mga09592_20547_c1 nmdc:mga09592_20547_c1_1001_1969 314
195 iso_pu_bacteria 2513237141 2513894125 314
196 iso_pu_bacteria 2939631187 2939633135 314
197 3300005328 Ga0070676_10122891 Ga0070676_101228911 315
198 3300005329 Ga0070683_100005693 Ga0070683_1000056936 315
199 3300005344 Ga0070661_100014615 Ga0070661_1000146155 315
200 3300005356 Ga0070674_100033443 Ga0070674_1000334431 315
201 3300005364 Ga0070673_100096599 Ga0070673_1000965992 315
202 3300005367 Ga0070667_100076684 Ga0070667_1000766844 315
203 3300005564 Ga0070664_100005855 Ga0070664_1000058556 315
204 3300005834 Ga0068851_10130084 Ga0068851_101300842 315
205 3300006237 Ga0097621_100008516 Ga0097621_1000085164 315
206 3300014969 Ga0157376_10007063 Ga0157376_100070635 315
207 3300025920 Ga0207649_10016683 Ga0207649_100166833 315
208 3300025940 Ga0207691_10024139 Ga0207691_100241394 315
209 3300025944 Ga0207661_10043226 Ga0207661_100432264 315
210 3300025960 Ga0207651_10103549 Ga0207651_101035492 315
211 3300005329 Ga0070683_100051877 Ga0070683_1000518774 316
212 3300005937 Ga0081455_10055668 Ga0081455_100556683 317
213 3300005983 Ga0081540_1023132 Ga0081540_10231323 317
214 3300021358 Ga0213873_10025110 Ga0213873_100251101 317
215 3300021361 Ga0213872_10038932 Ga0213872_100389322 317
216 3300021361 Ga0213872_10045749 Ga0213872_100457493 317
217 3300025292 Ga0209676_1012614 Ga0209676_10126142 317
218 3300025298 Ga0209050_1000827 Ga0209050_100082718 317
219 3300031730 Ga0307516_10086012 Ga0307516_100860123 317
220 3300035117 Ga0373953_0001480 Ga0373953_0001480_4250_5242 317
221 3300035119 Ga0373956_0001180 Ga0373956_0001180_868_1860 317
222 3300035724 Ga0373933_0004106 Ga0373933_0004106_4304_5296 317
223 3300036401 Ga0373937_0037785 Ga0373937_0037785_1614_2606 317
224 3300046454 Ga0495592_0049096 Ga0495592_0049096_1273_2265 317
225 3300046463 Ga0495653_0006099 Ga0495653_0006099_601_1593 317
226 3300046517 Ga0495630_0001016 Ga0495630_0001016_8414_9406 317
227 3300046533 Ga0495640_0005661 Ga0495640_0005661_8414_9406 317
228 3300046535 Ga0495586_0029891 Ga0495586_0029891_1392_2384 317
229 3300046559 Ga0495667_0002585 Ga0495667_0002585_9823_10815 317
230 3300046809 Ga0495600_0002212 Ga0495600_0002212_3803_4795 317
231 3300047319 Ga0495674_0001491 Ga0495674_0001491_2565_3557 317
232 3300047322 Ga0495680_0003924 Ga0495680_0003924_10654_11646 317
233 3300047471 Ga0495684_0016277 Ga0495684_0016277_2601_3593 317
234 3300053085 Ga0495619_0005906 Ga0495619_0005906_4249_5241 317
235 iso_pu_bacteria 2599185292 2599902528 317
236 iso_pu_bacteria 2643221569 2643859877 317
237 iso_pu_bacteria 2643221594 2643979170 317
238 iso_pu_bacteria 2643221621 2644121212 317
239 iso_pu_bacteria 2808606395 2809036067 317
240 iso_pu_bacteria 2857537821 2857540987 317
241 iso_pu_bacteria 2858950400 2858951428 317
242 iso_pu_bacteria 2941479691 2941481457 317
243 3300005355 Ga0070671_100286668 Ga0070671_1002866682 318
244 3300005436 Ga0070713_100042486 Ga0070713_1000424861 318
245 3300005436 Ga0070713_100103245 Ga0070713_1001032453 318
246 3300005543 Ga0070672_100098428 Ga0070672_1000984283 318
247 3300005578 Ga0068854_100161443 Ga0068854_1001614431 318
248 3300005983 Ga0081540_1097557 Ga0081540_10975572 318
249 3300006028 Ga0070717_10024502 Ga0070717_100245022 318
250 3300006237 Ga0097621_100063608 Ga0097621_1000636085 318
251 3300006358 Ga0068871_100035589 Ga0068871_1000355891 318
252 3300013296 Ga0157374_10055492 Ga0157374_100554925 318
253 3300013297 Ga0157378_10217173 Ga0157378_102171731 318
254 3300013308 Ga0157375_10168788 Ga0157375_101687882 318
255 3300021441 Ga0213871_10001199 Ga0213871_100011991 318
256 3300025928 Ga0207700_10204728 Ga0207700_102047282 318
257 3300025931 Ga0207644_10041157 Ga0207644_100411572 318
258 3300025940 Ga0207691_10013453 Ga0207691_100134535 318
259 3300025981 Ga0207640_10010704 Ga0207640_100107042 318
260 3300035083 Ga0373926_0027717 Ga0373926_0027717_747_1772 318
261 3300035116 Ga0373945_0052297 Ga0373945_0052297_37_1062 318
262 3300035170 Ga0373943_0000069 Ga0373943_0000069_2230_3255 318
263 3300035170 Ga0373943_0010274 Ga0373943_0010274_242_1267 318
264 3300035171 Ga0373946_0007622 Ga0373946_0007622_2433_3458 318
265 3300035171 Ga0373946_0029125 Ga0373946_0029125_452_1477 318
266 3300035692 Ga0373935_0008729 Ga0373935_0008729_892_1917 318
267 3300035695 Ga0373927_0001268 Ga0373927_0001268_9622_10647 318
268 3300035695 Ga0373927_0038759 Ga0373927_0038759_934_1959 318
269 3300035725 Ga0373947_0001389 Ga0373947_0001389_4377_5402 318
270 3300036401 Ga0373937_0543228 Ga0373937_0543228_47_1072 318
271 3300037068 Ga0373925_0003644 Ga0373925_0003644_4260_5285 318
272 3300037466 Ga0395898_0369725 Ga0395898_0369725_70_1050 318
273 3300039447 Ga0436361_0722496 Ga0436361_0722496_1010_2086 318
274 3300039447 Ga0436361_0906288 Ga0436361_0906288_1165_2160 318
275 3300039453 Ga0436362_0360566 Ga0436362_0360566_1396_2391 318
276 3300046454 Ga0495592_0116138 Ga0495592_0116138_491_1516 318
277 3300046463 Ga0495653_0030975 Ga0495653_0030975_2737_3762 318
278 3300046476 Ga0495662_0010313 Ga0495662_0010313_1331_2356 318
279 3300046477 Ga0495664_0000262 Ga0495664_0000262_16809_17834 318
280 3300046514 Ga0495618_0000259 Ga0495618_0000259_22231_23256 318
281 3300046517 Ga0495630_0004644 Ga0495630_0004644_4775_5800 318
282 3300046517 Ga0495630_0039735 Ga0495630_0039735_471_1496 318
283 3300046531 Ga0495665_0027582 Ga0495665_0027582_868_1893 318
284 3300046533 Ga0495640_0003390 Ga0495640_0003390_6358_7383 318
285 3300046533 Ga0495640_0041988 Ga0495640_0041988_489_1514 318
286 3300046543 Ga0495645_0003743 Ga0495645_0003743_6107_7132 318
287 3300046642 Ga0495634_0009185 Ga0495634_0009185_3837_4862 318
288 3300046663 Ga0495635_0000280 Ga0495635_0000280_30657_31682 318
289 3300046690 Ga0495624_0005340 Ga0495624_0005340_5606_6631 318
290 3300046690 Ga0495624_0115965 Ga0495624_0115965_600_1625 318
291 3300047315 Ga0495581_0014851 Ga0495581_0014851_188_1213 318
292 3300047319 Ga0495674_0026694 Ga0495674_0026694_1140_2165 318
293 3300047321 Ga0495676_0213183 Ga0495676_0213183_22_1047 318
294 3300047471 Ga0495684_0002799 Ga0495684_0002799_6393_7418 318
295 3300047471 Ga0495684_0003348 Ga0495684_0003348_9949_10974 318
296 3300048914 Ga0496111_0277491 Ga0496111_0277491_136_1149 318
297 3300053077 Ga0495601_0004025 Ga0495601_0004025_6140_7165 318
298 3300053085 Ga0495619_0002442 Ga0495619_0002442_416_1441 318
299 iso_pu_bacteria 2857542790 2857543530 318
300 3300005329 Ga0070683_100491610 Ga0070683_1004916101 319
301 3300005336 Ga0070680_100042526 Ga0070680_1000425263 319
302 3300005337 Ga0070682_100051695 Ga0070682_1000516952 319
303 3300005338 Ga0068868_100057893 Ga0068868_1000578931 319
304 3300005344 Ga0070661_100306541 Ga0070661_1003065411 319
305 3300005434 Ga0070709_10000242 Ga0070709_1000024216 319
306 3300005434 Ga0070709_10001452 Ga0070709_1000145211 319
307 3300005434 Ga0070709_10091484 Ga0070709_100914842 319
308 3300005435 Ga0070714_100013124 Ga0070714_1000131246 319
309 3300005435 Ga0070714_100311905 Ga0070714_1003119051 319
310 3300005437 Ga0070710_10009035 Ga0070710_100090356 319
311 3300005439 Ga0070711_100005644 Ga0070711_1000056446 319
312 3300005439 Ga0070711_100022470 Ga0070711_1000224702 319
313 3300005455 Ga0070663_100004885 Ga0070663_1000048856 319
314 3300005458 Ga0070681_10039604 Ga0070681_100396044 319
315 3300005458 Ga0070681_10235746 Ga0070681_102357461 319
316 3300005530 Ga0070679_100011762 Ga0070679_1000117625 319
317 3300005548 Ga0070665_100235628 Ga0070665_1002356282 319
318 3300005563 Ga0068855_100062055 Ga0068855_1000620553 319
319 3300005563 Ga0068855_100065971 Ga0068855_1000659712 319
320 3300005564 Ga0070664_100040356 Ga0070664_1000403562 319
321 3300005841 Ga0068863_100319481 Ga0068863_1003194812 319
322 3300006028 Ga0070717_10000411 Ga0070717_1000041121 319
323 3300006028 Ga0070717_10102844 Ga0070717_101028442 319
324 3300006028 Ga0070717_10232353 Ga0070717_102323532 319
325 3300006173 Ga0070716_100003995 Ga0070716_1000039955 319
326 3300006175 Ga0070712_100020002 Ga0070712_1000200024 319
327 3300006175 Ga0070712_100058016 Ga0070712_1000580162 319
328 3300006178 Ga0075367_10004965 Ga0075367_100049652 319
329 3300006237 Ga0097621_100166890 Ga0097621_1001668902 319
330 3300006237 Ga0097621_100266873 Ga0097621_1002668732 319
331 3300006353 Ga0075370_10013842 Ga0075370_100138422 319
332 3300007265 Ga0099794_10027334 Ga0099794_100273342 319
333 3300009093 Ga0105240_10253977 Ga0105240_102539772 319
334 3300009098 Ga0105245_10015489 Ga0105245_100154892 319
335 3300009098 Ga0105245_10217999 Ga0105245_102179992 319
336 3300009545 Ga0105237_10014622 Ga0105237_100146226 319
337 3300011119 Ga0105246_10081804 Ga0105246_100818041 319
338 3300013104 Ga0157370_10096080 Ga0157370_100960801 319
339 3300013104 Ga0157370_10122499 Ga0157370_101224992 319
340 3300013105 Ga0157369_10039389 Ga0157369_100393892 319
341 3300013296 Ga0157374_10016728 Ga0157374_100167285 319
342 3300013306 Ga0163162_10014739 Ga0163162_100147394 319
343 3300013308 Ga0157375_10020469 Ga0157375_100204694 319
344 3300013308 Ga0157375_10492260 Ga0157375_104922602 319
345 3300014325 Ga0163163_10009587 Ga0163163_100095875 319
346 3300014969 Ga0157376_10018358 Ga0157376_100183582 319
347 3300025898 Ga0207692_10000769 Ga0207692_100007697 319
348 3300025898 Ga0207692_10039366 Ga0207692_100393661 319
349 3300025900 Ga0207710_10142805 Ga0207710_101428051 319
350 3300025906 Ga0207699_10001448 Ga0207699_100014486 319
351 3300025906 Ga0207699_10073068 Ga0207699_100730681 319
352 3300025908 Ga0207643_10100664 Ga0207643_101006642 319
353 3300025912 Ga0207707_10052347 Ga0207707_100523472 319
354 3300025912 Ga0207707_10195942 Ga0207707_101959422 319
355 3300025915 Ga0207693_10095827 Ga0207693_100958272 319
356 3300025916 Ga0207663_10011059 Ga0207663_100110596 319
357 3300025916 Ga0207663_10190295 Ga0207663_101902951 319
358 3300025917 Ga0207660_10014318 Ga0207660_100143182 319
359 3300025917 Ga0207660_10071757 Ga0207660_100717572 319
360 3300025921 Ga0207652_10104069 Ga0207652_101040691 319
361 3300025928 Ga0207700_10002105 Ga0207700_1000210510 319
362 3300025928 Ga0207700_10025546 Ga0207700_100255462 319
363 3300025929 Ga0207664_10004305 Ga0207664_100043058 319
364 3300025929 Ga0207664_10007374 Ga0207664_100073745 319
365 3300025939 Ga0207665_10003894 Ga0207665_100038948 319
366 3300025940 Ga0207691_10173948 Ga0207691_101739481 319
367 3300025945 Ga0207679_10114879 Ga0207679_101148792 319
368 3300025949 Ga0207667_10127530 Ga0207667_101275302 319
369 3300026023 Ga0207677_10288554 Ga0207677_102885541 319
370 3300026067 Ga0207678_10037307 Ga0207678_100373073 319
371 3300026121 Ga0207683_10003934 Ga0207683_100039345 319
372 3300028379 Ga0268266_10130057 Ga0268266_101300572 319
373 3300028794 Ga0307515_10009804 Ga0307515_100098043 319
374 3300031249 Ga0265339_10046527 Ga0265339_100465272 319
375 3300031456 Ga0307513_10032426 Ga0307513_100324263 319
376 3300031456 Ga0307513_10071006 Ga0307513_100710064 319
377 3300031616 Ga0307508_10091438 Ga0307508_100914381 319
378 3300031730 Ga0307516_10000859 Ga0307516_1000085921 319
379 3300035086 Ga0373934_0010265 Ga0373934_0010265_303_1286 319
380 3300035111 Ga0373923_0012682 Ga0373923_0012682_1929_2912 319
381 3300035117 Ga0373953_0003249 Ga0373953_0003249_3534_4517 319
382 3300035118 Ga0373954_0010708 Ga0373954_0010708_239_1222 319
383 3300035119 Ga0373956_0004561 Ga0373956_0004561_1827_2810 319
384 3300035120 Ga0373957_0000718 Ga0373957_0000718_2918_3901 319
385 3300035172 Ga0373955_0009765 Ga0373955_0009765_80_1063 319
386 3300035410 Ga0373924_0018171 Ga0373924_0018171_613_1596 319
387 3300035724 Ga0373933_0009290 Ga0373933_0009290_239_1222 319
388 3300039437 Ga0436365_0981168 Ga0436365_0981168_152_1135 319
389 3300039437 Ga0436365_1651590 Ga0436365_1651590_2872_3855 319
390 3300039450 Ga0436363_0219890 Ga0436363_0219890_93_1076 319
391 3300041512 Ga0451853_4111325 Ga0451853_4111325_980_2026 319
392 3300046454 Ga0495592_0018211 Ga0495592_0018211_2694_3677 319
393 3300046459 Ga0495629_0006180 Ga0495629_0006180_1893_2876 319
394 3300046462 Ga0495651_0023870 Ga0495651_0023870_647_1630 319
395 3300046507 Ga0495606_0176777 Ga0495606_0176777_84_1067 319
396 3300046511 Ga0495608_0006739 Ga0495608_0006739_4435_5418 319
397 3300046529 Ga0495652_0011764 Ga0495652_0011764_6238_7221 319
398 3300046642 Ga0495634_0132260 Ga0495634_0132260_343_1326 319
399 3300046663 Ga0495635_0010498 Ga0495635_0010498_4853_5836 319
400 3300046675 Ga0495657_0051155 Ga0495657_0051155_1273_2256 319
401 3300046678 Ga0495599_0010366 Ga0495599_0010366_1862_2845 319
402 3300046679 Ga0495623_0012337 Ga0495623_0012337_4375_5358 319
403 3300046689 Ga0495613_0021810 Ga0495613_0021810_890_1873 319
404 3300046691 Ga0495670_0119799 Ga0495670_0119799_304_1287 319
405 3300046809 Ga0495600_0003588 Ga0495600_0003588_2141_3124 319
406 3300047444 Ga0495675_0019169 Ga0495675_0019169_2604_3587 319
407 3300047471 Ga0495684_0016289 Ga0495684_0016289_3092_4075 319
408 3300047673 Ga0495593_0012203 Ga0495593_0012203_3643_4626 319
409 3300048088 Ga0495602_0070010 Ga0495602_0070010_1503_2486 319
410 3300048903 Ga0496100_0001339 Ga0496100_0001339_9299_10282 319
411 3300048904 Ga0496101_0005846 Ga0496101_0005846_5016_5999 319
412 3300048905 Ga0496102_0011304 Ga0496102_0011304_5659_6642 319
413 3300048906 Ga0496103_0035181 Ga0496103_0035181_424_1407 319
414 3300048908 Ga0496105_0021644 Ga0496105_0021644_335_1318 319
415 3300048909 Ga0496106_0010254 Ga0496106_0010254_2187_3170 319
416 3300048909 Ga0496106_0069199 Ga0496106_0069199_77_1060 319
417 3300048910 Ga0496107_0090163 Ga0496107_0090163_530_1513 319
418 3300048912 Ga0496109_0010899 Ga0496109_0010899_6233_7279 319
419 3300048912 Ga0496109_0293036 Ga0496109_0293036_180_1208 319
420 3300048913 Ga0496110_0215857 Ga0496110_0215857_211_1194 319
421 3300048915 Ga0496112_0016913 Ga0496112_0016913_5170_6153 319
422 3300048917 Ga0496114_0012537 Ga0496114_0012537_4319_5302 319
423 3300048917 Ga0496114_0171134 Ga0496114_0171134_409_1437 319
424 3300048918 Ga0496115_0066448 Ga0496115_0066448_1585_2568 319
425 3300048920 Ga0496117_0055218 Ga0496117_0055218_555_1538 319
426 3300048921 Ga0496118_0008083 Ga0496118_0008083_5712_6695 319
427 3300048924 Ga0496121_0000041 Ga0496121_0000041_45318_46301 319
428 3300048927 Ga0496124_0000945 Ga0496124_0000945_22600_23583 319
429 3300048929 Ga0496126_0028923 Ga0496126_0028923_2131_3114 319
430 3300049581 Ga0501047_0010702 Ga0501047_0010702_4183_5166 319
431 3300049586 Ga0501070_0010185 Ga0501070_0010185_791_1774 319
432 3300049589 Ga0501073_0108584 Ga0501073_0108584_436_1419 319
433 3300049742 Ga0501080_0100919 Ga0501080_0100919_1407_2390 319
434 3300049823 Ga0501044_0016699 Ga0501044_0016699_4361_5344 319
435 3300050496 nmdc:mga07m45_64607_c1 nmdc:mga07m45_64607_c1_56_1039 319
436 3300053083 Ga0495655_0004534 Ga0495655_0004534_312_1358 319
437 3300053084 Ga0495595_0004367 Ga0495595_0004367_1183_2166 319
438 3300053158 Ga0500627_0030240 Ga0500627_0030240_363_1346 319
439 3300009545 Ga0105237_10015939 Ga0105237_100159393 320
440 3300009551 Ga0105238_10052003 Ga0105238_100520032 320
441 3300010375 Ga0105239_10051052 Ga0105239_100510522 320
442 3300013306 Ga0163162_10088826 Ga0163162_100888261 320
443 3300053093 Ga0500651_0012975 Ga0500651_0012975_3707_4708 320
444 iso_pu_bacteria 2855730933 2855734632 320
445 iso_pu_bacteria 2855767633 2855770222 320
446 iso_pu_bacteria 2881412998 2881414443 320
447 3300025298 Ga0209050_1001957 Ga0209050_10019573 321
448 3300031911 Ga0307412_10005148 Ga0307412_100051484 321
449 3300035695 Ga0373927_0001241 Ga0373927_0001241_9744_10742 321
450 3300046689 Ga0495613_0061590 Ga0495613_0061590_608_1606 321
451 3300048919 Ga0496116_0005759 Ga0496116_0005759_3125_4129 321
452 3300048919 Ga0496116_0040899 Ga0496116_0040899_1997_3001 321
453 3300048921 Ga0496118_0127945 Ga0496118_0127945_85_1089 321
454 3300048922 Ga0496119_0008344 Ga0496119_0008344_777_1781 321
455 3300048924 Ga0496121_0000847 Ga0496121_0000847_11929_12933 321
456 3300048925 Ga0496122_0000017 Ga0496122_0000017_360365_361369 321
457 3300048925 Ga0496122_0097221 Ga0496122_0097221_530_1534 321
458 3300048926 Ga0496123_0000033 Ga0496123_0000033_77064_78068 321
459 3300048926 Ga0496123_0082445 Ga0496123_0082445_194_1198 321
460 3300048927 Ga0496124_0040428 Ga0496124_0040428_2717_3721 321
461 3300048927 Ga0496124_0177323 Ga0496124_0177323_83_1087 321
462 3300048928 Ga0496125_0000005 Ga0496125_0000005_811632_812636 321
463 3300048928 Ga0496125_0036584 Ga0496125_0036584_3175_4179 321
464 3300050491 nmdc:mga00v17_221528_c1 nmdc:mga00v17_221528_c1_52_1053 321
465 3300006051 Ga0075364_10003656 Ga0075364_100036566 322
466 3300006051 Ga0075364_10014581 Ga0075364_100145813 322
467 3300048924 Ga0496121_0066820 Ga0496121_0066820_479_1456 322
468 3300048927 Ga0496124_0000103 Ga0496124_0000103_140921_141898 322
469 3300050491 nmdc:mga00v17_141_c1 nmdc:mga00v17_141_c1_31749_32726 322
470 3300049581 Ga0501047_0000950 Ga0501047_0000950_5848_6861 323
471 3300049822 Ga0501035_0004018 Ga0501035_0004018_10347_11321 323
472 3300049823 Ga0501044_0002477 Ga0501044_0002477_15242_16255 323
473 3300003187 JGI25151J46595_10000197 JGI25151J46595_1000019716 324
474 3300003187 JGI25151J46595_10005497 JGI25151J46595_100054974 324
475 3300003187 JGI25151J46595_10007324 JGI25151J46595_100073244 324
476 3300003771 Ga0055526_1005010 Ga0055526_10050102 324
477 3300003771 Ga0055526_1006918 Ga0055526_10069184 324
478 3300003773 Ga0055537_1007788 Ga0055537_10077882 324
479 3300003775 Ga0055524_1012589 Ga0055524_10125892 324
480 3300003781 Ga0055536_1001494 Ga0055536_100149413 324
481 3300003781 Ga0055536_1006276 Ga0055536_10062764 324
482 3300003784 Ga0055534_1003201 Ga0055534_10032014 324
483 3300003784 Ga0055534_1004774 Ga0055534_10047741 324
484 3300025263 Ga0209565_1000217 Ga0209565_100021756 324
485 3300025291 Ga0209675_1000479 Ga0209675_100047927 324
486 3300025291 Ga0209675_1013780 Ga0209675_10137801 324
487 3300025292 Ga0209676_1000066 Ga0209676_10000664 324
488 3300025294 Ga0209025_1000003 Ga0209025_1000003303 324
489 3300025294 Ga0209025_1001052 Ga0209025_100105237 324
490 3300025294 Ga0209025_1002731 Ga0209025_10027314 324
491 3300025295 Ga0209564_1001346 Ga0209564_100134623 324
492 3300025299 Ga0209256_1001626 Ga0209256_100162618 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

111

385

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9601 30 323
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9569 33 324
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.954 29 324
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9471 30 322
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9415 30 323
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9484 128 244 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9382 128 248 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.936 128 248 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9259 129 244 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9128 30 324 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A5N7RTP8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9694 30 322
AF-V8QW12-F1-model_v4 ABC transporter substrate-binding protein 0.9686 37 324
AF-A0A1R0HGB9-F1-model_v4 deleted 0.9663 29 324
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9648 37 324
AF-A0A1C9VI32-F1-model_v4 deleted 0.9638 22 324

Feature Viewer

pLDDT pTM Quality
90.82 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map