F454107
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 491 | 306 | 982 | 385 |
Family's Representative Sequence
| Representative Sequence | 3300020082|Ga0206353_10449420|Ga0206353_104494202 |
| Length | 386 |
| Sequence | MPRRLFTSESVTEGHPDKIPAARVAVETMITTGQVHVAGEVTTSAYADIATLVRGKILEIGYDSSKKGFDGASCGVSVSIGAQSPDIAQGVDGAYGQRAAETADELDRQGAGDQGLMFGYASDETPELMPVPITLAHRLAHRLSAVRKNGTIPYLRPDGKTQVTIEYAGDRAVRLDTVVVSSQHASDIDLDSLLAPDVRQFVVEPELGALLDDGIKLDTDGYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAARCEVQVAYAIGKAEPVGLFVETFGTETVAAERIEAAIGEVFDLRPAAIIRDLDLLRPIYAQTAAYGHFGRELPDFTWERTDRIDALKAAAGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 106 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 157 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 158 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 159 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 162 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 163 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 172 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 174 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 178 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 180 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 189 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 194 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 195 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 196 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 197 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 198 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 199 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 200 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 230 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 231 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 232 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 233 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 249 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 250 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 260 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 261 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 262 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 263 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 264 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 265 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 267 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 268 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 269 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 270 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 271 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 272 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 273 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 274 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 275 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 276 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 277 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 278 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 279 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 280 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 281 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 282 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 283 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 284 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 285 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 286 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 287 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 288 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 289 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 290 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 291 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 292 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 293 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 294 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 295 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 296 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 297 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 298 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 299 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 300 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 301 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 302 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 303 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 304 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 305 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 306 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.95 |
| Metatranscriptomes | 2.04 |
| Isolates | 12.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.05 |
| Nodule | 2.24 |
| Rhizoplane | 7.54 |
| Rhizosphere | 73.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0206353_10449420 | 3300020082 | Bacteria | 4586 |
| 2 | JGI25406J46586_10029948 | 3300003203 | Bacteria | 2053 |
| 3 | JGI25407J50210_10011742 | 3300003373 | Bacteria | 2242 |
| 4 | Ga0007427J51700_103889 | 3300003559 | Bacteria | 1703 |
| 5 | Ga0070658_10000155 | 3300005327 | Bacteria | 60553 |
| 6 | Ga0070670_100135587 | 3300005331 | Bacteria | 2127 |
| 7 | Ga0068869_100029053 | 3300005334 | Bacteria | 3869 |
| 8 | Ga0070666_10069597 | 3300005335 | Bacteria | 2393 |
| 9 | Ga0070680_100037247 | 3300005336 | Bacteria | 3930 |
| 10 | Ga0070680_100071705 | 3300005336 | Bacteria | 2847 |
| 11 | Ga0070680_100123799 | 3300005336 | Bacteria | 2160 |
| 12 | Ga0070682_100032467 | 3300005337 | Bacteria | 3166 |
| 13 | Ga0068868_100004213 | 3300005338 | Bacteria | 10061 |
| 14 | Ga0068868_100007824 | 3300005338 | Bacteria | 7630 |
| 15 | Ga0068868_100020963 | 3300005338 | Bacteria | 4919 |
| 16 | Ga0070660_100053517 | 3300005339 | Bacteria | 3114 |
| 17 | Ga0070689_100114231 | 3300005340 | Bacteria | 2151 |
| 18 | Ga0070691_10001177 | 3300005341 | Bacteria | 10945 |
| 19 | Ga0070661_100021232 | 3300005344 | Bacteria | 4635 |
| 20 | Ga0070661_100043884 | 3300005344 | Bacteria | 3266 |
| 21 | Ga0070692_10051312 | 3300005345 | Bacteria | 2145 |
| 22 | Ga0070669_100037629 | 3300005353 | Bacteria | 3510 |
| 23 | Ga0070675_100017004 | 3300005354 | Bacteria | 5779 |
| 24 | Ga0070675_100079739 | 3300005354 | Bacteria | 2728 |
| 25 | Ga0070671_100002713 | 3300005355 | Bacteria | 13735 |
| 26 | Ga0070688_100155594 | 3300005365 | Bacteria | 1566 |
| 27 | Ga0070659_100038921 | 3300005366 | Bacteria | 3710 |
| 28 | Ga0070667_100014986 | 3300005367 | Bacteria | 6405 |
| 29 | Ga0070667_100207366 | 3300005367 | Bacteria | 1741 |
| 30 | Ga0070709_10164481 | 3300005434 | Bacteria | 1545 |
| 31 | Ga0070714_100263200 | 3300005435 | Bacteria | 1597 |
| 32 | Ga0070710_10065621 | 3300005437 | Bacteria | 2079 |
| 33 | Ga0070711_100025960 | 3300005439 | Bacteria | 3836 |
| 34 | Ga0070705_100033674 | 3300005440 | Bacteria | 2858 |
| 35 | Ga0070705_100056907 | 3300005440 | Bacteria | 2305 |
| 36 | Ga0070700_100052970 | 3300005441 | Bacteria | 2531 |
| 37 | Ga0070694_100032516 | 3300005444 | Bacteria | 3426 |
| 38 | Ga0070708_100005557 | 3300005445 | Bacteria | 9988 |
| 39 | Ga0070663_100050920 | 3300005455 | Bacteria | 2947 |
| 40 | Ga0070678_100017670 | 3300005456 | Bacteria | 4599 |
| 41 | Ga0070662_100013742 | 3300005457 | Bacteria | 5392 |
| 42 | Ga0070681_10066947 | 3300005458 | Bacteria | 3561 |
| 43 | Ga0070681_10168363 | 3300005458 | Bacteria | 2113 |
| 44 | Ga0070685_10100702 | 3300005466 | Bacteria | 1764 |
| 45 | Ga0070706_100016465 | 3300005467 | Bacteria | 6833 |
| 46 | Ga0070706_100030801 | 3300005467 | Bacteria | 4945 |
| 47 | Ga0070707_100002888 | 3300005468 | Bacteria | 16326 |
| 48 | Ga0070707_100086721 | 3300005468 | Bacteria | 3027 |
| 49 | Ga0070679_100031607 | 3300005530 | Bacteria | 5231 |
| 50 | Ga0070679_100034415 | 3300005530 | Bacteria | 5020 |
| 51 | Ga0070684_100023795 | 3300005535 | Bacteria | 5129 |
| 52 | Ga0070684_100111449 | 3300005535 | Bacteria | 2454 |
| 53 | Ga0070697_100141613 | 3300005536 | Bacteria | 2023 |
| 54 | Ga0068853_100100890 | 3300005539 | Bacteria | 2552 |
| 55 | Ga0070695_100037879 | 3300005545 | Bacteria | 3040 |
| 56 | Ga0070696_100008782 | 3300005546 | Bacteria | 6762 |
| 57 | Ga0070693_100063728 | 3300005547 | Bacteria | 2149 |
| 58 | Ga0070704_100132440 | 3300005549 | Bacteria | 1934 |
| 59 | Ga0068855_100028889 | 3300005563 | Bacteria | 6634 |
| 60 | Ga0068855_100035705 | 3300005563 | Bacteria | 5921 |
| 61 | Ga0068855_100122244 | 3300005563 | Bacteria | 2979 |
| 62 | Ga0070664_100011541 | 3300005564 | Bacteria | 7169 |
| 63 | Ga0070664_100065602 | 3300005564 | Bacteria | 3098 |
| 64 | Ga0068854_100068130 | 3300005578 | Bacteria | 2595 |
| 65 | Ga0068856_100263612 | 3300005614 | Bacteria | 1739 |
| 66 | Ga0070702_100018873 | 3300005615 | Bacteria | 3585 |
| 67 | Ga0070702_100059422 | 3300005615 | Bacteria | 2218 |
| 68 | Ga0068864_100037652 | 3300005618 | Bacteria | 4129 |
| 69 | Ga0068864_100049993 | 3300005618 | Bacteria | 3597 |
| 70 | Ga0068864_100097845 | 3300005618 | Bacteria | 2598 |
| 71 | Ga0068864_100196241 | 3300005618 | Bacteria | 1852 |
| 72 | Ga0068861_100062463 | 3300005719 | Bacteria | 2862 |
| 73 | Ga0068851_10031107 | 3300005834 | Bacteria | 2650 |
| 74 | Ga0068870_10000071 | 3300005840 | Bacteria | 32257 |
| 75 | Ga0068870_10133917 | 3300005840 | Bacteria | 1442 |
| 76 | Ga0068863_100006202 | 3300005841 | Bacteria | 11728 |
| 77 | Ga0068863_100129014 | 3300005841 | Bacteria | 2413 |
| 78 | Ga0068863_100162764 | 3300005841 | Bacteria | 2138 |
| 79 | Ga0068863_100204199 | 3300005841 | Bacteria | 1901 |
| 80 | Ga0068863_100221379 | 3300005841 | Bacteria | 1824 |
| 81 | Ga0068858_100049748 | 3300005842 | Bacteria | 3880 |
| 82 | Ga0068858_100091164 | 3300005842 | Bacteria | 2837 |
| 83 | Ga0068860_100000696 | 3300005843 | Bacteria | 38651 |
| 84 | Ga0068860_100216133 | 3300005843 | Bacteria | 1860 |
| 85 | Ga0068862_100148141 | 3300005844 | Bacteria | 2088 |
| 86 | Ga0081455_10009481 | 3300005937 | Bacteria | 10009 |
| 87 | Ga0081455_10101636 | 3300005937 | Bacteria | 2307 |
| 88 | Ga0081538_10003212 | 3300005981 | Bacteria | 15534 |
| 89 | Ga0081540_1002024 | 3300005983 | Bacteria | 16920 |
| 90 | Ga0081540_1002336 | 3300005983 | Bacteria | 15529 |
| 91 | Ga0081540_1028714 | 3300005983 | Bacteria | 3116 |
| 92 | Ga0081540_1035544 | 3300005983 | Bacteria | 2670 |
| 93 | Ga0081540_1037843 | 3300005983 | Bacteria | 2552 |
| 94 | Ga0081539_10001256 | 3300005985 | Bacteria | 45022 |
| 95 | Ga0081539_10008632 | 3300005985 | Bacteria | 8790 |
| 96 | Ga0070717_10054407 | 3300006028 | Bacteria | 3300 |
| 97 | Ga0075364_10032964 | 3300006051 | Bacteria | 3332 |
| 98 | Ga0070716_100007596 | 3300006173 | Bacteria | 5347 |
| 99 | Ga0070712_100016810 | 3300006175 | Bacteria | 4731 |
| 100 | Ga0075362_10058102 | 3300006177 | Bacteria | 1744 |
| 101 | Ga0075367_10062290 | 3300006178 | Bacteria | 2227 |
| 102 | Ga0097621_100039185 | 3300006237 | Bacteria | 3805 |
| 103 | Ga0097621_100061317 | 3300006237 | Bacteria | 3085 |
| 104 | Ga0075370_10014738 | 3300006353 | Bacteria | 4174 |
| 105 | Ga0068871_100037288 | 3300006358 | Bacteria | 3876 |
| 106 | Ga0075428_100000548 | 3300006844 | Bacteria | 38376 |
| 107 | Ga0075428_100013258 | 3300006844 | Bacteria | 9171 |
| 108 | Ga0075428_100180559 | 3300006844 | Bacteria | 2285 |
| 109 | Ga0075430_100001669 | 3300006846 | Bacteria | 18139 |
| 110 | Ga0075431_100067857 | 3300006847 | Bacteria | 3681 |
| 111 | Ga0075433_10004261 | 3300006852 | Bacteria | 11111 |
| 112 | Ga0075433_10112437 | 3300006852 | Bacteria | 2416 |
| 113 | Ga0075434_100061910 | 3300006871 | Bacteria | 3724 |
| 114 | Ga0075429_100008206 | 3300006880 | Bacteria | 9079 |
| 115 | Ga0075436_100013244 | 3300006914 | Bacteria | 5652 |
| 116 | Ga0075436_100104504 | 3300006914 | Bacteria | 1974 |
| 117 | Ga0075435_100011752 | 3300007076 | Bacteria | 6460 |
| 118 | Ga0075435_100017819 | 3300007076 | Bacteria | 5383 |
| 119 | Ga0075435_100037946 | 3300007076 | Bacteria | 3840 |
| 120 | Ga0105251_10019066 | 3300009011 | Bacteria | 3633 |
| 121 | Ga0105251_10085020 | 3300009011 | Bacteria | 1458 |
| 122 | Ga0105240_10025288 | 3300009093 | Bacteria | 7806 |
| 123 | Ga0105240_10046325 | 3300009093 | Bacteria | 5510 |
| 124 | Ga0105240_10241506 | 3300009093 | Bacteria | 2094 |
| 125 | Ga0111539_10002078 | 3300009094 | Bacteria | 26758 |
| 126 | Ga0105245_10010790 | 3300009098 | Bacteria | 7950 |
| 127 | Ga0105245_10138499 | 3300009098 | Bacteria | 2290 |
| 128 | Ga0114129_10026954 | 3300009147 | Bacteria | 8134 |
| 129 | Ga0114129_10068551 | 3300009147 | Bacteria | 4946 |
| 130 | Ga0114129_10112387 | 3300009147 | Bacteria | 3756 |
| 131 | Ga0105243_10021460 | 3300009148 | Bacteria | 4903 |
| 132 | Ga0105241_10004726 | 3300009174 | Bacteria | 10042 |
| 133 | Ga0105241_10050833 | 3300009174 | Bacteria | 3159 |
| 134 | Ga0105241_10113572 | 3300009174 | Bacteria | 2171 |
| 135 | Ga0105242_10056072 | 3300009176 | Bacteria | 3224 |
| 136 | Ga0105248_10074502 | 3300009177 | Bacteria | 3815 |
| 137 | Ga0105248_10096019 | 3300009177 | Bacteria | 3338 |
| 138 | Ga0105237_10367808 | 3300009545 | Bacteria | 1443 |
| 139 | Ga0105238_10011506 | 3300009551 | Bacteria | 8915 |
| 140 | Ga0105238_10198471 | 3300009551 | Bacteria | 1982 |
| 141 | Ga0105032_100820 | 3300009979 | Bacteria | 2934 |
| 142 | Ga0105246_10000478 | 3300011119 | Bacteria | 21566 |
| 143 | Ga0105246_10011011 | 3300011119 | Bacteria | 5605 |
| 144 | Ga0157373_10044187 | 3300013100 | Bacteria | 3181 |
| 145 | Ga0157371_10095214 | 3300013102 | Bacteria | 2110 |
| 146 | Ga0157370_10029838 | 3300013104 | Bacteria | 5346 |
| 147 | Ga0157374_10123603 | 3300013296 | Bacteria | 2500 |
| 148 | Ga0157374_10262748 | 3300013296 | Bacteria | 1700 |
| 149 | Ga0157378_10126219 | 3300013297 | Bacteria | 2364 |
| 150 | Ga0157372_10087968 | 3300013307 | Bacteria | 3526 |
| 151 | Ga0157372_10292662 | 3300013307 | Bacteria | 1894 |
| 152 | Ga0157375_10043146 | 3300013308 | Bacteria | 4371 |
| 153 | Ga0163163_10009000 | 3300014325 | Bacteria | 8896 |
| 154 | Ga0163163_10088919 | 3300014325 | Bacteria | 3100 |
| 155 | Ga0163163_10102614 | 3300014325 | Bacteria | 2884 |
| 156 | Ga0157377_10012177 | 3300014745 | Bacteria | 4317 |
| 157 | Ga0157379_10045611 | 3300014968 | Bacteria | 3912 |
| 158 | Ga0157376_10217435 | 3300014969 | Bacteria | 1768 |
| 159 | Ga0206349_1115733 | 3300020075 | Bacteria | 2884 |
| 160 | Ga0206353_11895285 | 3300020082 | Bacteria | 1981 |
| 161 | Ga0213876_10001219 | 3300021384 | Bacteria | 16232 |
| 162 | Ga0224712_10004370 | 3300022467 | Bacteria | 3806 |
| 163 | Ga0224712_10075717 | 3300022467 | Bacteria | 1377 |
| 164 | Ga0207710_10008848 | 3300025900 | Bacteria | 4239 |
| 165 | Ga0207688_10029958 | 3300025901 | Bacteria | 3000 |
| 166 | Ga0207688_10121434 | 3300025901 | Bacteria | 1525 |
| 167 | Ga0207680_10093628 | 3300025903 | Bacteria | 1917 |
| 168 | Ga0207680_10148750 | 3300025903 | Bacteria | 1559 |
| 169 | Ga0207643_10000102 | 3300025908 | Bacteria | 57710 |
| 170 | Ga0207705_10001837 | 3300025909 | Bacteria | 16689 |
| 171 | Ga0207705_10033090 | 3300025909 | Bacteria | 3695 |
| 172 | Ga0207705_10041673 | 3300025909 | Bacteria | 3294 |
| 173 | Ga0207705_10057885 | 3300025909 | Bacteria | 2796 |
| 174 | Ga0207705_10251350 | 3300025909 | Bacteria | 1348 |
| 175 | Ga0207684_10006321 | 3300025910 | Bacteria | 10806 |
| 176 | Ga0207654_10064344 | 3300025911 | Bacteria | 2156 |
| 177 | Ga0207707_10036826 | 3300025912 | Bacteria | 4276 |
| 178 | Ga0207707_10047880 | 3300025912 | Bacteria | 3723 |
| 179 | Ga0207707_10210981 | 3300025912 | Bacteria | 1691 |
| 180 | Ga0207695_10003124 | 3300025913 | Bacteria | 23688 |
| 181 | Ga0207695_10027858 | 3300025913 | Bacteria | 6281 |
| 182 | Ga0207695_10101759 | 3300025913 | Bacteria | 2867 |
| 183 | Ga0207671_10028477 | 3300025914 | Bacteria | 4174 |
| 184 | Ga0207671_10184247 | 3300025914 | Bacteria | 1626 |
| 185 | Ga0207693_10001971 | 3300025915 | Bacteria | 17987 |
| 186 | Ga0207660_10013362 | 3300025917 | Bacteria | 5381 |
| 187 | Ga0207660_10015363 | 3300025917 | Bacteria | 5051 |
| 188 | Ga0207660_10124224 | 3300025917 | Bacteria | 1958 |
| 189 | Ga0207657_10058913 | 3300025919 | Bacteria | 3303 |
| 190 | Ga0207657_10059520 | 3300025919 | Bacteria | 3281 |
| 191 | Ga0207649_10008342 | 3300025920 | Bacteria | 5646 |
| 192 | Ga0207649_10063227 | 3300025920 | Bacteria | 2336 |
| 193 | Ga0207652_10019773 | 3300025921 | Bacteria | 5543 |
| 194 | Ga0207652_10082159 | 3300025921 | Bacteria | 2819 |
| 195 | Ga0207652_10117570 | 3300025921 | Bacteria | 2362 |
| 196 | Ga0207646_10037562 | 3300025922 | Bacteria | 4366 |
| 197 | Ga0207646_10075659 | 3300025922 | Bacteria | 3008 |
| 198 | Ga0207694_10005907 | 3300025924 | Bacteria | 9385 |
| 199 | Ga0207650_10003132 | 3300025925 | Bacteria | 11395 |
| 200 | Ga0207659_10010653 | 3300025926 | Bacteria | 5781 |
| 201 | Ga0207687_10006095 | 3300025927 | Bacteria | 7982 |
| 202 | Ga0207687_10031041 | 3300025927 | Bacteria | 3609 |
| 203 | Ga0207687_10208763 | 3300025927 | Bacteria | 1531 |
| 204 | Ga0207700_10170528 | 3300025928 | Bacteria | 1815 |
| 205 | Ga0207644_10046743 | 3300025931 | Bacteria | 3085 |
| 206 | Ga0207706_10065001 | 3300025933 | Bacteria | 3212 |
| 207 | Ga0207709_10074532 | 3300025935 | Bacteria | 2166 |
| 208 | Ga0207670_10012052 | 3300025936 | Bacteria | 5041 |
| 209 | Ga0207670_10078860 | 3300025936 | Bacteria | 2298 |
| 210 | Ga0207704_10066731 | 3300025938 | Bacteria | 2260 |
| 211 | Ga0207665_10002513 | 3300025939 | Bacteria | 12334 |
| 212 | Ga0207711_10120505 | 3300025941 | Bacteria | 2341 |
| 213 | Ga0207689_10014046 | 3300025942 | Bacteria | 6815 |
| 214 | Ga0207689_10041116 | 3300025942 | Bacteria | 3826 |
| 215 | Ga0207661_10009298 | 3300025944 | Bacteria | 7043 |
| 216 | Ga0207661_10010323 | 3300025944 | Bacteria | 6718 |
| 217 | Ga0207679_10019242 | 3300025945 | Bacteria | 4585 |
| 218 | Ga0207667_10074145 | 3300025949 | Bacteria | 3535 |
| 219 | Ga0207667_10454046 | 3300025949 | Bacteria | 1302 |
| 220 | Ga0207712_10216838 | 3300025961 | Bacteria | 1528 |
| 221 | Ga0207668_10002345 | 3300025972 | Bacteria | 11050 |
| 222 | Ga0207668_10031935 | 3300025972 | Bacteria | 3474 |
| 223 | Ga0207640_10031185 | 3300025981 | Bacteria | 3291 |
| 224 | Ga0207658_10020723 | 3300025986 | Bacteria | 4554 |
| 225 | Ga0207677_10007428 | 3300026023 | Bacteria | 6061 |
| 226 | Ga0207703_10090243 | 3300026035 | Bacteria | 2575 |
| 227 | Ga0207678_10000163 | 3300026067 | Bacteria | 55928 |
| 228 | Ga0207678_10002103 | 3300026067 | Bacteria | 18030 |
| 229 | Ga0207678_10150783 | 3300026067 | Bacteria | 1985 |
| 230 | Ga0207708_10009183 | 3300026075 | Bacteria | 7318 |
| 231 | Ga0207708_10018977 | 3300026075 | Bacteria | 5178 |
| 232 | Ga0207702_10000567 | 3300026078 | Bacteria | 41121 |
| 233 | Ga0207641_10008900 | 3300026088 | Bacteria | 8292 |
| 234 | Ga0207641_10107262 | 3300026088 | Bacteria | 2470 |
| 235 | Ga0207641_10167936 | 3300026088 | Bacteria | 2000 |
| 236 | Ga0207676_10000814 | 3300026095 | Bacteria | 24327 |
| 237 | Ga0207676_10035860 | 3300026095 | Bacteria | 3769 |
| 238 | Ga0207676_10059729 | 3300026095 | Bacteria | 3012 |
| 239 | Ga0207674_10066533 | 3300026116 | Bacteria | 3630 |
| 240 | Ga0207675_100034673 | 3300026118 | Bacteria | 4706 |
| 241 | Ga0207683_10001761 | 3300026121 | Bacteria | 19161 |
| 242 | Ga0207683_10002042 | 3300026121 | Bacteria | 17869 |
| 243 | Ga0207428_10015137 | 3300027907 | Bacteria | 6677 |
| 244 | Ga0207428_10067151 | 3300027907 | Bacteria | 2824 |
| 245 | Ga0268265_10021181 | 3300028380 | Bacteria | 4550 |
| 246 | Ga0268264_10000697 | 3300028381 | Bacteria | 39075 |
| 247 | Ga0268264_10144765 | 3300028381 | Bacteria | 2123 |
| 248 | Ga0307515_10000182 | 3300028794 | Bacteria | 154288 |
| 249 | Ga0307515_10007109 | 3300028794 | Bacteria | 22231 |
| 250 | Ga0307515_10049070 | 3300028794 | Bacteria | 6365 |
| 251 | Ga0307515_10282072 | 3300028794 | Bacteria | 1367 |
| 252 | Ga0307512_10009848 | 3300030522 | Bacteria | 9173 |
| 253 | Ga0307512_10023837 | 3300030522 | Bacteria | 5461 |
| 254 | Ga0307513_10030700 | 3300031456 | Bacteria | 6100 |
| 255 | Ga0307513_10037395 | 3300031456 | Bacteria | 5403 |
| 256 | Ga0307509_10043119 | 3300031507 | Bacteria | 4884 |
| 257 | Ga0307408_100089882 | 3300031548 | Bacteria | 2316 |
| 258 | Ga0307508_10001109 | 3300031616 | Bacteria | 31161 |
| 259 | Ga0316576_10000137 | 3300031727 | Bacteria | 28506 |
| 260 | Ga0316576_10006220 | 3300031727 | Bacteria | 7405 |
| 261 | Ga0307516_10000395 | 3300031730 | Bacteria | 56947 |
| 262 | Ga0307516_10007781 | 3300031730 | Bacteria | 12239 |
| 263 | Ga0307405_10005963 | 3300031731 | Bacteria | 5946 |
| 264 | Ga0307405_10061034 | 3300031731 | Bacteria | 2381 |
| 265 | Ga0307410_10125691 | 3300031852 | Bacteria | 1877 |
| 266 | Ga0307406_10002243 | 3300031901 | Bacteria | 10526 |
| 267 | Ga0307406_10005185 | 3300031901 | Bacteria | 7115 |
| 268 | Ga0307409_100000570 | 3300031995 | Bacteria | 16038 |
| 269 | Ga0307409_100187515 | 3300031995 | Bacteria | 1837 |
| 270 | Ga0307416_100063011 | 3300032002 | Bacteria | 3034 |
| 271 | Ga0307416_100341315 | 3300032002 | Bacteria | 1511 |
| 272 | Ga0307411_10174417 | 3300032005 | Bacteria | 1625 |
| 273 | Ga0307411_10176793 | 3300032005 | Bacteria | 1616 |
| 274 | Ga0307415_100000023 | 3300032126 | Bacteria | 64440 |
| 275 | Ga0307415_100108872 | 3300032126 | Bacteria | 2051 |
| 276 | Ga0307415_100109768 | 3300032126 | Bacteria | 2044 |
| 277 | Ga0316583_10002899 | 3300032133 | Bacteria | 6024 |
| 278 | Ga0316593_10007032 | 3300032168 | Bacteria | 3070 |
| 279 | Ga0307507_10056057 | 3300033179 | Bacteria | 3729 |
| 280 | Ga0307507_10081671 | 3300033179 | Bacteria | 2840 |
| 281 | Ga0316592_1014230 | 3300033524 | Bacteria | 1648 |
| 282 | Ga0316588_1009435 | 3300033528 | Bacteria | 2035 |
| 283 | Ga0316596_1004571 | 3300033541 | Bacteria | 3115 |
| 284 | Ga0373940_0019450 | 3300035088 | Bacteria | 1716 |
| 285 | Ga0373951_0000654 | 3300035091 | Bacteria | 9524 |
| 286 | Ga0373952_0002217 | 3300035092 | Bacteria | 3500 |
| 287 | Ga0373960_0018278 | 3300035121 | Bacteria | 1826 |
| 288 | Ga0373942_0000028 | 3300035207 | Bacteria | 26905 |
| 289 | Ga0373961_0005225 | 3300035241 | Bacteria | 3124 |
| 290 | Ga0373937_0261146 | 3300036401 | Bacteria | 1633 |
| 291 | Ga0395899_0009043 | 3300037312 | Bacteria | 7655 |
| 292 | Ga0395900_0003750 | 3300037418 | Bacteria | 16323 |
| 293 | Ga0395898_0021439 | 3300037466 | Bacteria | 6553 |
| 294 | Ga0395898_0060898 | 3300037466 | Bacteria | 3667 |
| 295 | Ga0395905_0050927 | 3300037471 | Bacteria | 3879 |
| 296 | Ga0395905_0088235 | 3300037471 | Bacteria | 2907 |
| 297 | Ga0316581_0035433 | 3300037588 | Bacteria | 1512 |
| 298 | Ga0436364_0821285 | 3300037853 | Bacteria | 6996 |
| 299 | Ga0436364_1328919 | 3300037853 | Bacteria | 8035 |
| 300 | Ga0395901_0004693 | 3300038443 | Bacteria | 13783 |
| 301 | Ga0436365_0093685 | 3300039437 | Bacteria | 33238 |
| 302 | Ga0436365_1730931 | 3300039437 | Bacteria | 2223 |
| 303 | Ga0436363_0003162 | 3300039450 | Bacteria | 2532 |
| 304 | Ga0451853_0639474 | 3300041512 | Bacteria | 3340 |
| 305 | Ga0439440_0016017 | 3300042993 | Bacteria | 1635 |
| 306 | Ga0466969_0066234 | 3300044656 | Bacteria | 1744 |
| 307 | Ga0466972_0032585 | 3300044658 | Bacteria | 2558 |
| 308 | Ga0466965_0021306 | 3300044683 | Bacteria | 3119 |
| 309 | Ga0466961_0153978 | 3300044693 | Bacteria | 1434 |
| 310 | Ga0466963_0005697 | 3300044694 | Bacteria | 7320 |
| 311 | Ga0466963_0020584 | 3300044694 | Bacteria | 4149 |
| 312 | Ga0466963_0093303 | 3300044694 | Bacteria | 2052 |
| 313 | Ga0466968_0092682 | 3300044735 | Bacteria | 1341 |
| 314 | Ga0466970_0006117 | 3300044765 | Bacteria | 5997 |
| 315 | Ga0466957_0014696 | 3300044842 | Bacteria | 4561 |
| 316 | Ga0466957_0064762 | 3300044842 | Bacteria | 2249 |
| 317 | Ga0466960_0014128 | 3300044901 | Bacteria | 3409 |
| 318 | Ga0466959_0002810 | 3300045049 | Bacteria | 11209 |
| 319 | Ga0466958_0026612 | 3300045836 | Bacteria | 3420 |
| 320 | Ga0466958_0069376 | 3300045836 | Bacteria | 2155 |
| 321 | Ga0466967_0022238 | 3300045976 | Bacteria | 5169 |
| 322 | Ga0466967_0031476 | 3300045976 | Bacteria | 4466 |
| 323 | Ga0466967_0063932 | 3300045976 | Bacteria | 3271 |
| 324 | Ga0466967_0081095 | 3300045976 | Bacteria | 2930 |
| 325 | Ga0466967_0235330 | 3300045976 | Bacteria | 1745 |
| 326 | Ga0466967_0396911 | 3300045976 | Bacteria | 1341 |
| 327 | Ga0495629_0039858 | 3300046459 | Bacteria | 3306 |
| 328 | Ga0495594_0033907 | 3300046499 | Bacteria | 2777 |
| 329 | Ga0495594_0123047 | 3300046499 | Bacteria | 1467 |
| 330 | Ga0495632_0030356 | 3300046519 | Bacteria | 2806 |
| 331 | Ga0495622_0052802 | 3300046557 | Bacteria | 1886 |
| 332 | Ga0495668_0000477 | 3300046616 | Bacteria | 50176 |
| 333 | Ga0495625_0000969 | 3300046660 | Bacteria | 38144 |
| 334 | Ga0495683_0060776 | 3300047323 | Bacteria | 1872 |
| 335 | Ga0495626_0000234 | 3300048091 | Bacteria | 65050 |
| 336 | Ga0496100_0062542 | 3300048903 | Bacteria | 2457 |
| 337 | Ga0496100_0101684 | 3300048903 | Bacteria | 1982 |
| 338 | Ga0496102_0031452 | 3300048905 | Bacteria | 4761 |
| 339 | Ga0496102_0185127 | 3300048905 | Bacteria | 1962 |
| 340 | Ga0496102_0272036 | 3300048905 | Bacteria | 1597 |
| 341 | Ga0496103_0105452 | 3300048906 | Bacteria | 1787 |
| 342 | Ga0496104_0014353 | 3300048907 | Bacteria | 7155 |
| 343 | Ga0496104_0026384 | 3300048907 | Bacteria | 5364 |
| 344 | Ga0496104_0028821 | 3300048907 | Bacteria | 5146 |
| 345 | Ga0496104_0158806 | 3300048907 | Bacteria | 2169 |
| 346 | Ga0496105_0122544 | 3300048908 | Bacteria | 2143 |
| 347 | Ga0496106_0053883 | 3300048909 | Bacteria | 3038 |
| 348 | Ga0496108_0000115 | 3300048911 | Bacteria | 79928 |
| 349 | Ga0496108_0016367 | 3300048911 | Bacteria | 6047 |
| 350 | Ga0496108_0016737 | 3300048911 | Bacteria | 5990 |
| 351 | Ga0496109_0007823 | 3300048912 | Bacteria | 9053 |
| 352 | Ga0496109_0018690 | 3300048912 | Bacteria | 6092 |
| 353 | Ga0496109_0168446 | 3300048912 | Bacteria | 2054 |
| 354 | Ga0496109_0219239 | 3300048912 | Bacteria | 1789 |
| 355 | Ga0496110_0007084 | 3300048913 | Bacteria | 8926 |
| 356 | Ga0496110_0029501 | 3300048913 | Bacteria | 4722 |
| 357 | Ga0496110_0051636 | 3300048913 | Bacteria | 3613 |
| 358 | Ga0496110_0174537 | 3300048913 | Bacteria | 1950 |
| 359 | Ga0496110_0192022 | 3300048913 | Bacteria | 1854 |
| 360 | Ga0496111_0001395 | 3300048914 | Bacteria | 13722 |
| 361 | Ga0496111_0126243 | 3300048914 | Bacteria | 1891 |
| 362 | Ga0496111_0153776 | 3300048914 | Bacteria | 1707 |
| 363 | Ga0496111_0162832 | 3300048914 | Bacteria | 1656 |
| 364 | Ga0496111_0202558 | 3300048914 | Bacteria | 1475 |
| 365 | Ga0496112_0088917 | 3300048915 | Bacteria | 3056 |
| 366 | Ga0496112_0207171 | 3300048915 | Bacteria | 1918 |
| 367 | Ga0496113_0061784 | 3300048916 | Bacteria | 2827 |
| 368 | Ga0496113_0167070 | 3300048916 | Bacteria | 1741 |
| 369 | Ga0496114_0023441 | 3300048917 | Bacteria | 5037 |
| 370 | Ga0496114_0093242 | 3300048917 | Bacteria | 2560 |
| 371 | Ga0496114_0140099 | 3300048917 | Bacteria | 2093 |
| 372 | Ga0496115_0003853 | 3300048918 | Bacteria | 10815 |
| 373 | Ga0496119_0000521 | 3300048922 | Bacteria | 52243 |
| 374 | Ga0496120_0006138 | 3300048923 | Bacteria | 9319 |
| 375 | Ga0496121_0002251 | 3300048924 | Bacteria | 30080 |
| 376 | Ga0496126_0093024 | 3300048929 | Bacteria | 2648 |
| 377 | Ga0496126_0130095 | 3300048929 | Bacteria | 2176 |
| 378 | Ga0501033_0238099 | 3300049570 | Bacteria | 1292 |
| 379 | Ga0501034_0070497 | 3300049571 | Bacteria | 3506 |
| 380 | Ga0501037_0034593 | 3300049573 | Bacteria | 3728 |
| 381 | Ga0501037_0131476 | 3300049573 | Bacteria | 1795 |
| 382 | Ga0501038_0090748 | 3300049574 | Bacteria | 2560 |
| 383 | Ga0501039_0177609 | 3300049575 | Bacteria | 1674 |
| 384 | Ga0501039_0246566 | 3300049575 | Bacteria | 1405 |
| 385 | Ga0501040_0280528 | 3300049576 | Bacteria | 1190 |
| 386 | Ga0501047_0074441 | 3300049581 | Bacteria | 3269 |
| 387 | Ga0501070_0019599 | 3300049586 | Bacteria | 5671 |
| 388 | Ga0501070_0021481 | 3300049586 | Bacteria | 5415 |
| 389 | Ga0501070_0113159 | 3300049586 | Bacteria | 2243 |
| 390 | Ga0501071_0137296 | 3300049587 | Bacteria | 1820 |
| 391 | Ga0501073_0035058 | 3300049589 | Bacteria | 3567 |
| 392 | Ga0501074_0000891 | 3300049590 | Bacteria | 19075 |
| 393 | Ga0501079_0104141 | 3300049741 | Bacteria | 2201 |
| 394 | Ga0501079_0149433 | 3300049741 | Bacteria | 1821 |
| 395 | Ga0501080_0132391 | 3300049742 | Bacteria | 2308 |
| 396 | Ga0501080_0151147 | 3300049742 | Bacteria | 2146 |
| 397 | Ga0501080_0235103 | 3300049742 | Bacteria | 1674 |
| 398 | Ga0501044_0026450 | 3300049823 | Bacteria | 6140 |
| 399 | Ga0501045_0183217 | 3300049824 | Bacteria | 1560 |
| 400 | nmdc:mga0yw44_12141_c1 | 3300050492 | Bacteria | 4478 |
| 401 | nmdc:mga06z11_42646_c1 | 3300050494 | Bacteria | 2277 |
| 402 | nmdc:mga05p37_161124_c1 | 3300050507 | Bacteria | 2740 |
| 403 | nmdc:mga05p37_54302_c1 | 3300050507 | Bacteria | 4929 |
| 404 | nmdc:mga09592_112248_c1 | 3300050508 | Bacteria | 2338 |
| 405 | nmdc:mga09592_217813_c1 | 3300050508 | Bacteria | 1654 |
| 406 | nmdc:mga09592_7011_c1 | 3300050508 | Bacteria | 9162 |
| 407 | nmdc:mga0qj67_181294_c1 | 3300050509 | Bacteria | 1710 |
| 408 | nmdc:mga06r32_108986_c1 | 3300050510 | Bacteria | 2723 |
| 409 | nmdc:mga06r32_164916_c1 | 3300050510 | Bacteria | 2198 |
| 410 | nmdc:mga06r32_183671_c1 | 3300050510 | Bacteria | 2078 |
| 411 | nmdc:mga08y16_10450_c1 | 3300050511 | Bacteria | 9738 |
| 412 | nmdc:mga08y16_65543_c1 | 3300050511 | Bacteria | 3792 |
| 413 | nmdc:mga0n895_17176_c1 | 3300050512 | Bacteria | 6667 |
| 414 | nmdc:mga0n895_265692_c1 | 3300050512 | Bacteria | 1741 |
| 415 | nmdc:mga0rr50_11903_c1 | 3300050513 | Bacteria | 5593 |
| 416 | nmdc:mga0rr50_49001_c1 | 3300050513 | Bacteria | 3126 |
| 417 | nmdc:mga08x19_219631_c1 | 3300050514 | Bacteria | 1306 |
| 418 | nmdc:mga08x19_7720_c1 | 3300050514 | Bacteria | 6389 |
| 419 | Ga0495619_0049476 | 3300053085 | Bacteria | 2772 |
| 420 | Ga0495619_0104133 | 3300053085 | Bacteria | 1934 |
| 421 | Ga0500643_000457 | 3300053087 | Bacteria | 30222 |
| 422 | Ga0500646_0000067 | 3300053090 | Bacteria | 29313 |
| 423 | Ga0500646_0000160 | 3300053090 | Bacteria | 19918 |
| 424 | Ga0500646_0026442 | 3300053090 | Bacteria | 1573 |
| 425 | Ga0500651_0019868 | 3300053093 | Bacteria | 4180 |
| 426 | Ga0500641_0028423 | 3300053096 | Bacteria | 2184 |
| 427 | Ga0500641_0123879 | 3300053096 | Bacteria | 1114 |
| 428 | Ga0500652_014834 | 3300053131 | Bacteria | 2797 |
| 429 | Ga0500579_100422 | 3300053143 | Bacteria | 1511 |
| 430 | Ga0501084_0034999 | 3300054114 | Bacteria | 4199 |
| 431 | Ga0501084_0234264 | 3300054114 | Bacteria | 1550 |
| 432 | Ga0466962_0021658 | 3300061719 | Bacteria | 3085 |
| 433 | 2501942791 | 2501939600 | Bacteria | 6907073 |
| 434 | 2501944794 | 2501939600 | Bacteria | 6907073 |
| 435 | 2623587988 | 2622736626 | Bacteria | 7181580 |
| 436 | 2676487073 | 2675903059 | Bacteria | 8644972 |
| 437 | 2772641587 | 2772190715 | Bacteria | 6959372 |
| 438 | 2772643621 | 2772190715 | Bacteria | 6959372 |
| 439 | 2831936641 | 2831935698 | Bacteria | 5963223 |
| 440 | 2855672163 | 2855670206 | Bacteria | 7120389 |
| 441 | 2855675211 | 2855670206 | Bacteria | 7120389 |
| 442 | 2855681989 | 2855676851 | Bacteria | 7063653 |
| 443 | 2855682790 | 2855676851 | Bacteria | 7063653 |
| 444 | 2855686411 | 2855683550 | Bacteria | 7134265 |
| 445 | 2855686835 | 2855683550 | Bacteria | 7134265 |
| 446 | 2856862015 | 2856858025 | Bacteria | 7255264 |
| 447 | 2856863709 | 2856858025 | Bacteria | 7255264 |
| 448 | 2857292913 | 2857288857 | Bacteria | 7189066 |
| 449 | 2857294748 | 2857288857 | Bacteria | 7189066 |
| 450 | 2858850042 | 2858848962 | Bacteria | 6963058 |
| 451 | 2858854413 | 2858848962 | Bacteria | 6963058 |
| 452 | 2858874865 | 2858868258 | Bacteria | 7683772 |
| 453 | 2858883445 | 2858882152 | Bacteria | 7230291 |
| 454 | 2858888472 | 2858882152 | Bacteria | 7230291 |
| 455 | 2858891775 | 2858888857 | Bacteria | 7060307 |
| 456 | 2858893828 | 2858888857 | Bacteria | 7060307 |
| 457 | 2858899238 | 2858895516 | Bacteria | 7378898 |
| 458 | 2858899374 | 2858895516 | Bacteria | 7378898 |
| 459 | 2867307813 | 2867302475 | Bacteria | 7087181 |
| 460 | 2867319128 | 2867312974 | Bacteria | 7058875 |
| 461 | 2867320133 | 2867319477 | Bacteria | 7069771 |
| 462 | 2868093261 | 2868088558 | Bacteria | 7609351 |
| 463 | 2869054139 | 2869048445 | Bacteria | 6875584 |
| 464 | 2869066103 | 2869061728 | Bacteria | 7112407 |
| 465 | 2869066663 | 2869061728 | Bacteria | 7112407 |
| 466 | 2869070749 | 2869068681 | Bacteria | 7205615 |
| 467 | 2869074118 | 2869068681 | Bacteria | 7205615 |
| 468 | 2880492072 | 2880489317 | Bacteria | 7096270 |
| 469 | 2880498505 | 2880495981 | Bacteria | 7340502 |
| 470 | 2880500226 | 2880495981 | Bacteria | 7340502 |
| 471 | 2887486835 | 2887478801 | Bacteria | 8972725 |
| 472 | 2902586689 | 2902582711 | Bacteria | 6187705 |
| 473 | 2929222119 | 2929219909 | Bacteria | 6984360 |
| 474 | 2929227091 | 2929226422 | Bacteria | 7248583 |
| 475 | 2929228777 | 2929226422 | Bacteria | 7248583 |
| 476 | 2946033834 | 2946033335 | Bacteria | 3835514 |
| 477 | 2996227943 | 2996221748 | Bacteria | 6799777 |
| 478 | 649812615 | 649633069 | Bacteria | 6962533 |
| 479 | 649814533 | 649633069 | Bacteria | 6962533 |
| 480 | 8001786836 | 8001781756 | Bacteria | 9586736 |
| 481 | 8003837105 | 8003830390 | Bacteria | 6541657 |
| 482 | 8003860393 | 8003856774 | Bacteria | 7675274 |
| 483 | 8003878109 | 8003870546 | Bacteria | 7396674 |
| 484 | 8054707125 | 8054704163 | Bacteria | 7247792 |
| 485 | 8054710204 | 8054704163 | Bacteria | 7247792 |
| 486 | 8054731054 | 8054727385 | Bacteria | 7558670 |
| 487 | 8054731788 | 8054727385 | Bacteria | 7558670 |
| 488 | 8054735186 | 8054734606 | Bacteria | 6947278 |
| 489 | 8054738344 | 8054734606 | Bacteria | 6947278 |
| 490 | 8055416121 | 8055412473 | Bacteria | 6257500 |
| 491 | 8057568568 | 8057568493 | Bacteria | 7221719 |
| 492 | Ga0206353_10449420 | |||
| 493 | JGI25406J46586_10029948 | |||
| 494 | JGI25407J50210_10011742 | |||
| 495 | Ga0007427J51700_103889 | |||
| 496 | Ga0070658_10000155 | |||
| 497 | Ga0070670_100135587 | |||
| 498 | Ga0068869_100029053 | |||
| 499 | Ga0070666_10069597 | |||
| 500 | Ga0070680_100037247 | |||
| 501 | Ga0070680_100071705 | |||
| 502 | Ga0070680_100123799 | |||
| 503 | Ga0070682_100032467 | |||
| 504 | Ga0068868_100004213 | |||
| 505 | Ga0068868_100007824 | |||
| 506 | Ga0068868_100020963 | |||
| 507 | Ga0070660_100053517 | |||
| 508 | Ga0070689_100114231 | |||
| 509 | Ga0070691_10001177 | |||
| 510 | Ga0070661_100021232 | |||
| 511 | Ga0070661_100043884 | |||
| 512 | Ga0070692_10051312 | |||
| 513 | Ga0070669_100037629 | |||
| 514 | Ga0070675_100017004 | |||
| 515 | Ga0070675_100079739 | |||
| 516 | Ga0070671_100002713 | |||
| 517 | Ga0070688_100155594 | |||
| 518 | Ga0070659_100038921 | |||
| 519 | Ga0070667_100014986 | |||
| 520 | Ga0070667_100207366 | |||
| 521 | Ga0070709_10164481 | |||
| 522 | Ga0070714_100263200 | |||
| 523 | Ga0070710_10065621 | |||
| 524 | Ga0070711_100025960 | |||
| 525 | Ga0070705_100033674 | |||
| 526 | Ga0070705_100056907 | |||
| 527 | Ga0070700_100052970 | |||
| 528 | Ga0070694_100032516 | |||
| 529 | Ga0070708_100005557 | |||
| 530 | Ga0070663_100050920 | |||
| 531 | Ga0070678_100017670 | |||
| 532 | Ga0070662_100013742 | |||
| 533 | Ga0070681_10066947 | |||
| 534 | Ga0070681_10168363 | |||
| 535 | Ga0070685_10100702 | |||
| 536 | Ga0070706_100016465 | |||
| 537 | Ga0070706_100030801 | |||
| 538 | Ga0070707_100002888 | |||
| 539 | Ga0070707_100086721 | |||
| 540 | Ga0070679_100031607 | |||
| 541 | Ga0070679_100034415 | |||
| 542 | Ga0070684_100023795 | |||
| 543 | Ga0070684_100111449 | |||
| 544 | Ga0070697_100141613 | |||
| 545 | Ga0068853_100100890 | |||
| 546 | Ga0070695_100037879 | |||
| 547 | Ga0070696_100008782 | |||
| 548 | Ga0070693_100063728 | |||
| 549 | Ga0070704_100132440 | |||
| 550 | Ga0068855_100028889 | |||
| 551 | Ga0068855_100035705 | |||
| 552 | Ga0068855_100122244 | |||
| 553 | Ga0070664_100011541 | |||
| 554 | Ga0070664_100065602 | |||
| 555 | Ga0068854_100068130 | |||
| 556 | Ga0068856_100263612 | |||
| 557 | Ga0070702_100018873 | |||
| 558 | Ga0070702_100059422 | |||
| 559 | Ga0068864_100037652 | |||
| 560 | Ga0068864_100049993 | |||
| 561 | Ga0068864_100097845 | |||
| 562 | Ga0068864_100196241 | |||
| 563 | Ga0068861_100062463 | |||
| 564 | Ga0068851_10031107 | |||
| 565 | Ga0068870_10000071 | |||
| 566 | Ga0068870_10133917 | |||
| 567 | Ga0068863_100006202 | |||
| 568 | Ga0068863_100129014 | |||
| 569 | Ga0068863_100162764 | |||
| 570 | Ga0068863_100204199 | |||
| 571 | Ga0068863_100221379 | |||
| 572 | Ga0068858_100049748 | |||
| 573 | Ga0068858_100091164 | |||
| 574 | Ga0068860_100000696 | |||
| 575 | Ga0068860_100216133 | |||
| 576 | Ga0068862_100148141 | |||
| 577 | Ga0081455_10009481 | |||
| 578 | Ga0081455_10101636 | |||
| 579 | Ga0081538_10003212 | |||
| 580 | Ga0081540_1002024 | |||
| 581 | Ga0081540_1002336 | |||
| 582 | Ga0081540_1028714 | |||
| 583 | Ga0081540_1035544 | |||
| 584 | Ga0081540_1037843 | |||
| 585 | Ga0081539_10001256 | |||
| 586 | Ga0081539_10008632 | |||
| 587 | Ga0070717_10054407 | |||
| 588 | Ga0075364_10032964 | |||
| 589 | Ga0070716_100007596 | |||
| 590 | Ga0070712_100016810 | |||
| 591 | Ga0075362_10058102 | |||
| 592 | Ga0075367_10062290 | |||
| 593 | Ga0097621_100039185 | |||
| 594 | Ga0097621_100061317 | |||
| 595 | Ga0075370_10014738 | |||
| 596 | Ga0068871_100037288 | |||
| 597 | Ga0075428_100000548 | |||
| 598 | Ga0075428_100013258 | |||
| 599 | Ga0075428_100180559 | |||
| 600 | Ga0075430_100001669 | |||
| 601 | Ga0075431_100067857 | |||
| 602 | Ga0075433_10004261 | |||
| 603 | Ga0075433_10112437 | |||
| 604 | Ga0075434_100061910 | |||
| 605 | Ga0075429_100008206 | |||
| 606 | Ga0075436_100013244 | |||
| 607 | Ga0075436_100104504 | |||
| 608 | Ga0075435_100011752 | |||
| 609 | Ga0075435_100017819 | |||
| 610 | Ga0075435_100037946 | |||
| 611 | Ga0105251_10019066 | |||
| 612 | Ga0105251_10085020 | |||
| 613 | Ga0105240_10025288 | |||
| 614 | Ga0105240_10046325 | |||
| 615 | Ga0105240_10241506 | |||
| 616 | Ga0111539_10002078 | |||
| 617 | Ga0105245_10010790 | |||
| 618 | Ga0105245_10138499 | |||
| 619 | Ga0114129_10026954 | |||
| 620 | Ga0114129_10068551 | |||
| 621 | Ga0114129_10112387 | |||
| 622 | Ga0105243_10021460 | |||
| 623 | Ga0105241_10004726 | |||
| 624 | Ga0105241_10050833 | |||
| 625 | Ga0105241_10113572 | |||
| 626 | Ga0105242_10056072 | |||
| 627 | Ga0105248_10074502 | |||
| 628 | Ga0105248_10096019 | |||
| 629 | Ga0105237_10367808 | |||
| 630 | Ga0105238_10011506 | |||
| 631 | Ga0105238_10198471 | |||
| 632 | Ga0105032_100820 | |||
| 633 | Ga0105246_10000478 | |||
| 634 | Ga0105246_10011011 | |||
| 635 | Ga0157373_10044187 | |||
| 636 | Ga0157371_10095214 | |||
| 637 | Ga0157370_10029838 | |||
| 638 | Ga0157374_10123603 | |||
| 639 | Ga0157374_10262748 | |||
| 640 | Ga0157378_10126219 | |||
| 641 | Ga0157372_10087968 | |||
| 642 | Ga0157372_10292662 | |||
| 643 | Ga0157375_10043146 | |||
| 644 | Ga0163163_10009000 | |||
| 645 | Ga0163163_10088919 | |||
| 646 | Ga0163163_10102614 | |||
| 647 | Ga0157377_10012177 | |||
| 648 | Ga0157379_10045611 | |||
| 649 | Ga0157376_10217435 | |||
| 650 | Ga0206349_1115733 | |||
| 651 | Ga0206353_11895285 | |||
| 652 | Ga0213876_10001219 | |||
| 653 | Ga0224712_10004370 | |||
| 654 | Ga0224712_10075717 | |||
| 655 | Ga0207710_10008848 | |||
| 656 | Ga0207688_10029958 | |||
| 657 | Ga0207688_10121434 | |||
| 658 | Ga0207680_10093628 | |||
| 659 | Ga0207680_10148750 | |||
| 660 | Ga0207643_10000102 | |||
| 661 | Ga0207705_10001837 | |||
| 662 | Ga0207705_10033090 | |||
| 663 | Ga0207705_10041673 | |||
| 664 | Ga0207705_10057885 | |||
| 665 | Ga0207705_10251350 | |||
| 666 | Ga0207684_10006321 | |||
| 667 | Ga0207654_10064344 | |||
| 668 | Ga0207707_10036826 | |||
| 669 | Ga0207707_10047880 | |||
| 670 | Ga0207707_10210981 | |||
| 671 | Ga0207695_10003124 | |||
| 672 | Ga0207695_10027858 | |||
| 673 | Ga0207695_10101759 | |||
| 674 | Ga0207671_10028477 | |||
| 675 | Ga0207671_10184247 | |||
| 676 | Ga0207693_10001971 | |||
| 677 | Ga0207660_10013362 | |||
| 678 | Ga0207660_10015363 | |||
| 679 | Ga0207660_10124224 | |||
| 680 | Ga0207657_10058913 | |||
| 681 | Ga0207657_10059520 | |||
| 682 | Ga0207649_10008342 | |||
| 683 | Ga0207649_10063227 | |||
| 684 | Ga0207652_10019773 | |||
| 685 | Ga0207652_10082159 | |||
| 686 | Ga0207652_10117570 | |||
| 687 | Ga0207646_10037562 | |||
| 688 | Ga0207646_10075659 | |||
| 689 | Ga0207694_10005907 | |||
| 690 | Ga0207650_10003132 | |||
| 691 | Ga0207659_10010653 | |||
| 692 | Ga0207687_10006095 | |||
| 693 | Ga0207687_10031041 | |||
| 694 | Ga0207687_10208763 | |||
| 695 | Ga0207700_10170528 | |||
| 696 | Ga0207644_10046743 | |||
| 697 | Ga0207706_10065001 | |||
| 698 | Ga0207709_10074532 | |||
| 699 | Ga0207670_10012052 | |||
| 700 | Ga0207670_10078860 | |||
| 701 | Ga0207704_10066731 | |||
| 702 | Ga0207665_10002513 | |||
| 703 | Ga0207711_10120505 | |||
| 704 | Ga0207689_10014046 | |||
| 705 | Ga0207689_10041116 | |||
| 706 | Ga0207661_10009298 | |||
| 707 | Ga0207661_10010323 | |||
| 708 | Ga0207679_10019242 | |||
| 709 | Ga0207667_10074145 | |||
| 710 | Ga0207667_10454046 | |||
| 711 | Ga0207712_10216838 | |||
| 712 | Ga0207668_10002345 | |||
| 713 | Ga0207668_10031935 | |||
| 714 | Ga0207640_10031185 | |||
| 715 | Ga0207658_10020723 | |||
| 716 | Ga0207677_10007428 | |||
| 717 | Ga0207703_10090243 | |||
| 718 | Ga0207678_10000163 | |||
| 719 | Ga0207678_10002103 | |||
| 720 | Ga0207678_10150783 | |||
| 721 | Ga0207708_10009183 | |||
| 722 | Ga0207708_10018977 | |||
| 723 | Ga0207702_10000567 | |||
| 724 | Ga0207641_10008900 | |||
| 725 | Ga0207641_10107262 | |||
| 726 | Ga0207641_10167936 | |||
| 727 | Ga0207676_10000814 | |||
| 728 | Ga0207676_10035860 | |||
| 729 | Ga0207676_10059729 | |||
| 730 | Ga0207674_10066533 | |||
| 731 | Ga0207675_100034673 | |||
| 732 | Ga0207683_10001761 | |||
| 733 | Ga0207683_10002042 | |||
| 734 | Ga0207428_10015137 | |||
| 735 | Ga0207428_10067151 | |||
| 736 | Ga0268265_10021181 | |||
| 737 | Ga0268264_10000697 | |||
| 738 | Ga0268264_10144765 | |||
| 739 | Ga0307515_10000182 | |||
| 740 | Ga0307515_10007109 | |||
| 741 | Ga0307515_10049070 | |||
| 742 | Ga0307515_10282072 | |||
| 743 | Ga0307512_10009848 | |||
| 744 | Ga0307512_10023837 | |||
| 745 | Ga0307513_10030700 | |||
| 746 | Ga0307513_10037395 | |||
| 747 | Ga0307509_10043119 | |||
| 748 | Ga0307408_100089882 | |||
| 749 | Ga0307508_10001109 | |||
| 750 | Ga0316576_10000137 | |||
| 751 | Ga0316576_10006220 | |||
| 752 | Ga0307516_10000395 | |||
| 753 | Ga0307516_10007781 | |||
| 754 | Ga0307405_10005963 | |||
| 755 | Ga0307405_10061034 | |||
| 756 | Ga0307410_10125691 | |||
| 757 | Ga0307406_10002243 | |||
| 758 | Ga0307406_10005185 | |||
| 759 | Ga0307409_100000570 | |||
| 760 | Ga0307409_100187515 | |||
| 761 | Ga0307416_100063011 | |||
| 762 | Ga0307416_100341315 | |||
| 763 | Ga0307411_10174417 | |||
| 764 | Ga0307411_10176793 | |||
| 765 | Ga0307415_100000023 | |||
| 766 | Ga0307415_100108872 | |||
| 767 | Ga0307415_100109768 | |||
| 768 | Ga0316583_10002899 | |||
| 769 | Ga0316593_10007032 | |||
| 770 | Ga0307507_10056057 | |||
| 771 | Ga0307507_10081671 | |||
| 772 | Ga0316592_1014230 | |||
| 773 | Ga0316588_1009435 | |||
| 774 | Ga0316596_1004571 | |||
| 775 | Ga0373940_0019450 | |||
| 776 | Ga0373951_0000654 | |||
| 777 | Ga0373952_0002217 | |||
| 778 | Ga0373960_0018278 | |||
| 779 | Ga0373942_0000028 | |||
| 780 | Ga0373961_0005225 | |||
| 781 | Ga0373937_0261146 | |||
| 782 | Ga0395899_0009043 | |||
| 783 | Ga0395900_0003750 | |||
| 784 | Ga0395898_0021439 | |||
| 785 | Ga0395898_0060898 | |||
| 786 | Ga0395905_0050927 | |||
| 787 | Ga0395905_0088235 | |||
| 788 | Ga0316581_0035433 | |||
| 789 | Ga0436364_0821285 | |||
| 790 | Ga0436364_1328919 | |||
| 791 | Ga0395901_0004693 | |||
| 792 | Ga0436365_0093685 | |||
| 793 | Ga0436365_1730931 | |||
| 794 | Ga0436363_0003162 | |||
| 795 | Ga0451853_0639474 | |||
| 796 | Ga0439440_0016017 | |||
| 797 | Ga0466969_0066234 | |||
| 798 | Ga0466972_0032585 | |||
| 799 | Ga0466965_0021306 | |||
| 800 | Ga0466961_0153978 | |||
| 801 | Ga0466963_0005697 | |||
| 802 | Ga0466963_0020584 | |||
| 803 | Ga0466963_0093303 | |||
| 804 | Ga0466968_0092682 | |||
| 805 | Ga0466970_0006117 | |||
| 806 | Ga0466957_0014696 | |||
| 807 | Ga0466957_0064762 | |||
| 808 | Ga0466960_0014128 | |||
| 809 | Ga0466959_0002810 | |||
| 810 | Ga0466958_0026612 | |||
| 811 | Ga0466958_0069376 | |||
| 812 | Ga0466967_0022238 | |||
| 813 | Ga0466967_0031476 | |||
| 814 | Ga0466967_0063932 | |||
| 815 | Ga0466967_0081095 | |||
| 816 | Ga0466967_0235330 | |||
| 817 | Ga0466967_0396911 | |||
| 818 | Ga0495629_0039858 | |||
| 819 | Ga0495594_0033907 | |||
| 820 | Ga0495594_0123047 | |||
| 821 | Ga0495632_0030356 | |||
| 822 | Ga0495622_0052802 | |||
| 823 | Ga0495668_0000477 | |||
| 824 | Ga0495625_0000969 | |||
| 825 | Ga0495683_0060776 | |||
| 826 | Ga0495626_0000234 | |||
| 827 | Ga0496100_0062542 | |||
| 828 | Ga0496100_0101684 | |||
| 829 | Ga0496102_0031452 | |||
| 830 | Ga0496102_0185127 | |||
| 831 | Ga0496102_0272036 | |||
| 832 | Ga0496103_0105452 | |||
| 833 | Ga0496104_0014353 | |||
| 834 | Ga0496104_0026384 | |||
| 835 | Ga0496104_0028821 | |||
| 836 | Ga0496104_0158806 | |||
| 837 | Ga0496105_0122544 | |||
| 838 | Ga0496106_0053883 | |||
| 839 | Ga0496108_0000115 | |||
| 840 | Ga0496108_0016367 | |||
| 841 | Ga0496108_0016737 | |||
| 842 | Ga0496109_0007823 | |||
| 843 | Ga0496109_0018690 | |||
| 844 | Ga0496109_0168446 | |||
| 845 | Ga0496109_0219239 | |||
| 846 | Ga0496110_0007084 | |||
| 847 | Ga0496110_0029501 | |||
| 848 | Ga0496110_0051636 | |||
| 849 | Ga0496110_0174537 | |||
| 850 | Ga0496110_0192022 | |||
| 851 | Ga0496111_0001395 | |||
| 852 | Ga0496111_0126243 | |||
| 853 | Ga0496111_0153776 | |||
| 854 | Ga0496111_0162832 | |||
| 855 | Ga0496111_0202558 | |||
| 856 | Ga0496112_0088917 | |||
| 857 | Ga0496112_0207171 | |||
| 858 | Ga0496113_0061784 | |||
| 859 | Ga0496113_0167070 | |||
| 860 | Ga0496114_0023441 | |||
| 861 | Ga0496114_0093242 | |||
| 862 | Ga0496114_0140099 | |||
| 863 | Ga0496115_0003853 | |||
| 864 | Ga0496119_0000521 | |||
| 865 | Ga0496120_0006138 | |||
| 866 | Ga0496121_0002251 | |||
| 867 | Ga0496126_0093024 | |||
| 868 | Ga0496126_0130095 | |||
| 869 | Ga0501033_0238099 | |||
| 870 | Ga0501034_0070497 | |||
| 871 | Ga0501037_0034593 | |||
| 872 | Ga0501037_0131476 | |||
| 873 | Ga0501038_0090748 | |||
| 874 | Ga0501039_0177609 | |||
| 875 | Ga0501039_0246566 | |||
| 876 | Ga0501040_0280528 | |||
| 877 | Ga0501047_0074441 | |||
| 878 | Ga0501070_0019599 | |||
| 879 | Ga0501070_0021481 | |||
| 880 | Ga0501070_0113159 | |||
| 881 | Ga0501071_0137296 | |||
| 882 | Ga0501073_0035058 | |||
| 883 | Ga0501074_0000891 | |||
| 884 | Ga0501079_0104141 | |||
| 885 | Ga0501079_0149433 | |||
| 886 | Ga0501080_0132391 | |||
| 887 | Ga0501080_0151147 | |||
| 888 | Ga0501080_0235103 | |||
| 889 | Ga0501044_0026450 | |||
| 890 | Ga0501045_0183217 | |||
| 891 | nmdc:mga0yw44_12141_c1 | |||
| 892 | nmdc:mga06z11_42646_c1 | |||
| 893 | nmdc:mga05p37_161124_c1 | |||
| 894 | nmdc:mga05p37_54302_c1 | |||
| 895 | nmdc:mga09592_112248_c1 | |||
| 896 | nmdc:mga09592_217813_c1 | |||
| 897 | nmdc:mga09592_7011_c1 | |||
| 898 | nmdc:mga0qj67_181294_c1 | |||
| 899 | nmdc:mga06r32_108986_c1 | |||
| 900 | nmdc:mga06r32_164916_c1 | |||
| 901 | nmdc:mga06r32_183671_c1 | |||
| 902 | nmdc:mga08y16_10450_c1 | |||
| 903 | nmdc:mga08y16_65543_c1 | |||
| 904 | nmdc:mga0n895_17176_c1 | |||
| 905 | nmdc:mga0n895_265692_c1 | |||
| 906 | nmdc:mga0rr50_11903_c1 | |||
| 907 | nmdc:mga0rr50_49001_c1 | |||
| 908 | nmdc:mga08x19_219631_c1 | |||
| 909 | nmdc:mga08x19_7720_c1 | |||
| 910 | Ga0495619_0049476 | |||
| 911 | Ga0495619_0104133 | |||
| 912 | Ga0500643_000457 | |||
| 913 | Ga0500646_0000067 | |||
| 914 | Ga0500646_0000160 | |||
| 915 | Ga0500646_0026442 | |||
| 916 | Ga0500651_0019868 | |||
| 917 | Ga0500641_0028423 | |||
| 918 | Ga0500641_0123879 | |||
| 919 | Ga0500652_014834 | |||
| 920 | Ga0500579_100422 | |||
| 921 | Ga0501084_0034999 | |||
| 922 | Ga0501084_0234264 | |||
| 923 | Ga0466962_0021658 | |||
| 924 | 2501942791 | |||
| 925 | 2501944794 | |||
| 926 | 2623587988 | |||
| 927 | 2676487073 | |||
| 928 | 2772641587 | |||
| 929 | 2772643621 | |||
| 930 | 2831936641 | |||
| 931 | 2855672163 | |||
| 932 | 2855675211 | |||
| 933 | 2855681989 | |||
| 934 | 2855682790 | |||
| 935 | 2855686411 | |||
| 936 | 2855686835 | |||
| 937 | 2856862015 | |||
| 938 | 2856863709 | |||
| 939 | 2857292913 | |||
| 940 | 2857294748 | |||
| 941 | 2858850042 | |||
| 942 | 2858854413 | |||
| 943 | 2858874865 | |||
| 944 | 2858883445 | |||
| 945 | 2858888472 | |||
| 946 | 2858891775 | |||
| 947 | 2858893828 | |||
| 948 | 2858899238 | |||
| 949 | 2858899374 | |||
| 950 | 2867307813 | |||
| 951 | 2867319128 | |||
| 952 | 2867320133 | |||
| 953 | 2868093261 | |||
| 954 | 2869054139 | |||
| 955 | 2869066103 | |||
| 956 | 2869066663 | |||
| 957 | 2869070749 | |||
| 958 | 2869074118 | |||
| 959 | 2880492072 | |||
| 960 | 2880498505 | |||
| 961 | 2880500226 | |||
| 962 | 2887486835 | |||
| 963 | 2902586689 | |||
| 964 | 2929222119 | |||
| 965 | 2929227091 | |||
| 966 | 2929228777 | |||
| 967 | 2946033834 | |||
| 968 | 2996227943 | |||
| 969 | 649812615 | |||
| 970 | 649814533 | |||
| 971 | 8001786836 | |||
| 972 | 8003837105 | |||
| 973 | 8003860393 | |||
| 974 | 8003878109 | |||
| 975 | 8054707125 | |||
| 976 | 8054710204 | |||
| 977 | 8054731054 | |||
| 978 | 8054731788 | |||
| 979 | 8054735186 | |||
| 980 | 8054738344 | |||
| 981 | 8055416121 | |||
| 982 | 8057568568 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h9u-assembly1.cif.gz_D | crystal structure of a thermostable methionine adenosyltransferase | 0.8928 | 2 | 384 |
| 5h9u-assembly1.cif.gz_D | crystal structure of a thermostable methionine adenosyltransferase | 0.8883 | 2 | 384 |
| 5t8s-assembly1.cif.gz_A | crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium | 0.887 | 2 | 383 |
| 5t8t-assembly1.cif.gz_A | crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound amp and magnesium | 0.8815 | 2 | 383 |
| 7low-assembly1.cif.gz_B | s-adenosylmethionine synthetase | 0.8808 | 2 | 384 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58EF9_292_361_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9869 | 273 | 338 | 3.30.300.10 |
| af_Q2G1W4_138_246_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9465 | 125 | 233 | 3.30.300.10 |
| af_P9WGV1_16_125_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9453 | 19 | 108 | 3.30.300.10 |
| af_Q2G1W4_138_246_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9298 | 125 | 233 | 3.30.300.10 |
| af_Q2G1W4_285_396_3.30.300.10 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9233 | 273 | 382 | 3.30.300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1E018-F1-model_v4 | Methionine adenosyltransferase | 0.9669 | 19 | 201 |
GO:0004478
GO:0005524 GO:0006556 GO:0046872 |
| AF-A0A355BID4-F1-model_v4 | Methionine adenosyltransferase (EC 2.5.1.6) | 0.9649 | 25 | 144 |
GO:0004478
GO:0005524 GO:0006556 GO:0046872 |
| AF-A0A6B3IRJ1-F1-model_v4 | Methionine adenosyltransferase (EC 2.5.1.6) | 0.9647 | 19 | 239 |
GO:0004478
GO:0005524 GO:0006556 GO:0046872 |
| AF-A0A7G3D859-F1-model_v4 | deleted | 0.9638 | 19 | 143 |
|
| AF-W7PNX6-F1-model_v4 | S-adenosylmethionine synthetase N-terminal domain-containing protein | 0.9634 | 28 | 96 |
GO:0004478
GO:0005524 GO:0006556 GO:0046872 |