F454107

General Info

Members Datasets Scaffolds Average Seq Length
491 306 982 385

Family's Representative Sequence

Representative Sequence 3300020082|Ga0206353_10449420|Ga0206353_104494202
Length 386
Sequence MPRRLFTSESVTEGHPDKIPAARVAVETMITTGQVHVAGEVTTSAYADIATLVRGKILEIGYDSSKKGFDGASCGVSVSIGAQSPDIAQGVDGAYGQRAAETADELDRQGAGDQGLMFGYASDETPELMPVPITLAHRLAHRLSAVRKNGTIPYLRPDGKTQVTIEYAGDRAVRLDTVVVSSQHASDIDLDSLLAPDVRQFVVEPELGALLDDGIKLDTDGYRLLVNPTGRFEIGGPMGDAGLTGRKIIIDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNVVAAGLAARCEVQVAYAIGKAEPVGLFVETFGTETVAAERIEAAIGEVFDLRPAAIIRDLDLLRPIYAQTAAYGHFGRELPDFTWERTDRIDALKAAAGL

Samples

Sample ID Description Type Environment
1 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
157 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
172 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
174 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
181 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
260 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
263 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
264 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
267 2501939600 Micromonospora sp. L5 Isolate Unclassified
268 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
269 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
270 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
271 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
272 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
273 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
274 2855683550 Micromonospora sp. RP3T Isolate Unclassified
275 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
276 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
277 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
278 2858868258 Micromonospora sp. MH33 Isolate Unclassified
279 2858882152 Micromonospora noduli MED15 Isolate Nodule
280 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
281 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
282 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
283 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
284 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
285 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
286 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
287 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
288 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
289 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
290 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
291 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
292 2902582711 Micromonospora sp. AP08 Isolate Unclassified
293 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
294 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
295 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
296 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
297 649633069 Micromonospora sp. L5 Isolate Unclassified
298 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
299 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
300 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
301 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
302 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
303 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
304 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
305 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
306 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.95
Metatranscriptomes 2.04
Isolates 12.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.05
Nodule 2.24
Rhizoplane 7.54
Rhizosphere 73.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206353_10449420 3300020082 Bacteria 4586
2 JGI25406J46586_10029948 3300003203 Bacteria 2053
3 JGI25407J50210_10011742 3300003373 Bacteria 2242
4 Ga0007427J51700_103889 3300003559 Bacteria 1703
5 Ga0070658_10000155 3300005327 Bacteria 60553
6 Ga0070670_100135587 3300005331 Bacteria 2127
7 Ga0068869_100029053 3300005334 Bacteria 3869
8 Ga0070666_10069597 3300005335 Bacteria 2393
9 Ga0070680_100037247 3300005336 Bacteria 3930
10 Ga0070680_100071705 3300005336 Bacteria 2847
11 Ga0070680_100123799 3300005336 Bacteria 2160
12 Ga0070682_100032467 3300005337 Bacteria 3166
13 Ga0068868_100004213 3300005338 Bacteria 10061
14 Ga0068868_100007824 3300005338 Bacteria 7630
15 Ga0068868_100020963 3300005338 Bacteria 4919
16 Ga0070660_100053517 3300005339 Bacteria 3114
17 Ga0070689_100114231 3300005340 Bacteria 2151
18 Ga0070691_10001177 3300005341 Bacteria 10945
19 Ga0070661_100021232 3300005344 Bacteria 4635
20 Ga0070661_100043884 3300005344 Bacteria 3266
21 Ga0070692_10051312 3300005345 Bacteria 2145
22 Ga0070669_100037629 3300005353 Bacteria 3510
23 Ga0070675_100017004 3300005354 Bacteria 5779
24 Ga0070675_100079739 3300005354 Bacteria 2728
25 Ga0070671_100002713 3300005355 Bacteria 13735
26 Ga0070688_100155594 3300005365 Bacteria 1566
27 Ga0070659_100038921 3300005366 Bacteria 3710
28 Ga0070667_100014986 3300005367 Bacteria 6405
29 Ga0070667_100207366 3300005367 Bacteria 1741
30 Ga0070709_10164481 3300005434 Bacteria 1545
31 Ga0070714_100263200 3300005435 Bacteria 1597
32 Ga0070710_10065621 3300005437 Bacteria 2079
33 Ga0070711_100025960 3300005439 Bacteria 3836
34 Ga0070705_100033674 3300005440 Bacteria 2858
35 Ga0070705_100056907 3300005440 Bacteria 2305
36 Ga0070700_100052970 3300005441 Bacteria 2531
37 Ga0070694_100032516 3300005444 Bacteria 3426
38 Ga0070708_100005557 3300005445 Bacteria 9988
39 Ga0070663_100050920 3300005455 Bacteria 2947
40 Ga0070678_100017670 3300005456 Bacteria 4599
41 Ga0070662_100013742 3300005457 Bacteria 5392
42 Ga0070681_10066947 3300005458 Bacteria 3561
43 Ga0070681_10168363 3300005458 Bacteria 2113
44 Ga0070685_10100702 3300005466 Bacteria 1764
45 Ga0070706_100016465 3300005467 Bacteria 6833
46 Ga0070706_100030801 3300005467 Bacteria 4945
47 Ga0070707_100002888 3300005468 Bacteria 16326
48 Ga0070707_100086721 3300005468 Bacteria 3027
49 Ga0070679_100031607 3300005530 Bacteria 5231
50 Ga0070679_100034415 3300005530 Bacteria 5020
51 Ga0070684_100023795 3300005535 Bacteria 5129
52 Ga0070684_100111449 3300005535 Bacteria 2454
53 Ga0070697_100141613 3300005536 Bacteria 2023
54 Ga0068853_100100890 3300005539 Bacteria 2552
55 Ga0070695_100037879 3300005545 Bacteria 3040
56 Ga0070696_100008782 3300005546 Bacteria 6762
57 Ga0070693_100063728 3300005547 Bacteria 2149
58 Ga0070704_100132440 3300005549 Bacteria 1934
59 Ga0068855_100028889 3300005563 Bacteria 6634
60 Ga0068855_100035705 3300005563 Bacteria 5921
61 Ga0068855_100122244 3300005563 Bacteria 2979
62 Ga0070664_100011541 3300005564 Bacteria 7169
63 Ga0070664_100065602 3300005564 Bacteria 3098
64 Ga0068854_100068130 3300005578 Bacteria 2595
65 Ga0068856_100263612 3300005614 Bacteria 1739
66 Ga0070702_100018873 3300005615 Bacteria 3585
67 Ga0070702_100059422 3300005615 Bacteria 2218
68 Ga0068864_100037652 3300005618 Bacteria 4129
69 Ga0068864_100049993 3300005618 Bacteria 3597
70 Ga0068864_100097845 3300005618 Bacteria 2598
71 Ga0068864_100196241 3300005618 Bacteria 1852
72 Ga0068861_100062463 3300005719 Bacteria 2862
73 Ga0068851_10031107 3300005834 Bacteria 2650
74 Ga0068870_10000071 3300005840 Bacteria 32257
75 Ga0068870_10133917 3300005840 Bacteria 1442
76 Ga0068863_100006202 3300005841 Bacteria 11728
77 Ga0068863_100129014 3300005841 Bacteria 2413
78 Ga0068863_100162764 3300005841 Bacteria 2138
79 Ga0068863_100204199 3300005841 Bacteria 1901
80 Ga0068863_100221379 3300005841 Bacteria 1824
81 Ga0068858_100049748 3300005842 Bacteria 3880
82 Ga0068858_100091164 3300005842 Bacteria 2837
83 Ga0068860_100000696 3300005843 Bacteria 38651
84 Ga0068860_100216133 3300005843 Bacteria 1860
85 Ga0068862_100148141 3300005844 Bacteria 2088
86 Ga0081455_10009481 3300005937 Bacteria 10009
87 Ga0081455_10101636 3300005937 Bacteria 2307
88 Ga0081538_10003212 3300005981 Bacteria 15534
89 Ga0081540_1002024 3300005983 Bacteria 16920
90 Ga0081540_1002336 3300005983 Bacteria 15529
91 Ga0081540_1028714 3300005983 Bacteria 3116
92 Ga0081540_1035544 3300005983 Bacteria 2670
93 Ga0081540_1037843 3300005983 Bacteria 2552
94 Ga0081539_10001256 3300005985 Bacteria 45022
95 Ga0081539_10008632 3300005985 Bacteria 8790
96 Ga0070717_10054407 3300006028 Bacteria 3300
97 Ga0075364_10032964 3300006051 Bacteria 3332
98 Ga0070716_100007596 3300006173 Bacteria 5347
99 Ga0070712_100016810 3300006175 Bacteria 4731
100 Ga0075362_10058102 3300006177 Bacteria 1744
101 Ga0075367_10062290 3300006178 Bacteria 2227
102 Ga0097621_100039185 3300006237 Bacteria 3805
103 Ga0097621_100061317 3300006237 Bacteria 3085
104 Ga0075370_10014738 3300006353 Bacteria 4174
105 Ga0068871_100037288 3300006358 Bacteria 3876
106 Ga0075428_100000548 3300006844 Bacteria 38376
107 Ga0075428_100013258 3300006844 Bacteria 9171
108 Ga0075428_100180559 3300006844 Bacteria 2285
109 Ga0075430_100001669 3300006846 Bacteria 18139
110 Ga0075431_100067857 3300006847 Bacteria 3681
111 Ga0075433_10004261 3300006852 Bacteria 11111
112 Ga0075433_10112437 3300006852 Bacteria 2416
113 Ga0075434_100061910 3300006871 Bacteria 3724
114 Ga0075429_100008206 3300006880 Bacteria 9079
115 Ga0075436_100013244 3300006914 Bacteria 5652
116 Ga0075436_100104504 3300006914 Bacteria 1974
117 Ga0075435_100011752 3300007076 Bacteria 6460
118 Ga0075435_100017819 3300007076 Bacteria 5383
119 Ga0075435_100037946 3300007076 Bacteria 3840
120 Ga0105251_10019066 3300009011 Bacteria 3633
121 Ga0105251_10085020 3300009011 Bacteria 1458
122 Ga0105240_10025288 3300009093 Bacteria 7806
123 Ga0105240_10046325 3300009093 Bacteria 5510
124 Ga0105240_10241506 3300009093 Bacteria 2094
125 Ga0111539_10002078 3300009094 Bacteria 26758
126 Ga0105245_10010790 3300009098 Bacteria 7950
127 Ga0105245_10138499 3300009098 Bacteria 2290
128 Ga0114129_10026954 3300009147 Bacteria 8134
129 Ga0114129_10068551 3300009147 Bacteria 4946
130 Ga0114129_10112387 3300009147 Bacteria 3756
131 Ga0105243_10021460 3300009148 Bacteria 4903
132 Ga0105241_10004726 3300009174 Bacteria 10042
133 Ga0105241_10050833 3300009174 Bacteria 3159
134 Ga0105241_10113572 3300009174 Bacteria 2171
135 Ga0105242_10056072 3300009176 Bacteria 3224
136 Ga0105248_10074502 3300009177 Bacteria 3815
137 Ga0105248_10096019 3300009177 Bacteria 3338
138 Ga0105237_10367808 3300009545 Bacteria 1443
139 Ga0105238_10011506 3300009551 Bacteria 8915
140 Ga0105238_10198471 3300009551 Bacteria 1982
141 Ga0105032_100820 3300009979 Bacteria 2934
142 Ga0105246_10000478 3300011119 Bacteria 21566
143 Ga0105246_10011011 3300011119 Bacteria 5605
144 Ga0157373_10044187 3300013100 Bacteria 3181
145 Ga0157371_10095214 3300013102 Bacteria 2110
146 Ga0157370_10029838 3300013104 Bacteria 5346
147 Ga0157374_10123603 3300013296 Bacteria 2500
148 Ga0157374_10262748 3300013296 Bacteria 1700
149 Ga0157378_10126219 3300013297 Bacteria 2364
150 Ga0157372_10087968 3300013307 Bacteria 3526
151 Ga0157372_10292662 3300013307 Bacteria 1894
152 Ga0157375_10043146 3300013308 Bacteria 4371
153 Ga0163163_10009000 3300014325 Bacteria 8896
154 Ga0163163_10088919 3300014325 Bacteria 3100
155 Ga0163163_10102614 3300014325 Bacteria 2884
156 Ga0157377_10012177 3300014745 Bacteria 4317
157 Ga0157379_10045611 3300014968 Bacteria 3912
158 Ga0157376_10217435 3300014969 Bacteria 1768
159 Ga0206349_1115733 3300020075 Bacteria 2884
160 Ga0206353_11895285 3300020082 Bacteria 1981
161 Ga0213876_10001219 3300021384 Bacteria 16232
162 Ga0224712_10004370 3300022467 Bacteria 3806
163 Ga0224712_10075717 3300022467 Bacteria 1377
164 Ga0207710_10008848 3300025900 Bacteria 4239
165 Ga0207688_10029958 3300025901 Bacteria 3000
166 Ga0207688_10121434 3300025901 Bacteria 1525
167 Ga0207680_10093628 3300025903 Bacteria 1917
168 Ga0207680_10148750 3300025903 Bacteria 1559
169 Ga0207643_10000102 3300025908 Bacteria 57710
170 Ga0207705_10001837 3300025909 Bacteria 16689
171 Ga0207705_10033090 3300025909 Bacteria 3695
172 Ga0207705_10041673 3300025909 Bacteria 3294
173 Ga0207705_10057885 3300025909 Bacteria 2796
174 Ga0207705_10251350 3300025909 Bacteria 1348
175 Ga0207684_10006321 3300025910 Bacteria 10806
176 Ga0207654_10064344 3300025911 Bacteria 2156
177 Ga0207707_10036826 3300025912 Bacteria 4276
178 Ga0207707_10047880 3300025912 Bacteria 3723
179 Ga0207707_10210981 3300025912 Bacteria 1691
180 Ga0207695_10003124 3300025913 Bacteria 23688
181 Ga0207695_10027858 3300025913 Bacteria 6281
182 Ga0207695_10101759 3300025913 Bacteria 2867
183 Ga0207671_10028477 3300025914 Bacteria 4174
184 Ga0207671_10184247 3300025914 Bacteria 1626
185 Ga0207693_10001971 3300025915 Bacteria 17987
186 Ga0207660_10013362 3300025917 Bacteria 5381
187 Ga0207660_10015363 3300025917 Bacteria 5051
188 Ga0207660_10124224 3300025917 Bacteria 1958
189 Ga0207657_10058913 3300025919 Bacteria 3303
190 Ga0207657_10059520 3300025919 Bacteria 3281
191 Ga0207649_10008342 3300025920 Bacteria 5646
192 Ga0207649_10063227 3300025920 Bacteria 2336
193 Ga0207652_10019773 3300025921 Bacteria 5543
194 Ga0207652_10082159 3300025921 Bacteria 2819
195 Ga0207652_10117570 3300025921 Bacteria 2362
196 Ga0207646_10037562 3300025922 Bacteria 4366
197 Ga0207646_10075659 3300025922 Bacteria 3008
198 Ga0207694_10005907 3300025924 Bacteria 9385
199 Ga0207650_10003132 3300025925 Bacteria 11395
200 Ga0207659_10010653 3300025926 Bacteria 5781
201 Ga0207687_10006095 3300025927 Bacteria 7982
202 Ga0207687_10031041 3300025927 Bacteria 3609
203 Ga0207687_10208763 3300025927 Bacteria 1531
204 Ga0207700_10170528 3300025928 Bacteria 1815
205 Ga0207644_10046743 3300025931 Bacteria 3085
206 Ga0207706_10065001 3300025933 Bacteria 3212
207 Ga0207709_10074532 3300025935 Bacteria 2166
208 Ga0207670_10012052 3300025936 Bacteria 5041
209 Ga0207670_10078860 3300025936 Bacteria 2298
210 Ga0207704_10066731 3300025938 Bacteria 2260
211 Ga0207665_10002513 3300025939 Bacteria 12334
212 Ga0207711_10120505 3300025941 Bacteria 2341
213 Ga0207689_10014046 3300025942 Bacteria 6815
214 Ga0207689_10041116 3300025942 Bacteria 3826
215 Ga0207661_10009298 3300025944 Bacteria 7043
216 Ga0207661_10010323 3300025944 Bacteria 6718
217 Ga0207679_10019242 3300025945 Bacteria 4585
218 Ga0207667_10074145 3300025949 Bacteria 3535
219 Ga0207667_10454046 3300025949 Bacteria 1302
220 Ga0207712_10216838 3300025961 Bacteria 1528
221 Ga0207668_10002345 3300025972 Bacteria 11050
222 Ga0207668_10031935 3300025972 Bacteria 3474
223 Ga0207640_10031185 3300025981 Bacteria 3291
224 Ga0207658_10020723 3300025986 Bacteria 4554
225 Ga0207677_10007428 3300026023 Bacteria 6061
226 Ga0207703_10090243 3300026035 Bacteria 2575
227 Ga0207678_10000163 3300026067 Bacteria 55928
228 Ga0207678_10002103 3300026067 Bacteria 18030
229 Ga0207678_10150783 3300026067 Bacteria 1985
230 Ga0207708_10009183 3300026075 Bacteria 7318
231 Ga0207708_10018977 3300026075 Bacteria 5178
232 Ga0207702_10000567 3300026078 Bacteria 41121
233 Ga0207641_10008900 3300026088 Bacteria 8292
234 Ga0207641_10107262 3300026088 Bacteria 2470
235 Ga0207641_10167936 3300026088 Bacteria 2000
236 Ga0207676_10000814 3300026095 Bacteria 24327
237 Ga0207676_10035860 3300026095 Bacteria 3769
238 Ga0207676_10059729 3300026095 Bacteria 3012
239 Ga0207674_10066533 3300026116 Bacteria 3630
240 Ga0207675_100034673 3300026118 Bacteria 4706
241 Ga0207683_10001761 3300026121 Bacteria 19161
242 Ga0207683_10002042 3300026121 Bacteria 17869
243 Ga0207428_10015137 3300027907 Bacteria 6677
244 Ga0207428_10067151 3300027907 Bacteria 2824
245 Ga0268265_10021181 3300028380 Bacteria 4550
246 Ga0268264_10000697 3300028381 Bacteria 39075
247 Ga0268264_10144765 3300028381 Bacteria 2123
248 Ga0307515_10000182 3300028794 Bacteria 154288
249 Ga0307515_10007109 3300028794 Bacteria 22231
250 Ga0307515_10049070 3300028794 Bacteria 6365
251 Ga0307515_10282072 3300028794 Bacteria 1367
252 Ga0307512_10009848 3300030522 Bacteria 9173
253 Ga0307512_10023837 3300030522 Bacteria 5461
254 Ga0307513_10030700 3300031456 Bacteria 6100
255 Ga0307513_10037395 3300031456 Bacteria 5403
256 Ga0307509_10043119 3300031507 Bacteria 4884
257 Ga0307408_100089882 3300031548 Bacteria 2316
258 Ga0307508_10001109 3300031616 Bacteria 31161
259 Ga0316576_10000137 3300031727 Bacteria 28506
260 Ga0316576_10006220 3300031727 Bacteria 7405
261 Ga0307516_10000395 3300031730 Bacteria 56947
262 Ga0307516_10007781 3300031730 Bacteria 12239
263 Ga0307405_10005963 3300031731 Bacteria 5946
264 Ga0307405_10061034 3300031731 Bacteria 2381
265 Ga0307410_10125691 3300031852 Bacteria 1877
266 Ga0307406_10002243 3300031901 Bacteria 10526
267 Ga0307406_10005185 3300031901 Bacteria 7115
268 Ga0307409_100000570 3300031995 Bacteria 16038
269 Ga0307409_100187515 3300031995 Bacteria 1837
270 Ga0307416_100063011 3300032002 Bacteria 3034
271 Ga0307416_100341315 3300032002 Bacteria 1511
272 Ga0307411_10174417 3300032005 Bacteria 1625
273 Ga0307411_10176793 3300032005 Bacteria 1616
274 Ga0307415_100000023 3300032126 Bacteria 64440
275 Ga0307415_100108872 3300032126 Bacteria 2051
276 Ga0307415_100109768 3300032126 Bacteria 2044
277 Ga0316583_10002899 3300032133 Bacteria 6024
278 Ga0316593_10007032 3300032168 Bacteria 3070
279 Ga0307507_10056057 3300033179 Bacteria 3729
280 Ga0307507_10081671 3300033179 Bacteria 2840
281 Ga0316592_1014230 3300033524 Bacteria 1648
282 Ga0316588_1009435 3300033528 Bacteria 2035
283 Ga0316596_1004571 3300033541 Bacteria 3115
284 Ga0373940_0019450 3300035088 Bacteria 1716
285 Ga0373951_0000654 3300035091 Bacteria 9524
286 Ga0373952_0002217 3300035092 Bacteria 3500
287 Ga0373960_0018278 3300035121 Bacteria 1826
288 Ga0373942_0000028 3300035207 Bacteria 26905
289 Ga0373961_0005225 3300035241 Bacteria 3124
290 Ga0373937_0261146 3300036401 Bacteria 1633
291 Ga0395899_0009043 3300037312 Bacteria 7655
292 Ga0395900_0003750 3300037418 Bacteria 16323
293 Ga0395898_0021439 3300037466 Bacteria 6553
294 Ga0395898_0060898 3300037466 Bacteria 3667
295 Ga0395905_0050927 3300037471 Bacteria 3879
296 Ga0395905_0088235 3300037471 Bacteria 2907
297 Ga0316581_0035433 3300037588 Bacteria 1512
298 Ga0436364_0821285 3300037853 Bacteria 6996
299 Ga0436364_1328919 3300037853 Bacteria 8035
300 Ga0395901_0004693 3300038443 Bacteria 13783
301 Ga0436365_0093685 3300039437 Bacteria 33238
302 Ga0436365_1730931 3300039437 Bacteria 2223
303 Ga0436363_0003162 3300039450 Bacteria 2532
304 Ga0451853_0639474 3300041512 Bacteria 3340
305 Ga0439440_0016017 3300042993 Bacteria 1635
306 Ga0466969_0066234 3300044656 Bacteria 1744
307 Ga0466972_0032585 3300044658 Bacteria 2558
308 Ga0466965_0021306 3300044683 Bacteria 3119
309 Ga0466961_0153978 3300044693 Bacteria 1434
310 Ga0466963_0005697 3300044694 Bacteria 7320
311 Ga0466963_0020584 3300044694 Bacteria 4149
312 Ga0466963_0093303 3300044694 Bacteria 2052
313 Ga0466968_0092682 3300044735 Bacteria 1341
314 Ga0466970_0006117 3300044765 Bacteria 5997
315 Ga0466957_0014696 3300044842 Bacteria 4561
316 Ga0466957_0064762 3300044842 Bacteria 2249
317 Ga0466960_0014128 3300044901 Bacteria 3409
318 Ga0466959_0002810 3300045049 Bacteria 11209
319 Ga0466958_0026612 3300045836 Bacteria 3420
320 Ga0466958_0069376 3300045836 Bacteria 2155
321 Ga0466967_0022238 3300045976 Bacteria 5169
322 Ga0466967_0031476 3300045976 Bacteria 4466
323 Ga0466967_0063932 3300045976 Bacteria 3271
324 Ga0466967_0081095 3300045976 Bacteria 2930
325 Ga0466967_0235330 3300045976 Bacteria 1745
326 Ga0466967_0396911 3300045976 Bacteria 1341
327 Ga0495629_0039858 3300046459 Bacteria 3306
328 Ga0495594_0033907 3300046499 Bacteria 2777
329 Ga0495594_0123047 3300046499 Bacteria 1467
330 Ga0495632_0030356 3300046519 Bacteria 2806
331 Ga0495622_0052802 3300046557 Bacteria 1886
332 Ga0495668_0000477 3300046616 Bacteria 50176
333 Ga0495625_0000969 3300046660 Bacteria 38144
334 Ga0495683_0060776 3300047323 Bacteria 1872
335 Ga0495626_0000234 3300048091 Bacteria 65050
336 Ga0496100_0062542 3300048903 Bacteria 2457
337 Ga0496100_0101684 3300048903 Bacteria 1982
338 Ga0496102_0031452 3300048905 Bacteria 4761
339 Ga0496102_0185127 3300048905 Bacteria 1962
340 Ga0496102_0272036 3300048905 Bacteria 1597
341 Ga0496103_0105452 3300048906 Bacteria 1787
342 Ga0496104_0014353 3300048907 Bacteria 7155
343 Ga0496104_0026384 3300048907 Bacteria 5364
344 Ga0496104_0028821 3300048907 Bacteria 5146
345 Ga0496104_0158806 3300048907 Bacteria 2169
346 Ga0496105_0122544 3300048908 Bacteria 2143
347 Ga0496106_0053883 3300048909 Bacteria 3038
348 Ga0496108_0000115 3300048911 Bacteria 79928
349 Ga0496108_0016367 3300048911 Bacteria 6047
350 Ga0496108_0016737 3300048911 Bacteria 5990
351 Ga0496109_0007823 3300048912 Bacteria 9053
352 Ga0496109_0018690 3300048912 Bacteria 6092
353 Ga0496109_0168446 3300048912 Bacteria 2054
354 Ga0496109_0219239 3300048912 Bacteria 1789
355 Ga0496110_0007084 3300048913 Bacteria 8926
356 Ga0496110_0029501 3300048913 Bacteria 4722
357 Ga0496110_0051636 3300048913 Bacteria 3613
358 Ga0496110_0174537 3300048913 Bacteria 1950
359 Ga0496110_0192022 3300048913 Bacteria 1854
360 Ga0496111_0001395 3300048914 Bacteria 13722
361 Ga0496111_0126243 3300048914 Bacteria 1891
362 Ga0496111_0153776 3300048914 Bacteria 1707
363 Ga0496111_0162832 3300048914 Bacteria 1656
364 Ga0496111_0202558 3300048914 Bacteria 1475
365 Ga0496112_0088917 3300048915 Bacteria 3056
366 Ga0496112_0207171 3300048915 Bacteria 1918
367 Ga0496113_0061784 3300048916 Bacteria 2827
368 Ga0496113_0167070 3300048916 Bacteria 1741
369 Ga0496114_0023441 3300048917 Bacteria 5037
370 Ga0496114_0093242 3300048917 Bacteria 2560
371 Ga0496114_0140099 3300048917 Bacteria 2093
372 Ga0496115_0003853 3300048918 Bacteria 10815
373 Ga0496119_0000521 3300048922 Bacteria 52243
374 Ga0496120_0006138 3300048923 Bacteria 9319
375 Ga0496121_0002251 3300048924 Bacteria 30080
376 Ga0496126_0093024 3300048929 Bacteria 2648
377 Ga0496126_0130095 3300048929 Bacteria 2176
378 Ga0501033_0238099 3300049570 Bacteria 1292
379 Ga0501034_0070497 3300049571 Bacteria 3506
380 Ga0501037_0034593 3300049573 Bacteria 3728
381 Ga0501037_0131476 3300049573 Bacteria 1795
382 Ga0501038_0090748 3300049574 Bacteria 2560
383 Ga0501039_0177609 3300049575 Bacteria 1674
384 Ga0501039_0246566 3300049575 Bacteria 1405
385 Ga0501040_0280528 3300049576 Bacteria 1190
386 Ga0501047_0074441 3300049581 Bacteria 3269
387 Ga0501070_0019599 3300049586 Bacteria 5671
388 Ga0501070_0021481 3300049586 Bacteria 5415
389 Ga0501070_0113159 3300049586 Bacteria 2243
390 Ga0501071_0137296 3300049587 Bacteria 1820
391 Ga0501073_0035058 3300049589 Bacteria 3567
392 Ga0501074_0000891 3300049590 Bacteria 19075
393 Ga0501079_0104141 3300049741 Bacteria 2201
394 Ga0501079_0149433 3300049741 Bacteria 1821
395 Ga0501080_0132391 3300049742 Bacteria 2308
396 Ga0501080_0151147 3300049742 Bacteria 2146
397 Ga0501080_0235103 3300049742 Bacteria 1674
398 Ga0501044_0026450 3300049823 Bacteria 6140
399 Ga0501045_0183217 3300049824 Bacteria 1560
400 nmdc:mga0yw44_12141_c1 3300050492 Bacteria 4478
401 nmdc:mga06z11_42646_c1 3300050494 Bacteria 2277
402 nmdc:mga05p37_161124_c1 3300050507 Bacteria 2740
403 nmdc:mga05p37_54302_c1 3300050507 Bacteria 4929
404 nmdc:mga09592_112248_c1 3300050508 Bacteria 2338
405 nmdc:mga09592_217813_c1 3300050508 Bacteria 1654
406 nmdc:mga09592_7011_c1 3300050508 Bacteria 9162
407 nmdc:mga0qj67_181294_c1 3300050509 Bacteria 1710
408 nmdc:mga06r32_108986_c1 3300050510 Bacteria 2723
409 nmdc:mga06r32_164916_c1 3300050510 Bacteria 2198
410 nmdc:mga06r32_183671_c1 3300050510 Bacteria 2078
411 nmdc:mga08y16_10450_c1 3300050511 Bacteria 9738
412 nmdc:mga08y16_65543_c1 3300050511 Bacteria 3792
413 nmdc:mga0n895_17176_c1 3300050512 Bacteria 6667
414 nmdc:mga0n895_265692_c1 3300050512 Bacteria 1741
415 nmdc:mga0rr50_11903_c1 3300050513 Bacteria 5593
416 nmdc:mga0rr50_49001_c1 3300050513 Bacteria 3126
417 nmdc:mga08x19_219631_c1 3300050514 Bacteria 1306
418 nmdc:mga08x19_7720_c1 3300050514 Bacteria 6389
419 Ga0495619_0049476 3300053085 Bacteria 2772
420 Ga0495619_0104133 3300053085 Bacteria 1934
421 Ga0500643_000457 3300053087 Bacteria 30222
422 Ga0500646_0000067 3300053090 Bacteria 29313
423 Ga0500646_0000160 3300053090 Bacteria 19918
424 Ga0500646_0026442 3300053090 Bacteria 1573
425 Ga0500651_0019868 3300053093 Bacteria 4180
426 Ga0500641_0028423 3300053096 Bacteria 2184
427 Ga0500641_0123879 3300053096 Bacteria 1114
428 Ga0500652_014834 3300053131 Bacteria 2797
429 Ga0500579_100422 3300053143 Bacteria 1511
430 Ga0501084_0034999 3300054114 Bacteria 4199
431 Ga0501084_0234264 3300054114 Bacteria 1550
432 Ga0466962_0021658 3300061719 Bacteria 3085
433 2501942791 2501939600 Bacteria 6907073
434 2501944794 2501939600 Bacteria 6907073
435 2623587988 2622736626 Bacteria 7181580
436 2676487073 2675903059 Bacteria 8644972
437 2772641587 2772190715 Bacteria 6959372
438 2772643621 2772190715 Bacteria 6959372
439 2831936641 2831935698 Bacteria 5963223
440 2855672163 2855670206 Bacteria 7120389
441 2855675211 2855670206 Bacteria 7120389
442 2855681989 2855676851 Bacteria 7063653
443 2855682790 2855676851 Bacteria 7063653
444 2855686411 2855683550 Bacteria 7134265
445 2855686835 2855683550 Bacteria 7134265
446 2856862015 2856858025 Bacteria 7255264
447 2856863709 2856858025 Bacteria 7255264
448 2857292913 2857288857 Bacteria 7189066
449 2857294748 2857288857 Bacteria 7189066
450 2858850042 2858848962 Bacteria 6963058
451 2858854413 2858848962 Bacteria 6963058
452 2858874865 2858868258 Bacteria 7683772
453 2858883445 2858882152 Bacteria 7230291
454 2858888472 2858882152 Bacteria 7230291
455 2858891775 2858888857 Bacteria 7060307
456 2858893828 2858888857 Bacteria 7060307
457 2858899238 2858895516 Bacteria 7378898
458 2858899374 2858895516 Bacteria 7378898
459 2867307813 2867302475 Bacteria 7087181
460 2867319128 2867312974 Bacteria 7058875
461 2867320133 2867319477 Bacteria 7069771
462 2868093261 2868088558 Bacteria 7609351
463 2869054139 2869048445 Bacteria 6875584
464 2869066103 2869061728 Bacteria 7112407
465 2869066663 2869061728 Bacteria 7112407
466 2869070749 2869068681 Bacteria 7205615
467 2869074118 2869068681 Bacteria 7205615
468 2880492072 2880489317 Bacteria 7096270
469 2880498505 2880495981 Bacteria 7340502
470 2880500226 2880495981 Bacteria 7340502
471 2887486835 2887478801 Bacteria 8972725
472 2902586689 2902582711 Bacteria 6187705
473 2929222119 2929219909 Bacteria 6984360
474 2929227091 2929226422 Bacteria 7248583
475 2929228777 2929226422 Bacteria 7248583
476 2946033834 2946033335 Bacteria 3835514
477 2996227943 2996221748 Bacteria 6799777
478 649812615 649633069 Bacteria 6962533
479 649814533 649633069 Bacteria 6962533
480 8001786836 8001781756 Bacteria 9586736
481 8003837105 8003830390 Bacteria 6541657
482 8003860393 8003856774 Bacteria 7675274
483 8003878109 8003870546 Bacteria 7396674
484 8054707125 8054704163 Bacteria 7247792
485 8054710204 8054704163 Bacteria 7247792
486 8054731054 8054727385 Bacteria 7558670
487 8054731788 8054727385 Bacteria 7558670
488 8054735186 8054734606 Bacteria 6947278
489 8054738344 8054734606 Bacteria 6947278
490 8055416121 8055412473 Bacteria 6257500
491 8057568568 8057568493 Bacteria 7221719
492 Ga0206353_10449420
493 JGI25406J46586_10029948
494 JGI25407J50210_10011742
495 Ga0007427J51700_103889
496 Ga0070658_10000155
497 Ga0070670_100135587
498 Ga0068869_100029053
499 Ga0070666_10069597
500 Ga0070680_100037247
501 Ga0070680_100071705
502 Ga0070680_100123799
503 Ga0070682_100032467
504 Ga0068868_100004213
505 Ga0068868_100007824
506 Ga0068868_100020963
507 Ga0070660_100053517
508 Ga0070689_100114231
509 Ga0070691_10001177
510 Ga0070661_100021232
511 Ga0070661_100043884
512 Ga0070692_10051312
513 Ga0070669_100037629
514 Ga0070675_100017004
515 Ga0070675_100079739
516 Ga0070671_100002713
517 Ga0070688_100155594
518 Ga0070659_100038921
519 Ga0070667_100014986
520 Ga0070667_100207366
521 Ga0070709_10164481
522 Ga0070714_100263200
523 Ga0070710_10065621
524 Ga0070711_100025960
525 Ga0070705_100033674
526 Ga0070705_100056907
527 Ga0070700_100052970
528 Ga0070694_100032516
529 Ga0070708_100005557
530 Ga0070663_100050920
531 Ga0070678_100017670
532 Ga0070662_100013742
533 Ga0070681_10066947
534 Ga0070681_10168363
535 Ga0070685_10100702
536 Ga0070706_100016465
537 Ga0070706_100030801
538 Ga0070707_100002888
539 Ga0070707_100086721
540 Ga0070679_100031607
541 Ga0070679_100034415
542 Ga0070684_100023795
543 Ga0070684_100111449
544 Ga0070697_100141613
545 Ga0068853_100100890
546 Ga0070695_100037879
547 Ga0070696_100008782
548 Ga0070693_100063728
549 Ga0070704_100132440
550 Ga0068855_100028889
551 Ga0068855_100035705
552 Ga0068855_100122244
553 Ga0070664_100011541
554 Ga0070664_100065602
555 Ga0068854_100068130
556 Ga0068856_100263612
557 Ga0070702_100018873
558 Ga0070702_100059422
559 Ga0068864_100037652
560 Ga0068864_100049993
561 Ga0068864_100097845
562 Ga0068864_100196241
563 Ga0068861_100062463
564 Ga0068851_10031107
565 Ga0068870_10000071
566 Ga0068870_10133917
567 Ga0068863_100006202
568 Ga0068863_100129014
569 Ga0068863_100162764
570 Ga0068863_100204199
571 Ga0068863_100221379
572 Ga0068858_100049748
573 Ga0068858_100091164
574 Ga0068860_100000696
575 Ga0068860_100216133
576 Ga0068862_100148141
577 Ga0081455_10009481
578 Ga0081455_10101636
579 Ga0081538_10003212
580 Ga0081540_1002024
581 Ga0081540_1002336
582 Ga0081540_1028714
583 Ga0081540_1035544
584 Ga0081540_1037843
585 Ga0081539_10001256
586 Ga0081539_10008632
587 Ga0070717_10054407
588 Ga0075364_10032964
589 Ga0070716_100007596
590 Ga0070712_100016810
591 Ga0075362_10058102
592 Ga0075367_10062290
593 Ga0097621_100039185
594 Ga0097621_100061317
595 Ga0075370_10014738
596 Ga0068871_100037288
597 Ga0075428_100000548
598 Ga0075428_100013258
599 Ga0075428_100180559
600 Ga0075430_100001669
601 Ga0075431_100067857
602 Ga0075433_10004261
603 Ga0075433_10112437
604 Ga0075434_100061910
605 Ga0075429_100008206
606 Ga0075436_100013244
607 Ga0075436_100104504
608 Ga0075435_100011752
609 Ga0075435_100017819
610 Ga0075435_100037946
611 Ga0105251_10019066
612 Ga0105251_10085020
613 Ga0105240_10025288
614 Ga0105240_10046325
615 Ga0105240_10241506
616 Ga0111539_10002078
617 Ga0105245_10010790
618 Ga0105245_10138499
619 Ga0114129_10026954
620 Ga0114129_10068551
621 Ga0114129_10112387
622 Ga0105243_10021460
623 Ga0105241_10004726
624 Ga0105241_10050833
625 Ga0105241_10113572
626 Ga0105242_10056072
627 Ga0105248_10074502
628 Ga0105248_10096019
629 Ga0105237_10367808
630 Ga0105238_10011506
631 Ga0105238_10198471
632 Ga0105032_100820
633 Ga0105246_10000478
634 Ga0105246_10011011
635 Ga0157373_10044187
636 Ga0157371_10095214
637 Ga0157370_10029838
638 Ga0157374_10123603
639 Ga0157374_10262748
640 Ga0157378_10126219
641 Ga0157372_10087968
642 Ga0157372_10292662
643 Ga0157375_10043146
644 Ga0163163_10009000
645 Ga0163163_10088919
646 Ga0163163_10102614
647 Ga0157377_10012177
648 Ga0157379_10045611
649 Ga0157376_10217435
650 Ga0206349_1115733
651 Ga0206353_11895285
652 Ga0213876_10001219
653 Ga0224712_10004370
654 Ga0224712_10075717
655 Ga0207710_10008848
656 Ga0207688_10029958
657 Ga0207688_10121434
658 Ga0207680_10093628
659 Ga0207680_10148750
660 Ga0207643_10000102
661 Ga0207705_10001837
662 Ga0207705_10033090
663 Ga0207705_10041673
664 Ga0207705_10057885
665 Ga0207705_10251350
666 Ga0207684_10006321
667 Ga0207654_10064344
668 Ga0207707_10036826
669 Ga0207707_10047880
670 Ga0207707_10210981
671 Ga0207695_10003124
672 Ga0207695_10027858
673 Ga0207695_10101759
674 Ga0207671_10028477
675 Ga0207671_10184247
676 Ga0207693_10001971
677 Ga0207660_10013362
678 Ga0207660_10015363
679 Ga0207660_10124224
680 Ga0207657_10058913
681 Ga0207657_10059520
682 Ga0207649_10008342
683 Ga0207649_10063227
684 Ga0207652_10019773
685 Ga0207652_10082159
686 Ga0207652_10117570
687 Ga0207646_10037562
688 Ga0207646_10075659
689 Ga0207694_10005907
690 Ga0207650_10003132
691 Ga0207659_10010653
692 Ga0207687_10006095
693 Ga0207687_10031041
694 Ga0207687_10208763
695 Ga0207700_10170528
696 Ga0207644_10046743
697 Ga0207706_10065001
698 Ga0207709_10074532
699 Ga0207670_10012052
700 Ga0207670_10078860
701 Ga0207704_10066731
702 Ga0207665_10002513
703 Ga0207711_10120505
704 Ga0207689_10014046
705 Ga0207689_10041116
706 Ga0207661_10009298
707 Ga0207661_10010323
708 Ga0207679_10019242
709 Ga0207667_10074145
710 Ga0207667_10454046
711 Ga0207712_10216838
712 Ga0207668_10002345
713 Ga0207668_10031935
714 Ga0207640_10031185
715 Ga0207658_10020723
716 Ga0207677_10007428
717 Ga0207703_10090243
718 Ga0207678_10000163
719 Ga0207678_10002103
720 Ga0207678_10150783
721 Ga0207708_10009183
722 Ga0207708_10018977
723 Ga0207702_10000567
724 Ga0207641_10008900
725 Ga0207641_10107262
726 Ga0207641_10167936
727 Ga0207676_10000814
728 Ga0207676_10035860
729 Ga0207676_10059729
730 Ga0207674_10066533
731 Ga0207675_100034673
732 Ga0207683_10001761
733 Ga0207683_10002042
734 Ga0207428_10015137
735 Ga0207428_10067151
736 Ga0268265_10021181
737 Ga0268264_10000697
738 Ga0268264_10144765
739 Ga0307515_10000182
740 Ga0307515_10007109
741 Ga0307515_10049070
742 Ga0307515_10282072
743 Ga0307512_10009848
744 Ga0307512_10023837
745 Ga0307513_10030700
746 Ga0307513_10037395
747 Ga0307509_10043119
748 Ga0307408_100089882
749 Ga0307508_10001109
750 Ga0316576_10000137
751 Ga0316576_10006220
752 Ga0307516_10000395
753 Ga0307516_10007781
754 Ga0307405_10005963
755 Ga0307405_10061034
756 Ga0307410_10125691
757 Ga0307406_10002243
758 Ga0307406_10005185
759 Ga0307409_100000570
760 Ga0307409_100187515
761 Ga0307416_100063011
762 Ga0307416_100341315
763 Ga0307411_10174417
764 Ga0307411_10176793
765 Ga0307415_100000023
766 Ga0307415_100108872
767 Ga0307415_100109768
768 Ga0316583_10002899
769 Ga0316593_10007032
770 Ga0307507_10056057
771 Ga0307507_10081671
772 Ga0316592_1014230
773 Ga0316588_1009435
774 Ga0316596_1004571
775 Ga0373940_0019450
776 Ga0373951_0000654
777 Ga0373952_0002217
778 Ga0373960_0018278
779 Ga0373942_0000028
780 Ga0373961_0005225
781 Ga0373937_0261146
782 Ga0395899_0009043
783 Ga0395900_0003750
784 Ga0395898_0021439
785 Ga0395898_0060898
786 Ga0395905_0050927
787 Ga0395905_0088235
788 Ga0316581_0035433
789 Ga0436364_0821285
790 Ga0436364_1328919
791 Ga0395901_0004693
792 Ga0436365_0093685
793 Ga0436365_1730931
794 Ga0436363_0003162
795 Ga0451853_0639474
796 Ga0439440_0016017
797 Ga0466969_0066234
798 Ga0466972_0032585
799 Ga0466965_0021306
800 Ga0466961_0153978
801 Ga0466963_0005697
802 Ga0466963_0020584
803 Ga0466963_0093303
804 Ga0466968_0092682
805 Ga0466970_0006117
806 Ga0466957_0014696
807 Ga0466957_0064762
808 Ga0466960_0014128
809 Ga0466959_0002810
810 Ga0466958_0026612
811 Ga0466958_0069376
812 Ga0466967_0022238
813 Ga0466967_0031476
814 Ga0466967_0063932
815 Ga0466967_0081095
816 Ga0466967_0235330
817 Ga0466967_0396911
818 Ga0495629_0039858
819 Ga0495594_0033907
820 Ga0495594_0123047
821 Ga0495632_0030356
822 Ga0495622_0052802
823 Ga0495668_0000477
824 Ga0495625_0000969
825 Ga0495683_0060776
826 Ga0495626_0000234
827 Ga0496100_0062542
828 Ga0496100_0101684
829 Ga0496102_0031452
830 Ga0496102_0185127
831 Ga0496102_0272036
832 Ga0496103_0105452
833 Ga0496104_0014353
834 Ga0496104_0026384
835 Ga0496104_0028821
836 Ga0496104_0158806
837 Ga0496105_0122544
838 Ga0496106_0053883
839 Ga0496108_0000115
840 Ga0496108_0016367
841 Ga0496108_0016737
842 Ga0496109_0007823
843 Ga0496109_0018690
844 Ga0496109_0168446
845 Ga0496109_0219239
846 Ga0496110_0007084
847 Ga0496110_0029501
848 Ga0496110_0051636
849 Ga0496110_0174537
850 Ga0496110_0192022
851 Ga0496111_0001395
852 Ga0496111_0126243
853 Ga0496111_0153776
854 Ga0496111_0162832
855 Ga0496111_0202558
856 Ga0496112_0088917
857 Ga0496112_0207171
858 Ga0496113_0061784
859 Ga0496113_0167070
860 Ga0496114_0023441
861 Ga0496114_0093242
862 Ga0496114_0140099
863 Ga0496115_0003853
864 Ga0496119_0000521
865 Ga0496120_0006138
866 Ga0496121_0002251
867 Ga0496126_0093024
868 Ga0496126_0130095
869 Ga0501033_0238099
870 Ga0501034_0070497
871 Ga0501037_0034593
872 Ga0501037_0131476
873 Ga0501038_0090748
874 Ga0501039_0177609
875 Ga0501039_0246566
876 Ga0501040_0280528
877 Ga0501047_0074441
878 Ga0501070_0019599
879 Ga0501070_0021481
880 Ga0501070_0113159
881 Ga0501071_0137296
882 Ga0501073_0035058
883 Ga0501074_0000891
884 Ga0501079_0104141
885 Ga0501079_0149433
886 Ga0501080_0132391
887 Ga0501080_0151147
888 Ga0501080_0235103
889 Ga0501044_0026450
890 Ga0501045_0183217
891 nmdc:mga0yw44_12141_c1
892 nmdc:mga06z11_42646_c1
893 nmdc:mga05p37_161124_c1
894 nmdc:mga05p37_54302_c1
895 nmdc:mga09592_112248_c1
896 nmdc:mga09592_217813_c1
897 nmdc:mga09592_7011_c1
898 nmdc:mga0qj67_181294_c1
899 nmdc:mga06r32_108986_c1
900 nmdc:mga06r32_164916_c1
901 nmdc:mga06r32_183671_c1
902 nmdc:mga08y16_10450_c1
903 nmdc:mga08y16_65543_c1
904 nmdc:mga0n895_17176_c1
905 nmdc:mga0n895_265692_c1
906 nmdc:mga0rr50_11903_c1
907 nmdc:mga0rr50_49001_c1
908 nmdc:mga08x19_219631_c1
909 nmdc:mga08x19_7720_c1
910 Ga0495619_0049476
911 Ga0495619_0104133
912 Ga0500643_000457
913 Ga0500646_0000067
914 Ga0500646_0000160
915 Ga0500646_0026442
916 Ga0500651_0019868
917 Ga0500641_0028423
918 Ga0500641_0123879
919 Ga0500652_014834
920 Ga0500579_100422
921 Ga0501084_0034999
922 Ga0501084_0234264
923 Ga0466962_0021658
924 2501942791
925 2501944794
926 2623587988
927 2676487073
928 2772641587
929 2772643621
930 2831936641
931 2855672163
932 2855675211
933 2855681989
934 2855682790
935 2855686411
936 2855686835
937 2856862015
938 2856863709
939 2857292913
940 2857294748
941 2858850042
942 2858854413
943 2858874865
944 2858883445
945 2858888472
946 2858891775
947 2858893828
948 2858899238
949 2858899374
950 2867307813
951 2867319128
952 2867320133
953 2868093261
954 2869054139
955 2869066103
956 2869066663
957 2869070749
958 2869074118
959 2880492072
960 2880498505
961 2880500226
962 2887486835
963 2902586689
964 2929222119
965 2929227091
966 2929228777
967 2946033834
968 2996227943
969 649812615
970 649814533
971 8001786836
972 8003837105
973 8003860393
974 8003878109
975 8054707125
976 8054710204
977 8054731054
978 8054731788
979 8054735186
980 8054738344
981 8055416121
982 8057568568

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02773

S-AdoMet_synt_C

S-adenosylmethionine synthetase, C-terminal domain

234

373

0.99

PF00438

S-AdoMet_synt_N

S-adenosylmethionine synthetase, N-terminal domain

19

85

0.98

PF02772

S-AdoMet_synt_M

S-adenosylmethionine synthetase, central domain

108

232

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h9u-assembly1.cif.gz_D crystal structure of a thermostable methionine adenosyltransferase 0.8928 2 384
5h9u-assembly1.cif.gz_D crystal structure of a thermostable methionine adenosyltransferase 0.8883 2 384
5t8s-assembly1.cif.gz_A crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium 0.887 2 383
5t8t-assembly1.cif.gz_A crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound amp and magnesium 0.8815 2 383
7low-assembly1.cif.gz_B s-adenosylmethionine synthetase 0.8808 2 384
ID Description Score Start End Superfamily
af_Q58EF9_292_361_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9869 273 338 3.30.300.10
af_Q2G1W4_138_246_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9465 125 233 3.30.300.10
af_P9WGV1_16_125_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9453 19 108 3.30.300.10
af_Q2G1W4_138_246_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9298 125 233 3.30.300.10
af_Q2G1W4_285_396_3.30.300.10 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9233 273 382 3.30.300.10
ID Description Score Start End GO Terms
AF-X1E018-F1-model_v4 Methionine adenosyltransferase 0.9669 19 201 GO:0004478
GO:0005524
GO:0006556
GO:0046872
AF-A0A355BID4-F1-model_v4 Methionine adenosyltransferase (EC 2.5.1.6) 0.9649 25 144 GO:0004478
GO:0005524
GO:0006556
GO:0046872
AF-A0A6B3IRJ1-F1-model_v4 Methionine adenosyltransferase (EC 2.5.1.6) 0.9647 19 239 GO:0004478
GO:0005524
GO:0006556
GO:0046872
AF-A0A7G3D859-F1-model_v4 deleted 0.9638 19 143
AF-W7PNX6-F1-model_v4 S-adenosylmethionine synthetase N-terminal domain-containing protein 0.9634 28 96 GO:0004478
GO:0005524
GO:0006556
GO:0046872

Map