F454106

General Info

Members Datasets Scaffolds Average Seq Length
491 292 482 176

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10532427|Ga0157376_105324271
Length 201
Sequence VLVEPVPKCASVRADLGGDQERKAHMARLVFGMNQSLDGYVDHTAFAPGPTLFRHFIEQAQDQAGSVYGRRMYEVMRYWDDDHPEWDADERAFAAAWRKQPKWVVSRSLTSVGPNATLVADDLDGAIRALKAGRDGEIEVAGPNLAHSLTALGLIDEYRIYLHPVVLGQGKPYFAGARPPLRLVASDRVDEDVIRLTYVPA

Samples

Sample ID Description Type Environment
1 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
2 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
3 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
4 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
5 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
6 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
7 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
8 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
9 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
176 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
181 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
184 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
185 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
186 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
187 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
188 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
235 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
236 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
246 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
247 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
248 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
249 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
250 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
251 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
252 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
253 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
254 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
255 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
256 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
257 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
264 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
265 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
266 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
267 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
271 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
283 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
284 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
285 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
286 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
287 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
288 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
289 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
290 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.55
Nodule 0.41
Rhizoplane 5.91
Rhizosphere 83.3
Stem 0
Stem Tuber 0
Unclassified 1.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000544 3300003215 Bacteria 23508
2 rootH2_10018394 3300003320 Bacteria 1460
3 rootL2_10216573 3300003322 Bacteria 2091
4 Ga0055526_1012492 3300003771 Bacteria 3696
5 Ga0055526_1028440 3300003771 Bacteria 1691
6 Ga0055524_1010220 3300003775 Bacteria 3752
7 Ga0055528_1000766 3300003790 Bacteria 22436
8 Ga0065165_1001406 3300005262 Bacteria 26221
9 Ga0065165_1003587 3300005262 Bacteria 10698
10 Ga0065715_10100722 3300005293 Bacteria 3238
11 Ga0065715_10106912 3300005293 Bacteria 2791
12 Ga0065715_10113183 3300005293 Bacteria 2470
13 Ga0065707_10555924 3300005295 Bacteria 718
14 Ga0070676_10203919 3300005328 Bacteria 1298
15 Ga0070683_100064682 3300005329 Bacteria 3405
16 Ga0070683_100696586 3300005329 Bacteria 973
17 Ga0070670_100066945 3300005331 Bacteria 3082
18 Ga0070680_100672298 3300005336 Bacteria 890
19 Ga0070682_100232336 3300005337 Bacteria 1319
20 Ga0068868_100167508 3300005338 Bacteria 1818
21 Ga0070660_100033353 3300005339 Bacteria 3881
22 Ga0070660_100164698 3300005339 Bacteria 1788
23 Ga0070660_100611859 3300005339 Bacteria 911
24 Ga0070661_100020030 3300005344 Bacteria 4769
25 Ga0070661_100026629 3300005344 Bacteria 4160
26 Ga0070668_100121958 3300005347 Bacteria 2085
27 Ga0070669_100082548 3300005353 Bacteria 2396
28 Ga0070675_100015068 3300005354 Bacteria 6106
29 Ga0070671_100025083 3300005355 Bacteria 4888
30 Ga0070671_100300986 3300005355 Bacteria 1365
31 Ga0070674_100039945 3300005356 Bacteria 3171
32 Ga0070674_100381957 3300005356 Bacteria 1146
33 Ga0070673_100047002 3300005364 Bacteria 3356
34 Ga0070688_100037783 3300005365 Bacteria 2944
35 Ga0070659_100080917 3300005366 Bacteria 2594
36 Ga0070659_100190570 3300005366 Bacteria 1685
37 Ga0070667_100073950 3300005367 Bacteria 2907
38 Ga0070667_100119599 3300005367 Bacteria 2291
39 Ga0070667_100297017 3300005367 Bacteria 1454
40 Ga0070701_10022510 3300005438 Bacteria 3021
41 Ga0070700_100091583 3300005441 Bacteria 1985
42 Ga0070694_100030466 3300005444 Bacteria 3529
43 Ga0070663_100109633 3300005455 Bacteria 2073
44 Ga0070663_100182228 3300005455 Bacteria 1630
45 Ga0070663_100905174 3300005455 Bacteria 762
46 Ga0070663_101026111 3300005455 Bacteria 718
47 Ga0070662_100037162 3300005457 Bacteria 3451
48 Ga0070662_100128742 3300005457 Bacteria 1949
49 Ga0070681_10381031 3300005458 Bacteria 1321
50 Ga0070685_10086759 3300005466 Bacteria 1887
51 Ga0070679_100018255 3300005530 Bacteria 6804
52 Ga0070679_100159587 3300005530 Bacteria 2229
53 Ga0070679_100738288 3300005530 Bacteria 927
54 Ga0070684_100048487 3300005535 Bacteria 3685
55 Ga0070684_100053855 3300005535 Bacteria 3504
56 Ga0070684_100210829 3300005535 Bacteria 1770
57 Ga0070684_100937413 3300005535 Bacteria 812
58 Ga0068853_100242003 3300005539 Bacteria 1654
59 Ga0070672_100041170 3300005543 Bacteria 3550
60 Ga0070672_100111292 3300005543 Bacteria 2232
61 Ga0070672_100671887 3300005543 Bacteria 906
62 Ga0070686_100023775 3300005544 Bacteria 3667
63 Ga0070686_100076689 3300005544 Bacteria 2202
64 Ga0070696_100282783 3300005546 Bacteria 1265
65 Ga0070693_100184646 3300005547 Bacteria 1345
66 Ga0070665_100000597 3300005548 Bacteria 50189
67 Ga0070704_100016422 3300005549 Bacteria 4677
68 Ga0068855_100000105 3300005563 Bacteria 104272
69 Ga0070664_100032602 3300005564 Bacteria 4358
70 Ga0070664_100223895 3300005564 Bacteria 1684
71 Ga0070664_100241265 3300005564 Bacteria 1622
72 Ga0068857_100205556 3300005577 Bacteria 1796
73 Ga0068857_100293004 3300005577 Bacteria 1499
74 Ga0068854_100076676 3300005578 Bacteria 2458
75 Ga0068856_100542844 3300005614 Bacteria 1184
76 Ga0068852_100102045 3300005616 Bacteria 2592
77 Ga0068852_100141566 3300005616 Bacteria 2227
78 Ga0068852_100291167 3300005616 Bacteria 1577
79 Ga0068859_100014063 3300005617 Bacteria 8027
80 Ga0068859_100036443 3300005617 Bacteria 4938
81 Ga0068859_100489104 3300005617 Bacteria 1326
82 Ga0068859_101308044 3300005617 Bacteria 799
83 Ga0068864_100042120 3300005618 Bacteria 3907
84 Ga0068864_100751366 3300005618 Bacteria 956
85 Ga0068866_10009200 3300005718 Bacteria 4187
86 Ga0068861_100008402 3300005719 Bacteria 7107
87 Ga0068863_100028315 3300005841 Bacteria 5350
88 Ga0068863_100072755 3300005841 Bacteria 3252
89 Ga0068858_100007262 3300005842 Bacteria 10735
90 Ga0068860_100057624 3300005843 Bacteria 3693
91 Ga0068862_100002215 3300005844 Bacteria 17418
92 Ga0068862_100024881 3300005844 Bacteria 5024
93 Ga0068862_100079421 3300005844 Bacteria 2844
94 Ga0068862_100210784 3300005844 Bacteria 1755
95 Ga0081539_10002635 3300005985 Bacteria 24522
96 Ga0081539_10009384 3300005985 Bacteria 8189
97 Ga0081539_10371825 3300005985 Bacteria 597
98 Ga0075368_10007188 3300006042 Bacteria 3924
99 Ga0075363_100016516 3300006048 Bacteria 3646
100 Ga0075363_100187421 3300006048 Bacteria 1179
101 Ga0075364_10056544 3300006051 Bacteria 2569
102 Ga0075362_10056748 3300006177 Bacteria 1763
103 Ga0075367_10002399 3300006178 Bacteria 8550
104 Ga0075367_10041795 3300006178 Bacteria 2681
105 Ga0075367_10269059 3300006178 Bacteria 1070
106 Ga0097621_100055559 3300006237 Bacteria 3233
107 Ga0097621_100158462 3300006237 Bacteria 1944
108 Ga0097621_100336496 3300006237 Bacteria 1340
109 Ga0097621_100369019 3300006237 Bacteria 1280
110 Ga0097621_100721661 3300006237 Bacteria 919
111 Ga0075370_10321095 3300006353 Bacteria 922
112 Ga0068871_100044160 3300006358 Bacteria 3582
113 Ga0068871_100116936 3300006358 Bacteria 2248
114 Ga0068871_100154951 3300006358 Bacteria 1956
115 Ga0075428_100410561 3300006844 Bacteria 1451
116 Ga0075433_10389752 3300006852 Bacteria 1229
117 Ga0075434_100051333 3300006871 Bacteria 4099
118 Ga0075429_101147450 3300006880 Bacteria 678
119 Ga0097620_100014063 3300006931 Bacteria 8027
120 Ga0097620_100036444 3300006931 Bacteria 4938
121 Ga0097620_100489038 3300006931 Bacteria 1326
122 Ga0097620_101307585 3300006931 Bacteria 799
123 Ga0075435_100072616 3300007076 Bacteria 2811
124 Ga0105244_10265651 3300009036 Bacteria 798
125 Ga0105240_10000444 3300009093 Bacteria 76383
126 Ga0111539_10005443 3300009094 Bacteria 16467
127 Ga0111539_10005878 3300009094 Bacteria 15845
128 Ga0111539_10127133 3300009094 Bacteria 2985
129 Ga0111539_11157639 3300009094 Bacteria 899
130 Ga0105245_10019855 3300009098 Bacteria 5890
131 Ga0105245_10027320 3300009098 Bacteria 5028
132 Ga0105245_10071300 3300009098 Bacteria 3156
133 Ga0105245_10218100 3300009098 Bacteria 1839
134 Ga0105247_10022185 3300009101 Bacteria 3822
135 Ga0105247_10237811 3300009101 Bacteria 1239
136 Ga0114129_12420137 3300009147 Bacteria 629
137 Ga0105243_10134501 3300009148 Bacteria 2102
138 Ga0105248_10013268 3300009177 Bacteria 9070
139 Ga0105248_10016140 3300009177 Bacteria 8217
140 Ga0105248_10058359 3300009177 Bacteria 4334
141 Ga0105248_10286714 3300009177 Bacteria 1854
142 Ga0105248_11221262 3300009177 Bacteria 850
143 Ga0105238_10104567 3300009551 Bacteria 2812
144 Ga0105238_10608744 3300009551 Bacteria 1101
145 Ga0105249_10038478 3300009553 Bacteria 4341
146 Ga0105239_10021339 3300010375 Bacteria 7142
147 Ga0105239_10051265 3300010375 Bacteria 4525
148 Ga0105239_10092532 3300010375 Bacteria 3338
149 Ga0105239_10099491 3300010375 Bacteria 3215
150 Ga0105239_10206839 3300010375 Bacteria 2199
151 Ga0105246_10024730 3300011119 Bacteria 3906
152 Ga0105246_10303686 3300011119 Bacteria 1290
153 Ga0157373_10398043 3300013100 Bacteria 987
154 Ga0171463_1003 3300013249 Bacteria 695693
155 Ga0157374_10065686 3300013296 Bacteria 3408
156 Ga0157374_10383494 3300013296 Bacteria 1400
157 Ga0157378_10050076 3300013297 Bacteria 3717
158 Ga0157378_10140473 3300013297 Bacteria 2243
159 Ga0157378_11146743 3300013297 Bacteria 815
160 Ga0163162_10220314 3300013306 Bacteria 2027
161 Ga0163162_10581297 3300013306 Bacteria 1247
162 Ga0157372_10248489 3300013307 Bacteria 2064
163 Ga0157372_10327224 3300013307 Bacteria 1784
164 Ga0157375_10635694 3300013308 Bacteria 1224
165 Ga0157375_10950963 3300013308 Bacteria 1001
166 Ga0163163_10051906 3300014325 Bacteria 4044
167 Ga0163163_10104634 3300014325 Bacteria 2856
168 Ga0157380_10059106 3300014326 Bacteria 3058
169 Ga0157380_10136875 3300014326 Bacteria 2098
170 Ga0157380_10722528 3300014326 Bacteria 1004
171 Ga0157377_10578747 3300014745 Bacteria 797
172 Ga0157376_10029818 3300014969 Bacteria 4349
173 Ga0157376_10152797 3300014969 Bacteria 2084
174 Ga0157376_10532427 3300014969 Bacteria 1160
175 Ga0183363_1085 3300015690 Bacteria 28396
176 Ga0163161_10032613 3300017792 Bacteria 3720
177 Ga0163161_10065879 3300017792 Bacteria 2644
178 Ga0207427_101445 3300025231 Bacteria 8567
179 Ga0209233_1001648 3300025261 Bacteria 8689
180 Ga0209673_1001862 3300025273 Bacteria 17116
181 Ga0209564_1001123 3300025295 Bacteria 31480
182 Ga0209564_1002804 3300025295 Bacteria 12968
183 Ga0209758_1000008 3300025297 Bacteria 1215263
184 Ga0209256_1001599 3300025299 Bacteria 22178
185 Ga0207656_10047661 3300025321 Bacteria 1843
186 Ga0207656_10085466 3300025321 Bacteria 1424
187 Ga0207682_10217742 3300025893 Bacteria 882
188 Ga0207682_10270315 3300025893 Bacteria 794
189 Ga0207710_10014652 3300025900 Bacteria 3309
190 Ga0207710_10173745 3300025900 Bacteria 1054
191 Ga0207645_10050611 3300025907 Bacteria 2653
192 Ga0207705_10074917 3300025909 Bacteria 2457
193 Ga0207707_10045462 3300025912 Bacteria 3826
194 Ga0207695_10000004 3300025913 Bacteria 1288665
195 Ga0207662_10004975 3300025918 Bacteria 7031
196 Ga0207657_10011367 3300025919 Bacteria 8844
197 Ga0207657_10138836 3300025919 Bacteria 1987
198 Ga0207657_10514169 3300025919 Bacteria 937
199 Ga0207657_10759034 3300025919 Bacteria 751
200 Ga0207649_10016710 3300025920 Bacteria 4146
201 Ga0207649_10059004 3300025920 Bacteria 2406
202 Ga0207649_10083393 3300025920 Bacteria 2075
203 Ga0207649_10463181 3300025920 Bacteria 959
204 Ga0207652_10063371 3300025921 Bacteria 3197
205 Ga0207681_10003774 3300025923 Bacteria 9413
206 Ga0207694_10435733 3300025924 Bacteria 1093
207 Ga0207650_10125373 3300025925 Bacteria 2004
208 Ga0207687_10351589 3300025927 Bacteria 1201
209 Ga0207644_10012726 3300025931 Bacteria 5594
210 Ga0207690_10033963 3300025932 Bacteria 3283
211 Ga0207706_10295397 3300025933 Bacteria 1412
212 Ga0207706_10983234 3300025933 Bacteria 710
213 Ga0207709_10266395 3300025935 Bacteria 1259
214 Ga0207670_10013302 3300025936 Bacteria 4846
215 Ga0207669_10848249 3300025937 Bacteria 760
216 Ga0207665_10821708 3300025939 Bacteria 735
217 Ga0207691_10040471 3300025940 Bacteria 4305
218 Ga0207691_10480112 3300025940 Bacteria 1056
219 Ga0207711_10132510 3300025941 Bacteria 2236
220 Ga0207711_10163161 3300025941 Bacteria 2018
221 Ga0207711_10281783 3300025941 Bacteria 1531
222 Ga0207711_10732954 3300025941 Bacteria 922
223 Ga0207711_11026090 3300025941 Bacteria 765
224 Ga0207661_10012825 3300025944 Bacteria 6106
225 Ga0207661_10231708 3300025944 Bacteria 1636
226 Ga0207661_10632948 3300025944 Bacteria 983
227 Ga0207661_10671395 3300025944 Bacteria 953
228 Ga0207679_10146947 3300025945 Bacteria 1913
229 Ga0207667_10000012 3300025949 Bacteria 445492
230 Ga0207667_10159265 3300025949 Bacteria 2322
231 Ga0207651_10071914 3300025960 Bacteria 2454
232 Ga0207651_10161525 3300025960 Bacteria 1757
233 Ga0207712_10002882 3300025961 Bacteria 10996
234 Ga0207668_10049147 3300025972 Bacteria 2898
235 Ga0207640_10347731 3300025981 Bacteria 1190
236 Ga0207658_10252647 3300025986 Bacteria 1499
237 Ga0207658_10267944 3300025986 Bacteria 1458
238 Ga0207703_10472753 3300026035 Bacteria 1174
239 Ga0207703_10637818 3300026035 Bacteria 1010
240 Ga0207639_10041343 3300026041 Bacteria 3448
241 Ga0207639_10379791 3300026041 Bacteria 1269
242 Ga0207678_10075969 3300026067 Bacteria 2877
243 Ga0207678_10546763 3300026067 Bacteria 1012
244 Ga0207702_10634985 3300026078 Bacteria 1050
245 Ga0207641_10422805 3300026088 Bacteria 1283
246 Ga0207641_10602793 3300026088 Bacteria 1075
247 Ga0207648_10004407 3300026089 Bacteria 14462
248 Ga0207648_10188583 3300026089 Bacteria 1827
249 Ga0207676_10025751 3300026095 Bacteria 4367
250 Ga0207676_11005993 3300026095 Bacteria 821
251 Ga0207674_10034881 3300026116 Bacteria 5254
252 Ga0207674_10172797 3300026116 Bacteria 2114
253 Ga0207674_10257778 3300026116 Bacteria 1691
254 Ga0207674_10304545 3300026116 Bacteria 1543
255 Ga0207675_100001134 3300026118 Bacteria 26415
256 Ga0207675_100009306 3300026118 Bacteria 9215
257 Ga0207683_10017710 3300026121 Bacteria 6075
258 Ga0207683_10096701 3300026121 Bacteria 2633
259 Ga0207683_10247980 3300026121 Bacteria 1625
260 Ga0207698_10102433 3300026142 Bacteria 2377
261 Ga0207698_10126128 3300026142 Bacteria 2177
262 Ga0207698_10547703 3300026142 Bacteria 1133
263 Ga0209813_10007562 3300027866 Bacteria 2709
264 Ga0207428_10137984 3300027907 Bacteria 1864
265 Ga0207428_10255202 3300027907 Bacteria 1307
266 Ga0207428_10810115 3300027907 Bacteria 665
267 Ga0268266_10001014 3300028379 Bacteria 35389
268 Ga0268266_10003004 3300028379 Bacteria 17352
269 Ga0268265_10001596 3300028380 Bacteria 18723
270 Ga0268265_10050657 3300028380 Bacteria 3130
271 Ga0268264_10085376 3300028381 Bacteria 2709
272 Ga0265338_10050337 3300028800 Bacteria 3767
273 Ga0307513_10042528 3300031456 Bacteria 5002
274 Ga0307408_100067420 3300031548 Bacteria 2632
275 Ga0307408_100135540 3300031548 Bacteria 1926
276 Ga0307408_100412516 3300031548 Bacteria 1162
277 Ga0307408_100522861 3300031548 Bacteria 1042
278 Ga0307408_100668246 3300031548 Bacteria 931
279 Ga0307405_10115922 3300031731 Bacteria 1824
280 Ga0307405_10193262 3300031731 Bacteria 1472
281 Ga0307405_10245674 3300031731 Bacteria 1328
282 Ga0307405_10622038 3300031731 Bacteria 884
283 Ga0307405_10922092 3300031731 Bacteria 740
284 Ga0307413_10084714 3300031824 Bacteria 2044
285 Ga0307413_10094249 3300031824 Bacteria 1959
286 Ga0307413_10129844 3300031824 Bacteria 1722
287 Ga0307413_10165637 3300031824 Bacteria 1558
288 Ga0307413_10377737 3300031824 Bacteria 1103
289 Ga0307413_10433692 3300031824 Bacteria 1038
290 Ga0307410_10298589 3300031852 Bacteria 1270
291 Ga0307410_10315228 3300031852 Bacteria 1239
292 Ga0307410_10492332 3300031852 Bacteria 1007
293 Ga0307410_10626176 3300031852 Bacteria 900
294 Ga0307410_10787284 3300031852 Bacteria 808
295 Ga0307410_10878340 3300031852 Bacteria 767
296 Ga0326468_10057804 3300031889 Bacteria 608
297 Ga0307406_10369844 3300031901 Bacteria 1127
298 Ga0307407_10004802 3300031903 Bacteria 5788
299 Ga0307407_10392591 3300031903 Bacteria 993
300 Ga0307407_10495741 3300031903 Bacteria 894
301 Ga0307412_10008352 3300031911 Bacteria 5904
302 Ga0307412_10011035 3300031911 Bacteria 5221
303 Ga0307412_10072007 3300031911 Bacteria 2361
304 Ga0307409_100052928 3300031995 Bacteria 3116
305 Ga0307409_100107929 3300031995 Bacteria 2327
306 Ga0307409_100142138 3300031995 Bacteria 2069
307 Ga0307409_100212236 3300031995 Bacteria 1740
308 Ga0307409_100420090 3300031995 Bacteria 1282
309 Ga0307416_100069356 3300032002 Bacteria 2917
310 Ga0307416_100133400 3300032002 Bacteria 2241
311 Ga0307416_100197182 3300032002 Bacteria 1906
312 Ga0307416_100787490 3300032002 Bacteria 1046
313 Ga0307416_100791612 3300032002 Bacteria 1043
314 Ga0307416_100952523 3300032002 Bacteria 960
315 Ga0307414_10078529 3300032004 Bacteria 2406
316 Ga0307414_10137361 3300032004 Bacteria 1908
317 Ga0307414_10153596 3300032004 Bacteria 1819
318 Ga0307414_10330641 3300032004 Bacteria 1301
319 Ga0307414_10425032 3300032004 Bacteria 1159
320 Ga0307414_10803130 3300032004 Bacteria 858
321 Ga0307414_10858375 3300032004 Bacteria 830
322 Ga0307411_10276912 3300032005 Bacteria 1333
323 Ga0307411_10391224 3300032005 Bacteria 1146
324 Ga0307415_100107808 3300032126 Bacteria 2059
325 Ga0307415_100193385 3300032126 Bacteria 1607
326 Ga0307415_100253722 3300032126 Bacteria 1431
327 Ga0307415_100295176 3300032126 Bacteria 1340
328 Ga0307415_100337287 3300032126 Bacteria 1264
329 Ga0307415_100527721 3300032126 Bacteria 1037
330 Ga0307415_100555418 3300032126 Bacteria 1014
331 Ga0307415_100662843 3300032126 Bacteria 937
332 Ga0373948_0038329 3300034817 Bacteria 994
333 Ga0373959_0077913 3300034820 Bacteria 759
334 Ga0373931_0041048 3300035691 Bacteria 2430
335 Ga0373937_0259727 3300036401 Bacteria 1638
336 Ga0395899_0339752 3300037312 Bacteria 1007
337 Ga0451802_1636167 3300041460 Bacteria 836
338 Ga0451804_0655400 3300041463 Bacteria 696
339 Ga0451853_3176257 3300041512 Bacteria 1383
340 Ga0439431_0103158 3300041997 Bacteria 785
341 Ga0439455_0026710 3300042012 Bacteria 1411
342 Ga0450894_001409 3300042131 Bacteria 3470
343 Ga0450895_001528 3300042132 Bacteria 1616
344 Ga0450896_002695 3300042133 Bacteria 2312
345 Ga0450910_009382 3300042147 Bacteria 1386
346 Ga0439446_0075614 3300042156 Bacteria 1036
347 Ga0439446_0130757 3300042156 Bacteria 814
348 Ga0439446_0175352 3300042156 Unclassified 715
349 Ga0450893_0085376 3300042532 Bacteria 628
350 Ga0453684_0038911 3300044712 Bacteria 6489
351 Ga0453684_0277670 3300044712 Bacteria 1912
352 Ga0451576_0013960 3300045051 Bacteria 8961
353 Ga0495605_0174506 3300046474 Bacteria 948
354 Ga0495664_0355070 3300046477 Bacteria 882
355 Ga0495583_0010998 3300046506 Bacteria 5220
356 Ga0495616_0031532 3300046513 Bacteria 2774
357 Ga0495631_0023058 3300046518 Bacteria 2889
358 Ga0495644_0050110 3300046523 Bacteria 1567
359 Ga0495663_0061132 3300046525 Bacteria 1184
360 Ga0495652_0153101 3300046529 Bacteria 1799
361 Ga0495640_0070274 3300046533 Bacteria 2353
362 Ga0495633_0138624 3300046558 Bacteria 1125
363 Ga0495667_0100719 3300046559 Bacteria 1869
364 Ga0495668_0000089 3300046616 Bacteria 145477
365 Ga0495668_0011942 3300046616 Bacteria 5173
366 Ga0495635_0228934 3300046663 Bacteria 1256
367 Ga0495623_0035127 3300046679 Bacteria 3213
368 Ga0495669_0035215 3300046684 Bacteria 2210
369 Ga0495669_0052689 3300046684 Bacteria 1829
370 Ga0495670_0082396 3300046691 Bacteria 1640
371 Ga0495670_0186826 3300046691 Bacteria 1095
372 Ga0495649_0074191 3300046694 Bacteria 1822
373 Ga0495649_0432056 3300046694 Bacteria 659
374 Ga0495600_0079544 3300046809 Bacteria 2140
375 Ga0495674_0007011 3300047319 Bacteria 10782
376 Ga0495683_0020437 3300047323 Bacteria 3415
377 Ga0495681_0066395 3300047470 Bacteria 1646
378 Ga0495684_0019807 3300047471 Bacteria 5184
379 Ga0495602_0419069 3300048088 Bacteria 951
380 Ga0495626_0058593 3300048091 Bacteria 1759
381 Ga0496100_0048167 3300048903 Bacteria 2750
382 Ga0496100_0103131 3300048903 Bacteria 1969
383 Ga0496101_0000588 3300048904 Bacteria 22146
384 Ga0496101_0041125 3300048904 Bacteria 3295
385 Ga0496101_0983767 3300048904 Bacteria 664
386 Ga0496102_0074069 3300048905 Bacteria 3130
387 Ga0496102_0451995 3300048905 Bacteria 1205
388 Ga0496104_0019336 3300048907 Bacteria 6229
389 Ga0496104_0045215 3300048907 Bacteria 4140
390 Ga0496105_0013920 3300048908 Bacteria 6393
391 Ga0496105_0020348 3300048908 Bacteria 5361
392 Ga0496106_0328173 3300048909 Bacteria 1228
393 Ga0496106_0393698 3300048909 Bacteria 1113
394 Ga0496107_0060297 3300048910 Bacteria 2746
395 Ga0496108_0212699 3300048911 Bacteria 1678
396 Ga0496108_0479149 3300048911 Bacteria 1087
397 Ga0496108_0953471 3300048911 Bacteria 734
398 Ga0496109_0154214 3300048912 Bacteria 2151
399 Ga0496112_0000007 3300048915 Bacteria 338850
400 Ga0496112_0015023 3300048915 Bacteria 7208
401 Ga0496113_0056419 3300048916 Bacteria 2949
402 Ga0496114_0000328 3300048917 Bacteria 34453
403 Ga0496114_0010181 3300048917 Bacteria 7481
404 Ga0496114_0308211 3300048917 Bacteria 1398
405 Ga0496114_0365614 3300048917 Bacteria 1276
406 Ga0496115_0004376 3300048918 Bacteria 10231
407 Ga0496115_0220707 3300048918 Bacteria 1564
408 Ga0496118_0005463 3300048921 Bacteria 14439
409 Ga0496126_0046759 3300048929 Plasmid 3966
410 Ga0495678_001739 3300049459 Bacteria 16208
411 Ga0495682_0007699 3300049460 Bacteria 4273
412 Ga0501290_003982 3300049513 Bacteria 1847
413 Ga0501291_035635 3300049514 Bacteria 856
414 Ga0501292_002962 3300049515 Bacteria 2232
415 Ga0501292_006330 3300049515 Bacteria 1678
416 Ga0501032_0068171 3300049569 Bacteria 2376
417 Ga0501032_0118965 3300049569 Bacteria 1747
418 Ga0501033_0208001 3300049570 Bacteria 1396
419 Ga0501034_0088559 3300049571 Bacteria 3093
420 Ga0501037_0127748 3300049573 Bacteria 1824
421 Ga0501040_0003561 3300049576 Bacteria 10068
422 Ga0501040_0766514 3300049576 Bacteria 698
423 Ga0501043_0133200 3300049579 Bacteria 1948
424 Ga0501043_1109856 3300049579 Bacteria 559
425 Ga0501070_0565759 3300049586 Bacteria 909
426 Ga0501073_0228741 3300049589 Bacteria 1285
427 Ga0501201_001670 3300049651 Bacteria 2064
428 Ga0501202_028401 3300049652 Bacteria 1154
429 Ga0501209_004778 3300049656 Bacteria 2387
430 Ga0501217_002943 3300049661 Bacteria 3407
431 Ga0501223_028770 3300049663 Bacteria 1081
432 Ga0501228_014786 3300049666 Bacteria 827
433 Ga0501233_016129 3300049668 Bacteria 1546
434 Ga0501235_000593 3300049669 Bacteria 7305
435 Ga0501240_012404 3300049673 Bacteria 1165
436 Ga0501252_001668 3300049682 Bacteria 2097
437 Ga0501257_013555 3300049686 Bacteria 1870
438 Ga0501259_003450 3300049688 Bacteria 2520
439 Ga0501221_002808 3300049704 Bacteria 2867
440 Ga0501225_0002184 3300049705 Bacteria 6049
441 Ga0501234_005122 3300049707 Bacteria 2051
442 Ga0501080_0430930 3300049742 Bacteria 1184
443 Ga0501081_0200730 3300049743 Bacteria 1446
444 Ga0501083_0417233 3300049744 Bacteria 873
445 Ga0501265_007142 3300049762 Bacteria 1309
446 Ga0501266_003058 3300049763 Bacteria 2082
447 Ga0501268_000657 3300049765 Bacteria 3896
448 Ga0501270_006730 3300049767 Bacteria 1394
449 Ga0501274_007937 3300049771 Bacteria 943
450 Ga0501035_0063277 3300049822 Bacteria 3291
451 Ga0501044_0087465 3300049823 Bacteria 3148
452 Ga0501044_0102176 3300049823 Bacteria 2883
453 Ga0501204_010978 3300049850 Bacteria 1070
454 nmdc:mga03n38_11042_c1 3300050490 Bacteria 3350
455 nmdc:mga00v17_218050_c1 3300050491 Bacteria 1235
456 nmdc:mga0yw44_73675_c1 3300050492 Bacteria 2125
457 nmdc:mga0k408_43384_c1 3300050493 Bacteria 2591
458 nmdc:mga06z11_11042_c1 3300050494 Bacteria 3877
459 nmdc:mga07m45_128525_c1 3300050496 Bacteria 1466
460 nmdc:mga07m45_185518_c1 3300050496 Bacteria 1209
461 nmdc:mga08y16_339771_c1 3300050511 Bacteria 1544
462 nmdc:mga08y16_36188_c1 3300050511 Bacteria 5184
463 nmdc:mga08y16_5852_c1 3300050511 Bacteria 12882
464 nmdc:mga08y16_728007_c1 3300050511 Bacteria 990
465 nmdc:mga0n895_49020_c1 3300050512 Bacteria 4136
466 nmdc:mga0rr50_17782_c1 3300050513 Bacteria 4758
467 nmdc:mga0a205_23382_c1 3300050515 Bacteria 5862
468 nmdc:mga0a205_949193_c1 3300050515 Bacteria 707
469 nmdc:mga0sz30_25492_c1 3300050516 Bacteria 2418
470 Ga0500641_0145770 3300053096 Bacteria 1023
471 Ga0500562_006009 3300053108 Bacteria 3057
472 Ga0500595_024357 3300053119 Bacteria 2114
473 Ga0500568_0000531 3300053139 Bacteria 28187
474 Ga0500573_0030511 3300053140 Bacteria 3110
475 Ga0500604_0002864 3300053151 Bacteria 4676
476 Ga0500616_0000773 3300053153 Bacteria 36808
477 Ga0500616_0005081 3300053153 Bacteria 9081
478 Ga0500634_0000025 3300053161 Bacteria 81954
479 Ga0500611_001614 3300053727 Bacteria 2531
480 Ga0501084_0488129 3300054114 Bacteria 1041
481 Ga0501084_1515929 3300054114 Unclassified 561
482 Ga0501082_0702112 3300060353 Bacteria 885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046684 Ga0495669_0052689 Ga0495669_0052689_1180_1689 154
2 3300003322 rootL2_10216573 rootL2_102165732 159
3 3300005356 Ga0070674_100381957 Ga0070674_1003819572 161
4 3300005364 Ga0070673_100047002 Ga0070673_1000470023 161
5 3300025893 Ga0207682_10217742 Ga0207682_102177422 161
6 3300025960 Ga0207651_10161525 Ga0207651_101615253 161
7 3300005329 Ga0070683_100064682 Ga0070683_1000646822 164
8 3300005366 Ga0070659_100190570 Ga0070659_1001905701 164
9 3300005535 Ga0070684_100053855 Ga0070684_1000538553 164
10 3300005564 Ga0070664_100223895 Ga0070664_1002238952 164
11 3300049579 Ga0501043_1109856 Ga0501043_1109856_18_527 165
12 3300031548 Ga0307408_100668246 Ga0307408_1006682461 166
13 3300042147 Ga0450910_009382 Ga0450910_009382_84_677 166
14 3300042156 Ga0439446_0175352 Ga0439446_0175352_126_683 166
15 3300006048 Ga0075363_100187421 Ga0075363_1001874211 167
16 3300009094 Ga0111539_10005443 Ga0111539_100054439 167
17 3300009094 Ga0111539_10005878 Ga0111539_1000587811 167
18 3300009098 Ga0105245_10218100 Ga0105245_102181002 167
19 3300009177 Ga0105248_10058359 Ga0105248_100583594 167
20 3300009551 Ga0105238_10104567 Ga0105238_101045671 167
21 3300009551 Ga0105238_10608744 Ga0105238_106087442 167
22 3300010375 Ga0105239_10051265 Ga0105239_100512656 167
23 3300010375 Ga0105239_10092532 Ga0105239_100925321 167
24 3300013100 Ga0157373_10398043 Ga0157373_103980432 167
25 3300013297 Ga0157378_10050076 Ga0157378_100500766 167
26 3300013297 Ga0157378_11146743 Ga0157378_111467431 167
27 3300014326 Ga0157380_10059106 Ga0157380_100591066 167
28 3300014745 Ga0157377_10578747 Ga0157377_105787472 167
29 3300017792 Ga0163161_10032613 Ga0163161_100326135 167
30 3300034817 Ga0373948_0038329 Ga0373948_0038329_154_681 167
31 3300034820 Ga0373959_0077913 Ga0373959_0077913_106_633 167
32 3300035691 Ga0373931_0041048 Ga0373931_0041048_854_1381 167
33 3300042131 Ga0450894_001409 Ga0450894_001409_2791_3300 167
34 3300042132 Ga0450895_001528 Ga0450895_001528_374_883 167
35 3300042133 Ga0450896_002695 Ga0450896_002695_894_1403 167
36 3300042156 Ga0439446_0130757 Ga0439446_0130757_25_534 167
37 3300046506 Ga0495583_0010998 Ga0495583_0010998_2397_2906 167
38 3300046513 Ga0495616_0031532 Ga0495616_0031532_571_1080 167
39 3300046518 Ga0495631_0023058 Ga0495631_0023058_546_1055 167
40 3300046523 Ga0495644_0050110 Ga0495644_0050110_655_1164 167
41 3300046525 Ga0495663_0061132 Ga0495663_0061132_39_548 167
42 3300046616 Ga0495668_0000089 Ga0495668_0000089_38271_38780 167
43 3300046691 Ga0495670_0082396 Ga0495670_0082396_456_965 167
44 3300046694 Ga0495649_0074191 Ga0495649_0074191_667_1176 167
45 3300047323 Ga0495683_0020437 Ga0495683_0020437_2781_3290 167
46 3300047470 Ga0495681_0066395 Ga0495681_0066395_404_913 167
47 3300048091 Ga0495626_0058593 Ga0495626_0058593_793_1302 167
48 3300048911 Ga0496108_0212699 Ga0496108_0212699_492_1019 167
49 3300049459 Ga0495678_001739 Ga0495678_001739_2090_2599 167
50 3300049460 Ga0495682_0007699 Ga0495682_0007699_3102_3611 167
51 3300049569 Ga0501032_0118965 Ga0501032_0118965_422_931 167
52 3300049579 Ga0501043_0133200 Ga0501043_0133200_15_524 167
53 3300049589 Ga0501073_0228741 Ga0501073_0228741_368_877 167
54 3300049651 Ga0501201_001670 Ga0501201_001670_1123_1632 167
55 3300049682 Ga0501252_001668 Ga0501252_001668_469_978 167
56 3300049823 Ga0501044_0087465 Ga0501044_0087465_1565_2074 167
57 3300050491 nmdc:mga00v17_218050_c1 nmdc:mga00v17_218050_c1_32_541 167
58 3300050493 nmdc:mga0k408_43384_c1 nmdc:mga0k408_43384_c1_243_752 167
59 3300050496 nmdc:mga07m45_185518_c1 nmdc:mga07m45_185518_c1_344_871 167
60 3300050511 nmdc:mga08y16_36188_c1 nmdc:mga08y16_36188_c1_32_541 167
61 3300050511 nmdc:mga08y16_5852_c1 nmdc:mga08y16_5852_c1_6674_7183 167
62 3300050515 nmdc:mga0a205_23382_c1 nmdc:mga0a205_23382_c1_5148_5657 167
63 3300054114 Ga0501084_1515929 Ga0501084_1515929_13_522 167
64 iso_pu_bacteria 2849573788 2849575629 169
65 iso_pu_bacteria 2513237159 2514000838 170
66 iso_pu_bacteria 2524614857 2526062971 170
67 iso_pu_bacteria 2582581316 2585330621 170
68 iso_pu_bacteria 2739367875 2740061878 170
69 iso_pu_bacteria 2842521101 2842525466 170
70 iso_pu_bacteria 2889790730 2889793871 170
71 iso_pu_bacteria 2898329390 2898331692 170
72 iso_pu_bacteria 3004334049 3004337344 170
73 3300025231 Ga0207427_101445 Ga0207427_1014457 172
74 3300025261 Ga0209233_1001648 Ga0209233_10016486 172
75 3300031731 Ga0307405_10922092 Ga0307405_109220922 173
76 3300031852 Ga0307410_10315228 Ga0307410_103152283 173
77 3300032126 Ga0307415_100527721 Ga0307415_1005277212 173
78 3300049742 Ga0501080_0430930 Ga0501080_0430930_176_703 173
79 3300049744 Ga0501083_0417233 Ga0501083_0417233_284_811 173
80 3300003215 JGI25153J46596_10000544 JGI25153J46596_1000054418 174
81 3300003320 rootH2_10018394 rootH2_100183942 174
82 3300003771 Ga0055526_1012492 Ga0055526_10124922 174
83 3300003771 Ga0055526_1028440 Ga0055526_10284402 174
84 3300003775 Ga0055524_1010220 Ga0055524_10102202 174
85 3300003790 Ga0055528_1000766 Ga0055528_100076616 174
86 3300005262 Ga0065165_1001406 Ga0065165_10014068 174
87 3300005262 Ga0065165_1003587 Ga0065165_10035872 174
88 3300005293 Ga0065715_10100722 Ga0065715_101007224 174
89 3300005293 Ga0065715_10106912 Ga0065715_101069123 174
90 3300005293 Ga0065715_10113183 Ga0065715_101131831 174
91 3300005295 Ga0065707_10555924 Ga0065707_105559241 174
92 3300005328 Ga0070676_10203919 Ga0070676_102039191 174
93 3300005329 Ga0070683_100696586 Ga0070683_1006965862 174
94 3300005331 Ga0070670_100066945 Ga0070670_1000669452 174
95 3300005336 Ga0070680_100672298 Ga0070680_1006722982 174
96 3300005337 Ga0070682_100232336 Ga0070682_1002323362 174
97 3300005338 Ga0068868_100167508 Ga0068868_1001675081 174
98 3300005339 Ga0070660_100033353 Ga0070660_1000333536 174
99 3300005339 Ga0070660_100164698 Ga0070660_1001646982 174
100 3300005339 Ga0070660_100611859 Ga0070660_1006118592 174
101 3300005344 Ga0070661_100020030 Ga0070661_1000200306 174
102 3300005344 Ga0070661_100026629 Ga0070661_1000266294 174
103 3300005347 Ga0070668_100121958 Ga0070668_1001219582 174
104 3300005353 Ga0070669_100082548 Ga0070669_1000825482 174
105 3300005354 Ga0070675_100015068 Ga0070675_1000150685 174
106 3300005355 Ga0070671_100025083 Ga0070671_1000250834 174
107 3300005355 Ga0070671_100300986 Ga0070671_1003009862 174
108 3300005356 Ga0070674_100039945 Ga0070674_1000399453 174
109 3300005365 Ga0070688_100037783 Ga0070688_1000377832 174
110 3300005366 Ga0070659_100080917 Ga0070659_1000809172 174
111 3300005367 Ga0070667_100073950 Ga0070667_1000739504 174
112 3300005367 Ga0070667_100119599 Ga0070667_1001195992 174
113 3300005367 Ga0070667_100297017 Ga0070667_1002970172 174
114 3300005438 Ga0070701_10022510 Ga0070701_100225102 174
115 3300005441 Ga0070700_100091583 Ga0070700_1000915832 174
116 3300005444 Ga0070694_100030466 Ga0070694_1000304662 174
117 3300005455 Ga0070663_100109633 Ga0070663_1001096333 174
118 3300005455 Ga0070663_100182228 Ga0070663_1001822282 174
119 3300005455 Ga0070663_100905174 Ga0070663_1009051741 174
120 3300005455 Ga0070663_101026111 Ga0070663_1010261111 174
121 3300005457 Ga0070662_100037162 Ga0070662_1000371622 174
122 3300005457 Ga0070662_100128742 Ga0070662_1001287422 174
123 3300005458 Ga0070681_10381031 Ga0070681_103810312 174
124 3300005466 Ga0070685_10086759 Ga0070685_100867592 174
125 3300005530 Ga0070679_100018255 Ga0070679_1000182553 174
126 3300005530 Ga0070679_100159587 Ga0070679_1001595875 174
127 3300005530 Ga0070679_100738288 Ga0070679_1007382882 174
128 3300005535 Ga0070684_100048487 Ga0070684_1000484874 174
129 3300005535 Ga0070684_100210829 Ga0070684_1002108292 174
130 3300005535 Ga0070684_100937413 Ga0070684_1009374131 174
131 3300005539 Ga0068853_100242003 Ga0068853_1002420031 174
132 3300005543 Ga0070672_100041170 Ga0070672_1000411702 174
133 3300005543 Ga0070672_100111292 Ga0070672_1001112924 174
134 3300005543 Ga0070672_100671887 Ga0070672_1006718872 174
135 3300005544 Ga0070686_100023775 Ga0070686_1000237753 174
136 3300005544 Ga0070686_100076689 Ga0070686_1000766892 174
137 3300005546 Ga0070696_100282783 Ga0070696_1002827832 174
138 3300005547 Ga0070693_100184646 Ga0070693_1001846462 174
139 3300005548 Ga0070665_100000597 Ga0070665_10000059739 174
140 3300005549 Ga0070704_100016422 Ga0070704_1000164224 174
141 3300005563 Ga0068855_100000105 Ga0068855_10000010581 174
142 3300005564 Ga0070664_100032602 Ga0070664_1000326023 174
143 3300005564 Ga0070664_100241265 Ga0070664_1002412653 174
144 3300005577 Ga0068857_100205556 Ga0068857_1002055562 174
145 3300005577 Ga0068857_100293004 Ga0068857_1002930042 174
146 3300005578 Ga0068854_100076676 Ga0068854_1000766762 174
147 3300005614 Ga0068856_100542844 Ga0068856_1005428442 174
148 3300005616 Ga0068852_100102045 Ga0068852_1001020455 174
149 3300005616 Ga0068852_100141566 Ga0068852_1001415663 174
150 3300005616 Ga0068852_100291167 Ga0068852_1002911672 174
151 3300005617 Ga0068859_100014063 Ga0068859_1000140636 174
152 3300005617 Ga0068859_100036443 Ga0068859_1000364433 174
153 3300005617 Ga0068859_100489104 Ga0068859_1004891042 174
154 3300005617 Ga0068859_101308044 Ga0068859_1013080441 174
155 3300005618 Ga0068864_100042120 Ga0068864_1000421203 174
156 3300005618 Ga0068864_100751366 Ga0068864_1007513661 174
157 3300005718 Ga0068866_10009200 Ga0068866_100092003 174
158 3300005719 Ga0068861_100008402 Ga0068861_1000084023 174
159 3300005841 Ga0068863_100028315 Ga0068863_1000283153 174
160 3300005841 Ga0068863_100072755 Ga0068863_1000727554 174
161 3300005842 Ga0068858_100007262 Ga0068858_1000072623 174
162 3300005843 Ga0068860_100057624 Ga0068860_1000576243 174
163 3300005844 Ga0068862_100002215 Ga0068862_10000221511 174
164 3300005844 Ga0068862_100024881 Ga0068862_1000248816 174
165 3300005844 Ga0068862_100079421 Ga0068862_1000794215 174
166 3300005844 Ga0068862_100210784 Ga0068862_1002107841 174
167 3300005985 Ga0081539_10002635 Ga0081539_100026353 174
168 3300005985 Ga0081539_10009384 Ga0081539_100093846 174
169 3300005985 Ga0081539_10371825 Ga0081539_103718251 174
170 3300006042 Ga0075368_10007188 Ga0075368_100071881 174
171 3300006048 Ga0075363_100016516 Ga0075363_1000165164 174
172 3300006051 Ga0075364_10056544 Ga0075364_100565443 174
173 3300006177 Ga0075362_10056748 Ga0075362_100567482 174
174 3300006178 Ga0075367_10002399 Ga0075367_100023995 174
175 3300006178 Ga0075367_10041795 Ga0075367_100417953 174
176 3300006178 Ga0075367_10269059 Ga0075367_102690592 174
177 3300006237 Ga0097621_100055559 Ga0097621_1000555594 174
178 3300006237 Ga0097621_100158462 Ga0097621_1001584622 174
179 3300006237 Ga0097621_100336496 Ga0097621_1003364962 174
180 3300006237 Ga0097621_100369019 Ga0097621_1003690192 174
181 3300006237 Ga0097621_100721661 Ga0097621_1007216612 174
182 3300006353 Ga0075370_10321095 Ga0075370_103210952 174
183 3300006358 Ga0068871_100044160 Ga0068871_1000441604 174
184 3300006358 Ga0068871_100116936 Ga0068871_1001169362 174
185 3300006358 Ga0068871_100154951 Ga0068871_1001549512 174
186 3300006844 Ga0075428_100410561 Ga0075428_1004105612 174
187 3300006852 Ga0075433_10389752 Ga0075433_103897522 174
188 3300006871 Ga0075434_100051333 Ga0075434_1000513337 174
189 3300006880 Ga0075429_101147450 Ga0075429_1011474501 174
190 3300006931 Ga0097620_100014063 Ga0097620_1000140636 174
191 3300006931 Ga0097620_100036444 Ga0097620_1000364442 174
192 3300006931 Ga0097620_100489038 Ga0097620_1004890382 174
193 3300006931 Ga0097620_101307585 Ga0097620_1013075851 174
194 3300007076 Ga0075435_100072616 Ga0075435_1000726162 174
195 3300009036 Ga0105244_10265651 Ga0105244_102656511 174
196 3300009093 Ga0105240_10000444 Ga0105240_1000044421 174
197 3300009094 Ga0111539_10127133 Ga0111539_101271332 174
198 3300009094 Ga0111539_11157639 Ga0111539_111576391 174
199 3300009098 Ga0105245_10019855 Ga0105245_100198553 174
200 3300009098 Ga0105245_10027320 Ga0105245_100273203 174
201 3300009098 Ga0105245_10071300 Ga0105245_100713001 174
202 3300009101 Ga0105247_10022185 Ga0105247_100221854 174
203 3300009101 Ga0105247_10237811 Ga0105247_102378112 174
204 3300009147 Ga0114129_12420137 Ga0114129_124201371 174
205 3300009148 Ga0105243_10134501 Ga0105243_101345012 174
206 3300009177 Ga0105248_10013268 Ga0105248_100132683 174
207 3300009177 Ga0105248_10016140 Ga0105248_100161408 174
208 3300009177 Ga0105248_10286714 Ga0105248_102867142 174
209 3300009177 Ga0105248_11221262 Ga0105248_112212621 174
210 3300009553 Ga0105249_10038478 Ga0105249_100384782 174
211 3300010375 Ga0105239_10021339 Ga0105239_100213392 174
212 3300010375 Ga0105239_10099491 Ga0105239_100994914 174
213 3300010375 Ga0105239_10206839 Ga0105239_102068393 174
214 3300011119 Ga0105246_10024730 Ga0105246_100247302 174
215 3300011119 Ga0105246_10303686 Ga0105246_103036862 174
216 3300013249 Ga0171463_1003 Ga0171463_1003128 174
217 3300013296 Ga0157374_10065686 Ga0157374_100656864 174
218 3300013296 Ga0157374_10383494 Ga0157374_103834942 174
219 3300013297 Ga0157378_10140473 Ga0157378_101404732 174
220 3300013306 Ga0163162_10220314 Ga0163162_102203142 174
221 3300013306 Ga0163162_10581297 Ga0163162_105812972 174
222 3300013307 Ga0157372_10248489 Ga0157372_102484892 174
223 3300013307 Ga0157372_10327224 Ga0157372_103272242 174
224 3300013308 Ga0157375_10635694 Ga0157375_106356942 174
225 3300013308 Ga0157375_10950963 Ga0157375_109509631 174
226 3300014325 Ga0163163_10051906 Ga0163163_100519062 174
227 3300014325 Ga0163163_10104634 Ga0163163_101046343 174
228 3300014326 Ga0157380_10136875 Ga0157380_101368752 174
229 3300014326 Ga0157380_10722528 Ga0157380_107225282 174
230 3300014969 Ga0157376_10029818 Ga0157376_100298184 174
231 3300014969 Ga0157376_10152797 Ga0157376_101527972 174
232 3300014969 Ga0157376_10532427 Ga0157376_105324271 174
233 3300015690 Ga0183363_1085 Ga0183363_10855 174
234 3300017792 Ga0163161_10065879 Ga0163161_100658792 174
235 3300025273 Ga0209673_1001862 Ga0209673_100186220 174
236 3300025295 Ga0209564_1001123 Ga0209564_100112314 174
237 3300025295 Ga0209564_1002804 Ga0209564_10028042 174
238 3300025297 Ga0209758_1000008 Ga0209758_10000081065 174
239 3300025299 Ga0209256_1001599 Ga0209256_10015999 174
240 3300025321 Ga0207656_10047661 Ga0207656_100476613 174
241 3300025321 Ga0207656_10085466 Ga0207656_100854663 174
242 3300025893 Ga0207682_10270315 Ga0207682_102703152 174
243 3300025900 Ga0207710_10014652 Ga0207710_100146523 174
244 3300025900 Ga0207710_10173745 Ga0207710_101737452 174
245 3300025907 Ga0207645_10050611 Ga0207645_100506113 174
246 3300025909 Ga0207705_10074917 Ga0207705_100749174 174
247 3300025912 Ga0207707_10045462 Ga0207707_100454622 174
248 3300025913 Ga0207695_10000004 Ga0207695_10000004534 174
249 3300025918 Ga0207662_10004975 Ga0207662_100049752 174
250 3300025919 Ga0207657_10011367 Ga0207657_100113679 174
251 3300025919 Ga0207657_10138836 Ga0207657_101388363 174
252 3300025919 Ga0207657_10514169 Ga0207657_105141691 174
253 3300025919 Ga0207657_10759034 Ga0207657_107590341 174
254 3300025920 Ga0207649_10016710 Ga0207649_100167102 174
255 3300025920 Ga0207649_10059004 Ga0207649_100590042 174
256 3300025920 Ga0207649_10083393 Ga0207649_100833933 174
257 3300025920 Ga0207649_10463181 Ga0207649_104631812 174
258 3300025921 Ga0207652_10063371 Ga0207652_100633712 174
259 3300025923 Ga0207681_10003774 Ga0207681_100037746 174
260 3300025924 Ga0207694_10435733 Ga0207694_104357332 174
261 3300025925 Ga0207650_10125373 Ga0207650_101253732 174
262 3300025927 Ga0207687_10351589 Ga0207687_103515891 174
263 3300025931 Ga0207644_10012726 Ga0207644_100127264 174
264 3300025932 Ga0207690_10033963 Ga0207690_100339632 174
265 3300025933 Ga0207706_10295397 Ga0207706_102953972 174
266 3300025933 Ga0207706_10983234 Ga0207706_109832341 174
267 3300025935 Ga0207709_10266395 Ga0207709_102663952 174
268 3300025936 Ga0207670_10013302 Ga0207670_100133022 174
269 3300025937 Ga0207669_10848249 Ga0207669_108482492 174
270 3300025939 Ga0207665_10821708 Ga0207665_108217081 174
271 3300025940 Ga0207691_10040471 Ga0207691_100404713 174
272 3300025940 Ga0207691_10480112 Ga0207691_104801122 174
273 3300025941 Ga0207711_10132510 Ga0207711_101325102 174
274 3300025941 Ga0207711_10163161 Ga0207711_101631613 174
275 3300025941 Ga0207711_10281783 Ga0207711_102817833 174
276 3300025941 Ga0207711_10732954 Ga0207711_107329541 174
277 3300025941 Ga0207711_11026090 Ga0207711_110260901 174
278 3300025944 Ga0207661_10012825 Ga0207661_100128256 174
279 3300025944 Ga0207661_10231708 Ga0207661_102317081 174
280 3300025944 Ga0207661_10632948 Ga0207661_106329482 174
281 3300025944 Ga0207661_10671395 Ga0207661_106713952 174
282 3300025945 Ga0207679_10146947 Ga0207679_101469473 174
283 3300025949 Ga0207667_10000012 Ga0207667_10000012352 174
284 3300025949 Ga0207667_10159265 Ga0207667_101592653 174
285 3300025960 Ga0207651_10071914 Ga0207651_100719142 174
286 3300025961 Ga0207712_10002882 Ga0207712_100028826 174
287 3300025972 Ga0207668_10049147 Ga0207668_100491472 174
288 3300025981 Ga0207640_10347731 Ga0207640_103477312 174
289 3300025986 Ga0207658_10252647 Ga0207658_102526472 174
290 3300025986 Ga0207658_10267944 Ga0207658_102679441 174
291 3300026035 Ga0207703_10472753 Ga0207703_104727532 174
292 3300026035 Ga0207703_10637818 Ga0207703_106378181 174
293 3300026041 Ga0207639_10041343 Ga0207639_100413432 174
294 3300026041 Ga0207639_10379791 Ga0207639_103797911 174
295 3300026067 Ga0207678_10075969 Ga0207678_100759692 174
296 3300026067 Ga0207678_10546763 Ga0207678_105467631 174
297 3300026078 Ga0207702_10634985 Ga0207702_106349851 174
298 3300026088 Ga0207641_10422805 Ga0207641_104228052 174
299 3300026088 Ga0207641_10602793 Ga0207641_106027932 174
300 3300026089 Ga0207648_10004407 Ga0207648_1000440710 174
301 3300026089 Ga0207648_10188583 Ga0207648_101885834 174
302 3300026095 Ga0207676_10025751 Ga0207676_100257513 174
303 3300026095 Ga0207676_11005993 Ga0207676_110059931 174
304 3300026116 Ga0207674_10034881 Ga0207674_100348811 174
305 3300026116 Ga0207674_10172797 Ga0207674_101727972 174
306 3300026116 Ga0207674_10257778 Ga0207674_102577782 174
307 3300026116 Ga0207674_10304545 Ga0207674_103045452 174
308 3300026118 Ga0207675_100001134 Ga0207675_10000113416 174
309 3300026118 Ga0207675_100009306 Ga0207675_1000093066 174
310 3300026121 Ga0207683_10017710 Ga0207683_100177107 174
311 3300026121 Ga0207683_10096701 Ga0207683_100967013 174
312 3300026121 Ga0207683_10247980 Ga0207683_102479802 174
313 3300026142 Ga0207698_10102433 Ga0207698_101024331 174
314 3300026142 Ga0207698_10126128 Ga0207698_101261284 174
315 3300026142 Ga0207698_10547703 Ga0207698_105477032 174
316 3300027866 Ga0209813_10007562 Ga0209813_100075622 174
317 3300027907 Ga0207428_10137984 Ga0207428_101379842 174
318 3300027907 Ga0207428_10255202 Ga0207428_102552022 174
319 3300027907 Ga0207428_10810115 Ga0207428_108101152 174
320 3300028379 Ga0268266_10001014 Ga0268266_1000101414 174
321 3300028379 Ga0268266_10003004 Ga0268266_100030044 174
322 3300028380 Ga0268265_10001596 Ga0268265_1000159611 174
323 3300028380 Ga0268265_10050657 Ga0268265_100506574 174
324 3300028381 Ga0268264_10085376 Ga0268264_100853762 174
325 3300028800 Ga0265338_10050337 Ga0265338_100503374 174
326 3300031456 Ga0307513_10042528 Ga0307513_100425284 174
327 3300031548 Ga0307408_100067420 Ga0307408_1000674203 174
328 3300031548 Ga0307408_100135540 Ga0307408_1001355402 174
329 3300031548 Ga0307408_100412516 Ga0307408_1004125162 174
330 3300031548 Ga0307408_100522861 Ga0307408_1005228612 174
331 3300031731 Ga0307405_10115922 Ga0307405_101159223 174
332 3300031731 Ga0307405_10193262 Ga0307405_101932622 174
333 3300031731 Ga0307405_10245674 Ga0307405_102456743 174
334 3300031731 Ga0307405_10622038 Ga0307405_106220382 174
335 3300031824 Ga0307413_10084714 Ga0307413_100847142 174
336 3300031824 Ga0307413_10094249 Ga0307413_100942492 174
337 3300031824 Ga0307413_10129844 Ga0307413_101298442 174
338 3300031824 Ga0307413_10165637 Ga0307413_101656372 174
339 3300031824 Ga0307413_10377737 Ga0307413_103777371 174
340 3300031824 Ga0307413_10433692 Ga0307413_104336921 174
341 3300031852 Ga0307410_10298589 Ga0307410_102985891 174
342 3300031852 Ga0307410_10492332 Ga0307410_104923322 174
343 3300031852 Ga0307410_10626176 Ga0307410_106261761 174
344 3300031852 Ga0307410_10787284 Ga0307410_107872841 174
345 3300031852 Ga0307410_10878340 Ga0307410_108783401 174
346 3300031889 Ga0326468_10057804 Ga0326468_100578041 174
347 3300031901 Ga0307406_10369844 Ga0307406_103698442 174
348 3300031903 Ga0307407_10004802 Ga0307407_100048022 174
349 3300031903 Ga0307407_10392591 Ga0307407_103925912 174
350 3300031903 Ga0307407_10495741 Ga0307407_104957412 174
351 3300031911 Ga0307412_10008352 Ga0307412_100083525 174
352 3300031911 Ga0307412_10011035 Ga0307412_100110352 174
353 3300031911 Ga0307412_10072007 Ga0307412_100720072 174
354 3300031995 Ga0307409_100052928 Ga0307409_1000529284 174
355 3300031995 Ga0307409_100107929 Ga0307409_1001079292 174
356 3300031995 Ga0307409_100142138 Ga0307409_1001421384 174
357 3300031995 Ga0307409_100212236 Ga0307409_1002122362 174
358 3300031995 Ga0307409_100420090 Ga0307409_1004200902 174
359 3300032002 Ga0307416_100069356 Ga0307416_1000693562 174
360 3300032002 Ga0307416_100133400 Ga0307416_1001334004 174
361 3300032002 Ga0307416_100197182 Ga0307416_1001971822 174
362 3300032002 Ga0307416_100787490 Ga0307416_1007874902 174
363 3300032002 Ga0307416_100791612 Ga0307416_1007916121 174
364 3300032002 Ga0307416_100952523 Ga0307416_1009525231 174
365 3300032004 Ga0307414_10078529 Ga0307414_100785292 174
366 3300032004 Ga0307414_10137361 Ga0307414_101373611 174
367 3300032004 Ga0307414_10153596 Ga0307414_101535963 174
368 3300032004 Ga0307414_10330641 Ga0307414_103306411 174
369 3300032004 Ga0307414_10425032 Ga0307414_104250322 174
370 3300032004 Ga0307414_10803130 Ga0307414_108031302 174
371 3300032004 Ga0307414_10858375 Ga0307414_108583752 174
372 3300032005 Ga0307411_10276912 Ga0307411_102769121 174
373 3300032005 Ga0307411_10391224 Ga0307411_103912243 174
374 3300032126 Ga0307415_100107808 Ga0307415_1001078082 174
375 3300032126 Ga0307415_100193385 Ga0307415_1001933851 174
376 3300032126 Ga0307415_100253722 Ga0307415_1002537222 174
377 3300032126 Ga0307415_100295176 Ga0307415_1002951762 174
378 3300032126 Ga0307415_100337287 Ga0307415_1003372871 174
379 3300032126 Ga0307415_100555418 Ga0307415_1005554182 174
380 3300032126 Ga0307415_100662843 Ga0307415_1006628431 174
381 3300036401 Ga0373937_0259727 Ga0373937_0259727_12_542 174
382 3300037312 Ga0395899_0339752 Ga0395899_0339752_216_746 174
383 3300041460 Ga0451802_1636167 Ga0451802_1636167_112_642 174
384 3300041463 Ga0451804_0655400 Ga0451804_0655400_21_551 174
385 3300041512 Ga0451853_3176257 Ga0451853_3176257_810_1340 174
386 3300041997 Ga0439431_0103158 Ga0439431_0103158_188_718 174
387 3300042012 Ga0439455_0026710 Ga0439455_0026710_491_1030 174
388 3300042156 Ga0439446_0075614 Ga0439446_0075614_485_1015 174
389 3300042532 Ga0450893_0085376 Ga0450893_0085376_46_576 174
390 3300044712 Ga0453684_0038911 Ga0453684_0038911_1192_1722 174
391 3300044712 Ga0453684_0277670 Ga0453684_0277670_1127_1672 174
392 3300045051 Ga0451576_0013960 Ga0451576_0013960_3440_3970 174
393 3300046474 Ga0495605_0174506 Ga0495605_0174506_159_689 174
394 3300046477 Ga0495664_0355070 Ga0495664_0355070_291_821 174
395 3300046529 Ga0495652_0153101 Ga0495652_0153101_110_640 174
396 3300046533 Ga0495640_0070274 Ga0495640_0070274_18_548 174
397 3300046558 Ga0495633_0138624 Ga0495633_0138624_34_564 174
398 3300046559 Ga0495667_0100719 Ga0495667_0100719_384_914 174
399 3300046616 Ga0495668_0011942 Ga0495668_0011942_3998_4528 174
400 3300046663 Ga0495635_0228934 Ga0495635_0228934_286_816 174
401 3300046679 Ga0495623_0035127 Ga0495623_0035127_2066_2596 174
402 3300046684 Ga0495669_0035215 Ga0495669_0035215_961_1491 174
403 3300046691 Ga0495670_0186826 Ga0495670_0186826_534_1064 174
404 3300046694 Ga0495649_0432056 Ga0495649_0432056_119_649 174
405 3300046809 Ga0495600_0079544 Ga0495600_0079544_291_821 174
406 3300047319 Ga0495674_0007011 Ga0495674_0007011_6126_6656 174
407 3300047471 Ga0495684_0019807 Ga0495684_0019807_1942_2472 174
408 3300048088 Ga0495602_0419069 Ga0495602_0419069_164_694 174
409 3300048903 Ga0496100_0048167 Ga0496100_0048167_2123_2653 174
410 3300048903 Ga0496100_0103131 Ga0496100_0103131_673_1203 174
411 3300048904 Ga0496101_0000588 Ga0496101_0000588_5333_5863 174
412 3300048904 Ga0496101_0041125 Ga0496101_0041125_2176_2706 174
413 3300048904 Ga0496101_0983767 Ga0496101_0983767_110_640 174
414 3300048905 Ga0496102_0074069 Ga0496102_0074069_1655_2185 174
415 3300048905 Ga0496102_0451995 Ga0496102_0451995_417_947 174
416 3300048907 Ga0496104_0019336 Ga0496104_0019336_3888_4418 174
417 3300048907 Ga0496104_0045215 Ga0496104_0045215_1443_1973 174
418 3300048908 Ga0496105_0013920 Ga0496105_0013920_5853_6383 174
419 3300048908 Ga0496105_0020348 Ga0496105_0020348_2166_2696 174
420 3300048909 Ga0496106_0328173 Ga0496106_0328173_572_1102 174
421 3300048909 Ga0496106_0393698 Ga0496106_0393698_11_541 174
422 3300048910 Ga0496107_0060297 Ga0496107_0060297_941_1471 174
423 3300048911 Ga0496108_0479149 Ga0496108_0479149_375_938 174
424 3300048911 Ga0496108_0953471 Ga0496108_0953471_42_572 174
425 3300048912 Ga0496109_0154214 Ga0496109_0154214_29_559 174
426 3300048915 Ga0496112_0000007 Ga0496112_0000007_120675_121235 174
427 3300048915 Ga0496112_0015023 Ga0496112_0015023_4385_4915 174
428 3300048916 Ga0496113_0056419 Ga0496113_0056419_295_825 174
429 3300048917 Ga0496114_0000328 Ga0496114_0000328_4581_5111 174
430 3300048917 Ga0496114_0010181 Ga0496114_0010181_5053_5583 174
431 3300048917 Ga0496114_0308211 Ga0496114_0308211_361_891 174
432 3300048917 Ga0496114_0365614 Ga0496114_0365614_663_1226 174
433 3300048918 Ga0496115_0004376 Ga0496115_0004376_6607_7137 174
434 3300048918 Ga0496115_0220707 Ga0496115_0220707_866_1396 174
435 3300048921 Ga0496118_0005463 Ga0496118_0005463_3777_4307 174
436 3300048929 Ga0496126_0046759 Ga0496126_0046759_2084_2614 174
437 3300049513 Ga0501290_003982 Ga0501290_003982_1162_1692 174
438 3300049514 Ga0501291_035635 Ga0501291_035635_90_620 174
439 3300049515 Ga0501292_002962 Ga0501292_002962_1162_1692 174
440 3300049515 Ga0501292_006330 Ga0501292_006330_201_758 174
441 3300049569 Ga0501032_0068171 Ga0501032_0068171_582_1112 174
442 3300049570 Ga0501033_0208001 Ga0501033_0208001_248_778 174
443 3300049571 Ga0501034_0088559 Ga0501034_0088559_427_957 174
444 3300049573 Ga0501037_0127748 Ga0501037_0127748_660_1190 174
445 3300049576 Ga0501040_0003561 Ga0501040_0003561_2967_3497 174
446 3300049576 Ga0501040_0766514 Ga0501040_0766514_150_680 174
447 3300049586 Ga0501070_0565759 Ga0501070_0565759_15_545 174
448 3300049652 Ga0501202_028401 Ga0501202_028401_561_1091 174
449 3300049656 Ga0501209_004778 Ga0501209_004778_1449_1979 174
450 3300049661 Ga0501217_002943 Ga0501217_002943_1505_2035 174
451 3300049663 Ga0501223_028770 Ga0501223_028770_471_1001 174
452 3300049666 Ga0501228_014786 Ga0501228_014786_97_627 174
453 3300049668 Ga0501233_016129 Ga0501233_016129_60_590 174
454 3300049669 Ga0501235_000593 Ga0501235_000593_3662_4192 174
455 3300049673 Ga0501240_012404 Ga0501240_012404_203_733 174
456 3300049686 Ga0501257_013555 Ga0501257_013555_1196_1726 174
457 3300049688 Ga0501259_003450 Ga0501259_003450_809_1339 174
458 3300049704 Ga0501221_002808 Ga0501221_002808_201_731 174
459 3300049705 Ga0501225_0002184 Ga0501225_0002184_4601_5131 174
460 3300049707 Ga0501234_005122 Ga0501234_005122_513_1043 174
461 3300049743 Ga0501081_0200730 Ga0501081_0200730_272_802 174
462 3300049762 Ga0501265_007142 Ga0501265_007142_71_601 174
463 3300049763 Ga0501266_003058 Ga0501266_003058_1420_1950 174
464 3300049765 Ga0501268_000657 Ga0501268_000657_788_1318 174
465 3300049767 Ga0501270_006730 Ga0501270_006730_51_581 174
466 3300049771 Ga0501274_007937 Ga0501274_007937_270_800 174
467 3300049822 Ga0501035_0063277 Ga0501035_0063277_55_585 174
468 3300049823 Ga0501044_0102176 Ga0501044_0102176_233_763 174
469 3300049850 Ga0501204_010978 Ga0501204_010978_263_793 174
470 3300050490 nmdc:mga03n38_11042_c1 nmdc:mga03n38_11042_c1_691_1275 174
471 3300050492 nmdc:mga0yw44_73675_c1 nmdc:mga0yw44_73675_c1_214_798 174
472 3300050494 nmdc:mga06z11_11042_c1 nmdc:mga06z11_11042_c1_214_798 174
473 3300050496 nmdc:mga07m45_128525_c1 nmdc:mga07m45_128525_c1_715_1299 174
474 3300050511 nmdc:mga08y16_339771_c1 nmdc:mga08y16_339771_c1_639_1169 174
475 3300050511 nmdc:mga08y16_728007_c1 nmdc:mga08y16_728007_c1_42_572 174
476 3300050512 nmdc:mga0n895_49020_c1 nmdc:mga0n895_49020_c1_697_1266 174
477 3300050513 nmdc:mga0rr50_17782_c1 nmdc:mga0rr50_17782_c1_2299_2868 174
478 3300050515 nmdc:mga0a205_949193_c1 nmdc:mga0a205_949193_c1_18_548 174
479 3300050516 nmdc:mga0sz30_25492_c1 nmdc:mga0sz30_25492_c1_1413_1997 174
480 3300053096 Ga0500641_0145770 Ga0500641_0145770_295_825 174
481 3300053108 Ga0500562_006009 Ga0500562_006009_265_795 174
482 3300053119 Ga0500595_024357 Ga0500595_024357_1108_1680 174
483 3300053139 Ga0500568_0000531 Ga0500568_0000531_21893_22423 174
484 3300053140 Ga0500573_0030511 Ga0500573_0030511_2448_2978 174
485 3300053151 Ga0500604_0002864 Ga0500604_0002864_2542_3072 174
486 3300053153 Ga0500616_0000773 Ga0500616_0000773_15300_15830 174
487 3300053153 Ga0500616_0005081 Ga0500616_0005081_8185_8715 174
488 3300053161 Ga0500634_0000025 Ga0500634_0000025_22570_23100 174
489 3300053727 Ga0500611_001614 Ga0500611_001614_135_665 174
490 3300054114 Ga0501084_0488129 Ga0501084_0488129_431_961 174
491 3300060353 Ga0501082_0702112 Ga0501082_0702112_134_664 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

27

195

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7901 4 174
1vdr-assembly1.cif.gz_A dihydrofolate reductase 0.7812 4 174
8ucx-assembly1.cif.gz_A dihydrofolate reductase complexed with folate 0.7729 3 174
3tqb-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with folate 0.7704 3 172
4qi9-assembly2.cif.gz_B crystal structure of dihydrofolate reductase from yersinia pestis complexed with methotrexate 0.7688 3 174
ID Description Score Start End Superfamily
af_Q58168_23_157_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.8132 154 171 3.30.1380.20
af_Q9VRH6_461_580_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8051 154 173 3.30.70.240
af_Q8ID31_1067_1217_3.30.980.10 Alpha Beta;2-Layer Sandwich;Threonyl-tRNA Synthetase; Chain A, domain 2;Threonyl-trna Synthetase; Chain A, domain 2 0.8025 154 174 3.30.980.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7901 4 174 3.40.430.10
af_A0A0R0KAP7_457_568_3.30.70.240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7835 154 173 3.30.70.240
ID Description Score Start End GO Terms
AF-A0A503TTP0-F1-model_v4 Dihydrofolate reductase 0.9709 1 174 GO:0008703
GO:0009231
AF-A0A5C4SWX9-F1-model_v4 Dihydrofolate reductase 0.9706 20 174 GO:0008703
GO:0009231
AF-A0A435HEI2-F1-model_v4 Dihydrofolate reductase 0.9701 1 128
AF-A0A2A6I880-F1-model_v4 deleted 0.9674 1 174
AF-A0A503TTP0-F1-model_v4 Dihydrofolate reductase 0.9655 1 174 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
94.39 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map