F454098

General Info

Members Datasets Scaffolds Average Seq Length
491 373 448 118

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10631862|Ga0157370_106318621
Length 138
Sequence MKTYLSFQILPNNARRNENPFMKVKRIVTNFNTPDVALAKIFYQDILGLEQLMDHGWITTYGSSETSMNIQISFASEGGSGTTTPDLSIEVDDVDEAFKKMQEAGFPIIYGLTNEPWGVRRFYTRDPFGKLINILSHL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
4 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
5 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
6 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
7 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
8 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
9 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
10 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
11 2738541283 Pedobacter sp. OK701 Isolate Unclassified
12 2738543023 Pedobacter sp. OK628 Isolate Unclassified
13 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
14 2818991452 Burkholderia cepacia 561 Isolate Unclassified
15 2818991459 Paenibacillus sp. 597 Isolate Unclassified
16 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
17 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
18 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
19 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
20 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
21 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
22 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
23 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
24 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
25 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
26 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
27 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
28 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
29 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
30 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
31 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
32 2928170801 Burkholderia sp. 572 Isolate Unclassified
33 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
34 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
35 2996887358 Rhizobium sp. R711 Isolate Nodule
36 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
37 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
38 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
39 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
40 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
41 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
45 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
46 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
47 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
48 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
49 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
50 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
54 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
58 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
59 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
60 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
61 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
62 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
63 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
67 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
68 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
69 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
70 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
71 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
75 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
80 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
81 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
82 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
90 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
95 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
96 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
99 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
100 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
101 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
102 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
136 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
137 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
157 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
163 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
165 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
168 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
172 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
174 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
248 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
249 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
256 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
257 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
258 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
261 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
262 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
263 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
264 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
265 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
266 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
267 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
282 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
283 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
306 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
333 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
337 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
338 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
352 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
353 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
354 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
355 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
358 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
361 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
362 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
365 8005258706 Rhizobium sp. R693 Isolate Nodule
366 8005321885 Rhizobium sp. R72 Isolate Nodule
367 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
368 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
369 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
370 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
371 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
372 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
373 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.24
Metatranscriptomes 0
Isolates 8.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.02
Nodule 2.24
Rhizoplane 1.63
Rhizosphere 72.91
Stem 0
Stem Tuber 0
Unclassified 11.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1498326 2162886007 Bacteria 186627
2 SwRhRL2b_contig_1955925 2162886007 Bacteria 4613
3 MBSR1b_contig_1136325 2162886012 Bacteria 986
4 MBSR1b_contig_5039782 2162886012 Unclassified 839
5 JGI24738J21930_10025155 3300002075 Eukaryota 1224
6 JGI24033J26618_1022043 3300002155 Unclassified 822
7 JGI25158J39367_1000005 3300002739 Bacteria 65147
8 JGI25150J39212_1006725 3300002774 Bacteria 2353
9 JGI25159J45721_1005425 3300002987 Bacteria 4004
10 JGI25151J46595_10023750 3300003187 Bacteria 2519
11 rootH2_10280088 3300003320 Bacteria 1172
12 rootH1_10190753 3300003323 Bacteria 3899
13 JGI25161J50226_1000051 3300003374 Bacteria 110051
14 JGI26130J50248_101547 3300003398 Unclassified 689
15 Ga0055538_1000835 3300003751 Bacteria 8079
16 Ga0055532_1000621 3300003758 Bacteria 13968
17 Ga0055532_1000651 3300003758 Bacteria 13364
18 Ga0055528_1000433 3300003790 Bacteria 33610
19 Ga0055541_1005809 3300003841 Bacteria 2135
20 Ga0055541_1017645 3300003841 Bacteria 898
21 Ga0055543_1000095 3300004625 Bacteria 77750
22 Ga0065165_1075640 3300005262 Bacteria 884
23 Ga0065704_10070132 3300005289 Bacteria 1955461
24 Ga0065704_10079069 3300005289 Bacteria 4263
25 Ga0065712_10013289 3300005290 Bacteria 1879
26 Ga0065715_10274421 3300005293 Bacteria 1094
27 Ga0065707_10002381 3300005295 Bacteria 4646
28 Ga0070658_10590484 3300005327 Bacteria 962
29 Ga0070676_10007577 3300005328 Bacteria 5830
30 Ga0070690_100038639 3300005330 Bacteria 3013
31 Ga0070670_100087310 3300005331 Bacteria 2680
32 Ga0070670_100191804 3300005331 Bacteria 1775
33 Ga0070677_10026983 3300005333 Bacteria 2158
34 Ga0068869_100007531 3300005334 Bacteria 6966
35 Ga0070666_10189944 3300005335 Bacteria 1443
36 Ga0070680_100024407 3300005336 Bacteria 4830
37 Ga0068868_100017299 3300005338 Bacteria 5368
38 Ga0070660_100011087 3300005339 Bacteria 6392
39 Ga0070689_100021058 3300005340 Bacteria 4847
40 Ga0070691_10008748 3300005341 Bacteria 4635
41 Ga0070687_100054588 3300005343 Bacteria 2082
42 Ga0070661_100054581 3300005344 Bacteria 2926
43 Ga0070661_100084792 3300005344 Bacteria 2340
44 Ga0070692_10012549 3300005345 Bacteria 3925
45 Ga0070668_100026193 3300005347 Bacteria 4423
46 Ga0070668_100040988 3300005347 Bacteria 3546
47 Ga0070668_100256600 3300005347 Bacteria 1453
48 Ga0070669_100010456 3300005353 Bacteria 6589
49 Ga0070669_100055675 3300005353 Bacteria 2898
50 Ga0070675_100071989 3300005354 Bacteria 2869
51 Ga0070675_101734875 3300005354 Bacteria 576
52 Ga0070671_100161316 3300005355 Bacteria 1895
53 Ga0070674_100000739 3300005356 Bacteria 16724
54 Ga0070673_100010133 3300005364 Bacteria 6364
55 Ga0070659_100015572 3300005366 Bacteria 5696
56 Ga0070667_100019159 3300005367 Bacteria 5674
57 Ga0070667_100137802 3300005367 Bacteria 2135
58 Ga0070703_10101558 3300005406 Bacteria 1014
59 Ga0070700_100008894 3300005441 Bacteria 5491
60 Ga0070694_100037175 3300005444 Bacteria 3228
61 Ga0070708_101812170 3300005445 Unclassified 566
62 Ga0070663_100040629 3300005455 Bacteria 3258
63 Ga0070678_100015070 3300005456 Bacteria 4900
64 Ga0070662_100038230 3300005457 Bacteria 3408
65 Ga0070681_10003611 3300005458 Bacteria 14508
66 Ga0068867_100000585 3300005459 Bacteria 24164
67 Ga0070685_10056593 3300005466 Bacteria 2280
68 Ga0070698_101650039 3300005471 Bacteria 593
69 Ga0070699_100385267 3300005518 Bacteria 1266
70 Ga0070679_100199383 3300005530 Bacteria 1968
71 Ga0070684_100028951 3300005535 Bacteria 4689
72 Ga0068853_100084819 3300005539 Bacteria 2776
73 Ga0068853_100325476 3300005539 Bacteria 1425
74 Ga0068853_101889357 3300005539 Bacteria 579
75 Ga0070686_100059476 3300005544 Bacteria 2462
76 Ga0070695_100017793 3300005545 Bacteria 4312
77 Ga0070696_100011954 3300005546 Bacteria 5818
78 Ga0070665_100077663 3300005548 Bacteria 3326
79 Ga0070665_102101049 3300005548 Bacteria 569
80 Ga0070704_101206006 3300005549 Unclassified 690
81 Ga0068855_100410123 3300005563 Bacteria 1483
82 Ga0070664_100008951 3300005564 Bacteria 8118
83 Ga0070664_100076270 3300005564 Plasmid 2880
84 Ga0068857_100083057 3300005577 Bacteria 2861
85 Ga0068854_100020378 3300005578 Bacteria 4486
86 Ga0068854_100052823 3300005578 Bacteria 2916
87 Ga0068854_100247980 3300005578 Bacteria 1421
88 Ga0068852_100176163 3300005616 Bacteria 2008
89 Ga0068864_100109282 3300005618 Bacteria 2462
90 Ga0068866_10015695 3300005718 Bacteria 3370
91 Ga0068861_100075001 3300005719 Bacteria 2632
92 Ga0068861_100194830 3300005719 Bacteria 1697
93 Ga0068870_10123513 3300005840 Bacteria 1494
94 Ga0068860_100912205 3300005843 Bacteria 895
95 Ga0068862_100036556 3300005844 Bacteria 4163
96 Ga0075432_10007927 3300006058 Bacteria 3620
97 Ga0075369_10065382 3300006186 Bacteria 1594
98 Ga0075427_10014459 3300006194 Bacteria 1211
99 Ga0097621_100018374 3300006237 Bacteria 5338
100 Ga0075370_10284336 3300006353 Bacteria 983
101 Ga0068871_100034084 3300006358 Bacteria 4037
102 Ga0075428_100147055 3300006844 Bacteria 2561
103 Ga0075428_100319735 3300006844 Bacteria 1668
104 Ga0075430_100041659 3300006846 Bacteria 3884
105 Ga0075431_100037525 3300006847 Bacteria 4991
106 Ga0075434_100297058 3300006871 Bacteria 1635
107 Ga0075429_100017722 3300006880 Bacteria 6158
108 Ga0068865_100026051 3300006881 Bacteria 3852
109 Ga0068865_100353463 3300006881 Bacteria 1191
110 Ga0075436_100014714 3300006914 Bacteria 5362
111 Ga0075435_100020064 3300007076 Bacteria 5111
112 Ga0105244_10005983 3300009036 Bacteria 7968
113 Ga0105240_10246375 3300009093 Bacteria 2069
114 Ga0105240_11085412 3300009093 Unclassified 852
115 Ga0105245_10015123 3300009098 Bacteria 6721
116 Ga0105245_10017677 3300009098 Bacteria 6224
117 Ga0114129_10304383 3300009147 Bacteria 2123
118 Ga0105243_10015243 3300009148 Bacteria 5815
119 Ga0105243_10778139 3300009148 Bacteria 941
120 Ga0105243_11001008 3300009148 Bacteria 838
121 Ga0105241_10022413 3300009174 Bacteria 4679
122 Ga0105242_10015349 3300009176 Bacteria 5949
123 Ga0105242_10091409 3300009176 Bacteria 2562
124 Ga0105248_10549645 3300009177 Bacteria 1303
125 Ga0105237_10026240 3300009545 Bacteria 5954
126 Ga0105237_10228768 3300009545 Bacteria 1860
127 Ga0105237_10499347 3300009545 Bacteria 1223
128 Ga0105238_10720875 3300009551 Bacteria 1010
129 Ga0105249_10016829 3300009553 Bacteria 6488
130 Ga0105249_11130468 3300009553 Bacteria 854
131 Ga0105249_11583616 3300009553 Bacteria 728
132 Ga0123340_1075761 3300009763 Bacteria 731
133 Ga0123341_1125430 3300009765 Bacteria 735
134 Ga0123341_1126176 3300009765 Bacteria 730
135 Ga0123342_1015824 3300009766 Bacteria 6741
136 Ga0105239_10012165 3300010375 Bacteria 9595
137 Ga0105239_10179852 3300010375 Bacteria 2366
138 Ga0105246_10004353 3300011119 Bacteria 8615
139 Ga0105246_10480018 3300011119 Bacteria 1051
140 Ga0157373_10236095 3300013100 Bacteria 1292
141 Ga0157371_10006393 3300013102 Bacteria 9734
142 Ga0157371_10765437 3300013102 Bacteria 726
143 Ga0157370_10346961 3300013104 Bacteria 1368
144 Ga0157370_10631862 3300013104 Bacteria 979
145 Ga0157370_10747155 3300013104 Bacteria 891
146 Ga0157370_10775403 3300013104 Bacteria 873
147 Ga0157369_10076942 3300013105 Bacteria 3577
148 Ga0157369_11801282 3300013105 Bacteria 622
149 Ga0157374_10054289 3300013296 Bacteria 3737
150 Ga0157378_10008474 3300013297 Bacteria 8956
151 Ga0163162_10188298 3300013306 Bacteria 2191
152 Ga0163162_10980983 3300013306 Bacteria 955
153 Ga0157372_11003829 3300013307 Bacteria 967
154 Ga0157372_11882820 3300013307 Unclassified 688
155 Ga0157375_10034026 3300013308 Bacteria 4849
156 Ga0157380_10035518 3300014326 Bacteria 3851
157 Ga0182008_10000419 3300014497 Bacteria 32858
158 Ga0157377_10033671 3300014745 Bacteria 2798
159 Ga0157376_10016572 3300014969 Bacteria 5598
160 Ga0157376_10115675 3300014969 Bacteria 2368
161 Ga0182006_1003306 3300015261 Bacteria 8324
162 Ga0182006_1201273 3300015261 Bacteria 660
163 Ga0163161_10063439 3300017792 Bacteria 2693
164 Ga0163161_10590783 3300017792 Bacteria 914
165 Ga0213876_10101414 3300021384 Bacteria 1526
166 Ga0209436_100032 3300025208 Bacteria 80755
167 Ga0209784_100393 3300025224 Bacteria 19953
168 Ga0209566_100022 3300025225 Bacteria 403259
169 Ga0209566_100347 3300025225 Bacteria 39809
170 Ga0209672_100771 3300025228 Bacteria 15344
171 Ga0209147_100063 3300025229 Bacteria 241980
172 Ga0209147_106075 3300025229 Bacteria 1713
173 Ga0209258_100022 3300025242 Bacteria 553584
174 Ga0207425_1010031 3300025245 Bacteria 2323
175 Ga0209148_1000034 3300025254 Bacteria 553584
176 Ga0209129_1009614 3300025258 Bacteria 2519
177 Ga0209565_1041392 3300025263 Bacteria 857
178 Ga0209673_1000033 3300025273 Bacteria 335369
179 Ga0209673_1048336 3300025273 Bacteria 1146
180 Ga0209130_1000006 3300025284 Bacteria 596528
181 Ga0209675_1012914 3300025291 Bacteria 2653
182 Ga0209675_1030230 3300025291 Bacteria 1295
183 Ga0209676_1033966 3300025292 Bacteria 1512
184 Ga0209025_1001923 3300025294 Bacteria 24082
185 Ga0209025_1002945 3300025294 Bacteria 16928
186 Ga0209025_1004502 3300025294 Bacteria 12049
187 Ga0209025_1066678 3300025294 Bacteria 1305
188 Ga0209758_1026347 3300025297 Bacteria 2519
189 Ga0209256_1000563 3300025299 Bacteria 53065
190 Ga0209256_1001087 3300025299 Bacteria 31357
191 Ga0207426_1007305 3300025302 Bacteria 4642
192 Ga0207697_10027903 3300025315 Bacteria 2308
193 Ga0207655_1008209 3300025728 Bacteria 6658
194 Ga0207682_10029423 3300025893 Bacteria 2196
195 Ga0207642_10003793 3300025899 Bacteria 4814
196 Ga0207688_10003727 3300025901 Bacteria 8315
197 Ga0207680_10645196 3300025903 Unclassified 758
198 Ga0207647_10529017 3300025904 Unclassified 655
199 Ga0207699_10206138 3300025906 Bacteria 1335
200 Ga0207645_10009829 3300025907 Bacteria 6596
201 Ga0207643_10027372 3300025908 Bacteria 3160
202 Ga0207654_10419983 3300025911 Unclassified 933
203 Ga0207707_10006811 3300025912 Bacteria 9971
204 Ga0207671_10013352 3300025914 Bacteria 6545
205 Ga0207671_10015396 3300025914 Bacteria 5988
206 Ga0207671_10136481 3300025914 Bacteria 1886
207 Ga0207671_10373467 3300025914 Bacteria 1132
208 Ga0207660_10020524 3300025917 Bacteria 4435
209 Ga0207662_10004786 3300025918 Bacteria 7154
210 Ga0207657_10011345 3300025919 Bacteria 8849
211 Ga0207649_10006843 3300025920 Bacteria 6193
212 Ga0207652_10948685 3300025921 Unclassified 758
213 Ga0207681_10048604 3300025923 Bacteria 2864
214 Ga0207681_10171552 3300025923 Bacteria 1644
215 Ga0207650_10100998 3300025925 Bacteria 2220
216 Ga0207659_10011952 3300025926 Bacteria 5500
217 Ga0207659_11505169 3300025926 Bacteria 576
218 Ga0207687_10038649 3300025927 Bacteria 3262
219 Ga0207690_10045047 3300025932 Bacteria 2912
220 Ga0207706_10017531 3300025933 Bacteria 6454
221 Ga0207706_11174016 3300025933 Bacteria 639
222 Ga0207686_10006773 3300025934 Bacteria 6172
223 Ga0207686_11552856 3300025934 Bacteria 546
224 Ga0207709_10005278 3300025935 Bacteria 7348
225 Ga0207709_10575110 3300025935 Bacteria 889
226 Ga0207709_10825866 3300025935 Bacteria 749
227 Ga0207670_10009253 3300025936 Bacteria 5611
228 Ga0207704_10005560 3300025938 Bacteria 5810
229 Ga0207704_11708506 3300025938 Bacteria 541
230 Ga0207691_10038209 3300025940 Bacteria 4441
231 Ga0207711_10380874 3300025941 Bacteria 1309
232 Ga0207689_10000943 3300025942 Bacteria 27928
233 Ga0207661_10562316 3300025944 Bacteria 1045
234 Ga0207679_10025279 3300025945 Bacteria 4081
235 Ga0207667_10016891 3300025949 Bacteria 8233
236 Ga0207667_10078349 3300025949 Bacteria 3425
237 Ga0207667_10651890 3300025949 Bacteria 1058
238 Ga0207651_10033680 3300025960 Bacteria 3307
239 Ga0207712_10007718 3300025961 Bacteria 6804
240 Ga0207668_10046291 3300025972 Bacteria 2971
241 Ga0207640_10121575 3300025981 Bacteria 1872
242 Ga0207640_10194988 3300025981 Bacteria 1530
243 Ga0207658_10021189 3300025986 Bacteria 4508
244 Ga0207658_10864450 3300025986 Bacteria 822
245 Ga0207677_10063644 3300026023 Bacteria 2565
246 Ga0207639_10156864 3300026041 Bacteria 1913
247 Ga0207639_10188337 3300026041 Bacteria 1761
248 Ga0207678_10072848 3300026067 Bacteria 2944
249 Ga0207708_10000703 3300026075 Bacteria 25326
250 Ga0207648_10000250 3300026089 Bacteria 58226
251 Ga0207648_10862201 3300026089 Bacteria 845
252 Ga0207676_10067503 3300026095 Bacteria 2857
253 Ga0207674_10022389 3300026116 Bacteria 6786
254 Ga0207675_100187465 3300026118 Bacteria 1983
255 Ga0207683_10001377 3300026121 Bacteria 21964
256 Ga0207698_11083885 3300026142 Bacteria 813
257 Ga0209973_1000353 3300027252 Bacteria 3336
258 Ga0209969_1008989 3300027360 Bacteria 1420
259 Ga0209967_1000233 3300027364 Bacteria 7769
260 Ga0209981_1003271 3300027378 Bacteria 2099
261 Ga0209996_1000267 3300027395 Bacteria 6560
262 Ga0209984_1000574 3300027424 Bacteria 4021
263 Ga0210000_1000015 3300027462 Bacteria 30974
264 Ga0209995_1000181 3300027471 Bacteria 10093
265 Ga0209968_1000207 3300027526 Bacteria 10295
266 Ga0209999_1001387 3300027543 Bacteria 4154
267 Ga0209982_1000223 3300027552 Bacteria 6696
268 Ga0209970_1000725 3300027614 Bacteria 5721
269 Ga0210002_1001638 3300027617 Bacteria 3184
270 Ga0209971_1000665 3300027682 Bacteria 8933
271 Ga0209966_1008612 3300027695 Bacteria 1813
272 Ga0209998_10001373 3300027717 Bacteria 5908
273 Ga0209974_10001854 3300027876 Bacteria 7712
274 Ga0207428_10010972 3300027907 Bacteria 8057
275 Ga0268266_10197520 3300028379 Bacteria 1840
276 Ga0268266_10212650 3300028379 Bacteria 1774
277 Ga0268266_11193423 3300028379 Bacteria 736
278 Ga0268265_10012925 3300028380 Bacteria 5667
279 Ga0268264_10215039 3300028381 Bacteria 1767
280 Ga0307515_10115206 3300028794 Bacteria 3099
281 Ga0307513_10347227 3300031456 Bacteria 1232
282 Ga0307405_10003173 3300031731 Bacteria 7479
283 Ga0307413_10559631 3300031824 Unclassified 929
284 Ga0307414_10013386 3300032004 Bacteria 4882
285 Ga0307414_10375481 3300032004 Bacteria 1228
286 Ga0307414_11459105 3300032004 Bacteria 636
287 Ga0373961_0130889 3300035241 Unclassified 840
288 Ga0373931_0083683 3300035691 Bacteria 1766
289 Ga0395899_0010529 3300037312 Bacteria 7084
290 Ga0395900_0567655 3300037418 Bacteria 1078
291 Ga0395898_0042122 3300037466 Bacteria 4507
292 Ga0395905_0007341 3300037471 Bacteria 10976
293 Ga0400485_18736 3300038735 Bacteria 53978
294 Ga0400488_15559 3300038741 Bacteria 4329
295 Ga0400486_20875 3300038742 Bacteria 25353
296 Ga0400487_07374 3300039110 Bacteria 28411
297 Ga0436365_1896915 3300039437 Bacteria 3244
298 Ga0439447_120943 3300041407 Unclassified 601
299 Ga0439465_0031781 3300041413 Bacteria 1683
300 Ga0439449_0056293 3300042007 Bacteria 1452
301 Ga0439455_0072951 3300042012 Bacteria 925
302 Ga0439458_0223788 3300042157 Bacteria 519
303 Ga0439460_0073539 3300042461 Bacteria 1062
304 Ga0466982_0161775 3300044672 Bacteria 1364
305 Ga0466965_0111943 3300044683 Bacteria 1403
306 Ga0466961_0196844 3300044693 Bacteria 1247
307 Ga0466970_0241085 3300044765 Bacteria 1012
308 Ga0466970_0259682 3300044765 Bacteria 974
309 Ga0466957_0244225 3300044842 Bacteria 1192
310 Ga0466960_0069803 3300044901 Bacteria 1747
311 Ga0466960_0152191 3300044901 Bacteria 1236
312 Ga0451576_0175451 3300045051 Bacteria 2237
313 Ga0466958_0290065 3300045836 Bacteria 1049
314 Ga0466958_0377854 3300045836 Bacteria 913
315 Ga0495638_0000634 3300046460 Bacteria 38683
316 Ga0495605_0015541 3300046474 Bacteria 4136
317 Ga0495585_0025792 3300046492 Bacteria 3362
318 Ga0495606_0062416 3300046507 Bacteria 2379
319 Ga0495610_0123664 3300046512 Bacteria 1131
320 Ga0495616_0014701 3300046513 Bacteria 4374
321 Ga0495620_0092968 3300046515 Bacteria 1208
322 Ga0495620_0326307 3300046515 Bacteria 583
323 Ga0495631_0370064 3300046518 Bacteria 610
324 Ga0495632_0035354 3300046519 Bacteria 2550
325 Ga0495632_0035395 3300046519 Bacteria 2548
326 Ga0495637_0170539 3300046520 Bacteria 812
327 Ga0495643_0055775 3300046522 Bacteria 2111
328 Ga0495645_0191208 3300046543 Bacteria 1395
329 Ga0495668_0015443 3300046616 Bacteria 4459
330 Ga0495625_0198309 3300046660 Bacteria 1326
331 Ga0495625_0374991 3300046660 Bacteria 894
332 Ga0495661_0086424 3300046665 Bacteria 1795
333 Ga0495624_0737818 3300046690 Bacteria 584
334 Ga0495670_0237913 3300046691 Bacteria 969
335 Ga0495649_0260123 3300046694 Bacteria 890
336 Ga0495589_0046117 3300046794 Bacteria 2164
337 Ga0495636_0094761 3300047318 Bacteria 1299
338 Ga0495674_0039568 3300047319 Bacteria 4225
339 Ga0495672_0036425 3300047320 Bacteria 3021
340 Ga0495676_0071592 3300047321 Bacteria 2665
341 Ga0495687_059488 3300047443 Bacteria 1580
342 Ga0495687_098246 3300047443 Bacteria 1105
343 Ga0495686_0340003 3300047472 Bacteria 818
344 Ga0496100_0408390 3300048903 Bacteria 1035
345 Ga0496102_1588371 3300048905 Bacteria 572
346 Ga0496107_0054714 3300048910 Bacteria 2881
347 Ga0496108_1399664 3300048911 Bacteria 585
348 Ga0496110_0000463 3300048913 Bacteria 27632
349 Ga0496113_1114107 3300048916 Bacteria 619
350 Ga0496116_0013095 3300048919 Bacteria 6719
351 Ga0496117_0025069 3300048920 Bacteria 4698
352 Ga0496117_0074235 3300048920 Bacteria 2265
353 Ga0496118_0019250 3300048921 Bacteria 6111
354 Ga0496118_0364888 3300048921 Bacteria 764
355 Ga0496119_0084061 3300048922 Bacteria 1826
356 Ga0496121_0017385 3300048924 Bacteria 7349
357 Ga0496121_0024020 3300048924 Bacteria 5843
358 Ga0496121_0083593 3300048924 Bacteria 2519
359 Ga0496121_0084583 3300048924 Bacteria 2500
360 Ga0496121_0202103 3300048924 Bacteria 1415
361 Ga0496121_0265200 3300048924 Bacteria 1183
362 Ga0496121_0438945 3300048924 Bacteria 844
363 Ga0496122_0001866 3300048925 Bacteria 32082
364 Ga0496122_0045032 3300048925 Bacteria 3434
365 Ga0496122_0146467 3300048925 Bacteria 1466
366 Ga0496122_0245344 3300048925 Bacteria 1006
367 Ga0496122_0273912 3300048925 Bacteria 927
368 Ga0496123_0068046 3300048926 Bacteria 2245
369 Ga0496123_0133323 3300048926 Bacteria 1371
370 Ga0496123_0254807 3300048926 Bacteria 863
371 Ga0496124_0088193 3300048927 Bacteria 2536
372 Ga0496124_0122082 3300048927 Bacteria 2080
373 Ga0496124_0169587 3300048927 Bacteria 1692
374 Ga0496124_0530841 3300048927 Bacteria 781
375 Ga0496125_0008336 3300048928 Bacteria 10874
376 Ga0496125_0346899 3300048928 Bacteria 888
377 Ga0496126_0179729 3300048929 Bacteria 1798
378 Ga0496126_0203668 3300048929 Bacteria 1669
379 Ga0495678_077493 3300049459 Bacteria 1202
380 Ga0501031_0238476 3300049568 Bacteria 1182
381 Ga0501032_0140235 3300049569 Bacteria 1592
382 Ga0501032_0575837 3300049569 Bacteria 717
383 Ga0501033_0016220 3300049570 Bacteria 5642
384 Ga0501033_0231267 3300049570 Bacteria 1313
385 Ga0501033_0642686 3300049570 Bacteria 725
386 Ga0501034_0165526 3300049571 Bacteria 2180
387 Ga0501036_0220932 3300049572 Bacteria 1591
388 Ga0501036_0804772 3300049572 Bacteria 774
389 Ga0501037_0405360 3300049573 Bacteria 935
390 Ga0501037_0551493 3300049573 Bacteria 778
391 Ga0501038_0488877 3300049574 Bacteria 942
392 Ga0501038_1188324 3300049574 Bacteria 554
393 Ga0501039_0914170 3300049575 Unclassified 683
394 Ga0501041_0525361 3300049577 Unclassified 754
395 Ga0501042_1101794 3300049578 Unclassified 579
396 Ga0501043_0264425 3300049579 Bacteria 1322
397 Ga0501046_0460267 3300049580 Bacteria 914
398 Ga0501047_0271094 3300049581 Bacteria 1543
399 Ga0501047_0337126 3300049581 Bacteria 1346
400 Ga0501048_0857454 3300049582 Unclassified 653
401 Ga0501070_0062221 3300049586 Bacteria 3092
402 Ga0501075_0619963 3300049591 Bacteria 825
403 Ga0501238_020770 3300049671 Unclassified 927
404 Ga0501251_019662 3300049681 Unclassified 887
405 Ga0501080_0776931 3300049742 Bacteria 841
406 Ga0501080_0946775 3300049742 Bacteria 749
407 Ga0501080_1808811 3300049742 Unclassified 513
408 Ga0501081_1389299 3300049743 Unclassified 533
409 Ga0501241_001084 3300049758 Bacteria 5727
410 Ga0501263_034065 3300049760 Bacteria 729
411 Ga0501269_006079 3300049766 Bacteria 1455
412 Ga0501035_0002261 3300049822 Bacteria 19041
413 Ga0501035_0107804 3300049822 Bacteria 2442
414 Ga0501035_0125649 3300049822 Bacteria 2239
415 Ga0501035_0167321 3300049822 Bacteria 1901
416 Ga0501035_0297522 3300049822 Bacteria 1360
417 Ga0501044_0001816 3300049823 Bacteria 24846
418 Ga0501044_0052179 3300049823 Bacteria 4215
419 Ga0501044_0103797 3300049823 Bacteria 2857
420 Ga0501044_0216687 3300049823 Bacteria 1866
421 Ga0501044_0243705 3300049823 Bacteria 1740
422 Ga0501044_0778349 3300049823 Bacteria 837
423 Ga0501045_0333528 3300049824 Bacteria 1129
424 nmdc:mga06z11_677874_c1 3300050494 Bacteria 628
425 nmdc:mga07m45_270546_c1 3300050496 Bacteria 988
426 nmdc:mga09592_9443_c1 3300050508 Bacteria 7926
427 nmdc:mga0qj67_121651_c1 3300050509 Bacteria 2112
428 nmdc:mga08y16_45630_c1 3300050511 Bacteria 4592
429 nmdc:mga0n895_27322_c1 3300050512 Bacteria 5420
430 nmdc:mga0rr50_19893_c1 3300050513 Bacteria 4544
431 nmdc:mga08x19_59220_c1 3300050514 Bacteria 2479
432 nmdc:mga0sz30_10284_c2 3300050516 Bacteria 2432
433 Ga0500643_005160 3300053087 Bacteria 5697
434 Ga0500650_0099866 3300053098 Bacteria 1358
435 Ga0500618_020350 3300053125 Bacteria 1625
436 Ga0500652_213184 3300053131 Bacteria 779
437 Ga0500658_0050842 3300053134 Bacteria 1693
438 Ga0500568_0002860 3300053139 Bacteria 9932
439 Ga0500577_0343779 3300053142 Unclassified 652
440 Ga0500604_0327161 3300053151 Bacteria 532
441 Ga0500616_0000989 3300053153 Bacteria 30709
442 Ga0500622_0000209 3300053156 Bacteria 61889
443 Ga0500622_0000338 3300053156 Bacteria 46041
444 Ga0500627_0003670 3300053158 Bacteria 4800
445 Ga0500636_0293539 3300053177 Bacteria 805
446 Ga0500645_029654 3300053730 Bacteria 1650
447 Ga0500645_221355 3300053730 Bacteria 507
448 Ga0530510_1089324 3300061734 Unclassified 612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009763 Ga0123340_1075761 Ga0123340_10757612 109
2 iso_pu_bacteria 2896109856 2896110922 111
3 iso_pu_bacteria 2503198000 2503198965 112
4 iso_pu_bacteria 2510917028 2511184122 112
5 iso_pu_bacteria 2512564013 2512636843 112
6 iso_pu_bacteria 2512564039 2512733141 112
7 iso_pu_bacteria 2513237166 2514051882 112
8 iso_pu_bacteria 2599185239 2599739758 112
9 iso_pu_bacteria 2600255292 2601667986 112
10 iso_pu_bacteria 2643221634 2644194731 112
11 iso_pu_bacteria 2738541283 2738754080 112
12 iso_pu_bacteria 2738543023 2739303807 112
13 iso_pu_bacteria 2818991452 2819636367 112
14 iso_pu_bacteria 2818991459 2819673059 112
15 iso_pu_bacteria 2857465823 2857469230 112
16 iso_pu_bacteria 2857547612 2857549972 112
17 iso_pu_bacteria 2857591370 2857595387 112
18 iso_pu_bacteria 2863421361 2863424299 112
19 iso_pu_bacteria 2885080285 2885081749 112
20 iso_pu_bacteria 2885526491 2885531374 112
21 iso_pu_bacteria 2888578766 2888582067 112
22 iso_pu_bacteria 2889049205 2889054456 112
23 iso_pu_bacteria 2894414249 2894417128 112
24 iso_pu_bacteria 2894414249 2894417800 112
25 iso_pu_bacteria 2904113452 2904114412 112
26 iso_pu_bacteria 2904162308 2904164133 112
27 iso_pu_bacteria 2904755435 2904757297 112
28 iso_pu_bacteria 2907202186 2907203176 112
29 iso_pu_bacteria 2915597211 2915600279 112
30 iso_pu_bacteria 2919425241 2919428431 112
31 iso_pu_bacteria 2928170801 2928174768 112
32 iso_pu_bacteria 2932410948 2932411690 112
33 iso_pu_bacteria 2932416698 2932418743 112
34 iso_pu_bacteria 2996887358 2996890349 112
35 iso_pu_bacteria 8005258706 8005262532 112
36 iso_pu_bacteria 8005321885 8005324876 112
37 iso_pu_bacteria 8018845410 8018852773 112
38 iso_pu_bacteria 8020938398 8020942923 112
39 iso_pu_bacteria 8020953355 8020959603 112
40 iso_pu_bacteria 8021120328 8021123981 112
41 iso_pu_bacteria 8054795415 8054797893 112
42 iso_pu_bacteria 8056533031 8056540330 112
43 iso_pu_bacteria 8057977335 8057979398 112
44 3300003323 rootH1_10190753 rootH1_101907534 115
45 3300025291 Ga0209675_1012914 Ga0209675_10129143 115
46 3300046694 Ga0495649_0260123 Ga0495649_0260123_47_394 115
47 2162886007 SwRhRL2b_contig_1498326 SwRhRL2b_0696.00002270 116
48 2162886007 SwRhRL2b_contig_1955925 SwRhRL2b_0490.00001260 116
49 2162886012 MBSR1b_contig_1136325 MBSR1b_0877.00002250 116
50 2162886012 MBSR1b_contig_5039782 MBSR1b_0549.00007900 116
51 3300002075 JGI24738J21930_10025155 JGI24738J21930_100251553 116
52 3300002155 JGI24033J26618_1022043 JGI24033J26618_10220432 116
53 3300002739 JGI25158J39367_1000005 JGI25158J39367_10000056 116
54 3300002774 JGI25150J39212_1006725 JGI25150J39212_10067252 116
55 3300002987 JGI25159J45721_1005425 JGI25159J45721_10054253 116
56 3300003187 JGI25151J46595_10023750 JGI25151J46595_100237503 116
57 3300003320 rootH2_10280088 rootH2_102800882 116
58 3300003374 JGI25161J50226_1000051 JGI25161J50226_100005192 116
59 3300003398 JGI26130J50248_101547 JGI26130J50248_1015472 116
60 3300003751 Ga0055538_1000835 Ga0055538_10008359 116
61 3300003758 Ga0055532_1000621 Ga0055532_100062111 116
62 3300003758 Ga0055532_1000651 Ga0055532_100065113 116
63 3300003790 Ga0055528_1000433 Ga0055528_100043322 116
64 3300003841 Ga0055541_1005809 Ga0055541_10058093 116
65 3300003841 Ga0055541_1017645 Ga0055541_10176451 116
66 3300004625 Ga0055543_1000095 Ga0055543_100009569 116
67 3300005262 Ga0065165_1075640 Ga0065165_10756402 116
68 3300005289 Ga0065704_10070132 Ga0065704_10070132521 116
69 3300005289 Ga0065704_10079069 Ga0065704_100790693 116
70 3300005290 Ga0065712_10013289 Ga0065712_100132893 116
71 3300005293 Ga0065715_10274421 Ga0065715_102744212 116
72 3300005295 Ga0065707_10002381 Ga0065707_100023812 116
73 3300005327 Ga0070658_10590484 Ga0070658_105904841 116
74 3300005328 Ga0070676_10007577 Ga0070676_100075772 116
75 3300005330 Ga0070690_100038639 Ga0070690_1000386394 116
76 3300005331 Ga0070670_100087310 Ga0070670_1000873102 116
77 3300005331 Ga0070670_100191804 Ga0070670_1001918041 116
78 3300005333 Ga0070677_10026983 Ga0070677_100269833 116
79 3300005334 Ga0068869_100007531 Ga0068869_1000075315 116
80 3300005335 Ga0070666_10189944 Ga0070666_101899441 116
81 3300005336 Ga0070680_100024407 Ga0070680_1000244076 116
82 3300005338 Ga0068868_100017299 Ga0068868_1000172999 116
83 3300005339 Ga0070660_100011087 Ga0070660_10001108710 116
84 3300005340 Ga0070689_100021058 Ga0070689_1000210584 116
85 3300005341 Ga0070691_10008748 Ga0070691_100087487 116
86 3300005343 Ga0070687_100054588 Ga0070687_1000545883 116
87 3300005344 Ga0070661_100054581 Ga0070661_1000545813 116
88 3300005344 Ga0070661_100084792 Ga0070661_1000847922 116
89 3300005345 Ga0070692_10012549 Ga0070692_100125493 116
90 3300005347 Ga0070668_100026193 Ga0070668_1000261933 116
91 3300005347 Ga0070668_100040988 Ga0070668_1000409884 116
92 3300005347 Ga0070668_100256600 Ga0070668_1002566002 116
93 3300005353 Ga0070669_100010456 Ga0070669_1000104563 116
94 3300005353 Ga0070669_100055675 Ga0070669_1000556752 116
95 3300005354 Ga0070675_100071989 Ga0070675_1000719892 116
96 3300005354 Ga0070675_101734875 Ga0070675_1017348751 116
97 3300005355 Ga0070671_100161316 Ga0070671_1001613163 116
98 3300005356 Ga0070674_100000739 Ga0070674_10000073912 116
99 3300005364 Ga0070673_100010133 Ga0070673_10001013310 116
100 3300005366 Ga0070659_100015572 Ga0070659_1000155722 116
101 3300005367 Ga0070667_100019159 Ga0070667_1000191592 116
102 3300005367 Ga0070667_100137802 Ga0070667_1001378024 116
103 3300005406 Ga0070703_10101558 Ga0070703_101015582 116
104 3300005441 Ga0070700_100008894 Ga0070700_1000088949 116
105 3300005444 Ga0070694_100037175 Ga0070694_1000371754 116
106 3300005445 Ga0070708_101812170 Ga0070708_1018121701 116
107 3300005455 Ga0070663_100040629 Ga0070663_1000406293 116
108 3300005456 Ga0070678_100015070 Ga0070678_1000150708 116
109 3300005457 Ga0070662_100038230 Ga0070662_1000382303 116
110 3300005458 Ga0070681_10003611 Ga0070681_1000361112 116
111 3300005459 Ga0068867_100000585 Ga0068867_10000058526 116
112 3300005466 Ga0070685_10056593 Ga0070685_100565933 116
113 3300005471 Ga0070698_101650039 Ga0070698_1016500391 116
114 3300005518 Ga0070699_100385267 Ga0070699_1003852672 116
115 3300005530 Ga0070679_100199383 Ga0070679_1001993833 116
116 3300005535 Ga0070684_100028951 Ga0070684_1000289512 116
117 3300005539 Ga0068853_100084819 Ga0068853_1000848192 116
118 3300005539 Ga0068853_100325476 Ga0068853_1003254762 116
119 3300005539 Ga0068853_101889357 Ga0068853_1018893571 116
120 3300005544 Ga0070686_100059476 Ga0070686_1000594763 116
121 3300005545 Ga0070695_100017793 Ga0070695_1000177933 116
122 3300005546 Ga0070696_100011954 Ga0070696_1000119548 116
123 3300005548 Ga0070665_100077663 Ga0070665_1000776634 116
124 3300005548 Ga0070665_102101049 Ga0070665_1021010491 116
125 3300005549 Ga0070704_101206006 Ga0070704_1012060061 116
126 3300005563 Ga0068855_100410123 Ga0068855_1004101232 116
127 3300005564 Ga0070664_100008951 Ga0070664_1000089519 116
128 3300005564 Ga0070664_100076270 Ga0070664_1000762701 116
129 3300005577 Ga0068857_100083057 Ga0068857_1000830574 116
130 3300005578 Ga0068854_100020378 Ga0068854_1000203784 116
131 3300005578 Ga0068854_100052823 Ga0068854_1000528234 116
132 3300005578 Ga0068854_100247980 Ga0068854_1002479803 116
133 3300005616 Ga0068852_100176163 Ga0068852_1001761631 116
134 3300005618 Ga0068864_100109282 Ga0068864_1001092823 116
135 3300005718 Ga0068866_10015695 Ga0068866_100156952 116
136 3300005719 Ga0068861_100075001 Ga0068861_1000750013 116
137 3300005719 Ga0068861_100194830 Ga0068861_1001948303 116
138 3300005840 Ga0068870_10123513 Ga0068870_101235132 116
139 3300005843 Ga0068860_100912205 Ga0068860_1009122052 116
140 3300005844 Ga0068862_100036556 Ga0068862_1000365561 116
141 3300006058 Ga0075432_10007927 Ga0075432_100079272 116
142 3300006186 Ga0075369_10065382 Ga0075369_100653822 116
143 3300006194 Ga0075427_10014459 Ga0075427_100144592 116
144 3300006237 Ga0097621_100018374 Ga0097621_1000183744 116
145 3300006353 Ga0075370_10284336 Ga0075370_102843362 116
146 3300006358 Ga0068871_100034084 Ga0068871_1000340844 116
147 3300006844 Ga0075428_100147055 Ga0075428_1001470552 116
148 3300006844 Ga0075428_100319735 Ga0075428_1003197353 116
149 3300006846 Ga0075430_100041659 Ga0075430_1000416592 116
150 3300006847 Ga0075431_100037525 Ga0075431_1000375256 116
151 3300006871 Ga0075434_100297058 Ga0075434_1002970582 116
152 3300006880 Ga0075429_100017722 Ga0075429_1000177226 116
153 3300006881 Ga0068865_100026051 Ga0068865_1000260514 116
154 3300006881 Ga0068865_100353463 Ga0068865_1003534632 116
155 3300006914 Ga0075436_100014714 Ga0075436_1000147147 116
156 3300007076 Ga0075435_100020064 Ga0075435_1000200644 116
157 3300009036 Ga0105244_10005983 Ga0105244_100059833 116
158 3300009093 Ga0105240_10246375 Ga0105240_102463752 116
159 3300009093 Ga0105240_11085412 Ga0105240_110854121 116
160 3300009098 Ga0105245_10015123 Ga0105245_100151235 116
161 3300009098 Ga0105245_10017677 Ga0105245_100176776 116
162 3300009147 Ga0114129_10304383 Ga0114129_103043833 116
163 3300009148 Ga0105243_10015243 Ga0105243_100152435 116
164 3300009148 Ga0105243_10778139 Ga0105243_107781392 116
165 3300009148 Ga0105243_11001008 Ga0105243_110010081 116
166 3300009174 Ga0105241_10022413 Ga0105241_100224132 116
167 3300009176 Ga0105242_10015349 Ga0105242_100153492 116
168 3300009176 Ga0105242_10091409 Ga0105242_100914091 116
169 3300009177 Ga0105248_10549645 Ga0105248_105496451 116
170 3300009545 Ga0105237_10026240 Ga0105237_100262403 116
171 3300009545 Ga0105237_10228768 Ga0105237_102287681 116
172 3300009545 Ga0105237_10499347 Ga0105237_104993472 116
173 3300009551 Ga0105238_10720875 Ga0105238_107208752 116
174 3300009553 Ga0105249_10016829 Ga0105249_100168292 116
175 3300009553 Ga0105249_11130468 Ga0105249_111304681 116
176 3300009553 Ga0105249_11583616 Ga0105249_115836162 116
177 3300009765 Ga0123341_1125430 Ga0123341_11254302 116
178 3300009765 Ga0123341_1126176 Ga0123341_11261762 116
179 3300009766 Ga0123342_1015824 Ga0123342_10158244 116
180 3300010375 Ga0105239_10012165 Ga0105239_100121657 116
181 3300010375 Ga0105239_10179852 Ga0105239_101798522 116
182 3300011119 Ga0105246_10004353 Ga0105246_100043534 116
183 3300011119 Ga0105246_10480018 Ga0105246_104800182 116
184 3300013100 Ga0157373_10236095 Ga0157373_102360952 116
185 3300013102 Ga0157371_10006393 Ga0157371_100063939 116
186 3300013102 Ga0157371_10765437 Ga0157371_107654371 116
187 3300013104 Ga0157370_10346961 Ga0157370_103469612 116
188 3300013104 Ga0157370_10631862 Ga0157370_106318621 116
189 3300013104 Ga0157370_10747155 Ga0157370_107471552 116
190 3300013104 Ga0157370_10775403 Ga0157370_107754031 116
191 3300013105 Ga0157369_10076942 Ga0157369_100769423 116
192 3300013105 Ga0157369_11801282 Ga0157369_118012822 116
193 3300013296 Ga0157374_10054289 Ga0157374_100542893 116
194 3300013297 Ga0157378_10008474 Ga0157378_1000847413 116
195 3300013306 Ga0163162_10188298 Ga0163162_101882982 116
196 3300013306 Ga0163162_10980983 Ga0163162_109809832 116
197 3300013307 Ga0157372_11003829 Ga0157372_110038292 116
198 3300013307 Ga0157372_11882820 Ga0157372_118828201 116
199 3300013308 Ga0157375_10034026 Ga0157375_100340266 116
200 3300014326 Ga0157380_10035518 Ga0157380_100355182 116
201 3300014497 Ga0182008_10000419 Ga0182008_100004199 116
202 3300014745 Ga0157377_10033671 Ga0157377_100336712 116
203 3300014969 Ga0157376_10016572 Ga0157376_100165722 116
204 3300014969 Ga0157376_10115675 Ga0157376_101156753 116
205 3300015261 Ga0182006_1003306 Ga0182006_100330612 116
206 3300015261 Ga0182006_1201273 Ga0182006_12012731 116
207 3300017792 Ga0163161_10063439 Ga0163161_100634393 116
208 3300017792 Ga0163161_10590783 Ga0163161_105907832 116
209 3300021384 Ga0213876_10101414 Ga0213876_101014142 116
210 3300025208 Ga0209436_100032 Ga0209436_10003261 116
211 3300025224 Ga0209784_100393 Ga0209784_10039317 116
212 3300025225 Ga0209566_100022 Ga0209566_100022130 116
213 3300025225 Ga0209566_100347 Ga0209566_10034715 116
214 3300025228 Ga0209672_100771 Ga0209672_1007719 116
215 3300025229 Ga0209147_100063 Ga0209147_10006387 116
216 3300025229 Ga0209147_106075 Ga0209147_1060752 116
217 3300025242 Ga0209258_100022 Ga0209258_100022269 116
218 3300025245 Ga0207425_1010031 Ga0207425_10100312 116
219 3300025254 Ga0209148_1000034 Ga0209148_1000034269 116
220 3300025258 Ga0209129_1009614 Ga0209129_10096142 116
221 3300025263 Ga0209565_1041392 Ga0209565_10413922 116
222 3300025273 Ga0209673_1000033 Ga0209673_1000033148 116
223 3300025273 Ga0209673_1048336 Ga0209673_10483361 116
224 3300025284 Ga0209130_1000006 Ga0209130_1000006422 116
225 3300025291 Ga0209675_1030230 Ga0209675_10302302 116
226 3300025292 Ga0209676_1033966 Ga0209676_10339662 116
227 3300025294 Ga0209025_1001923 Ga0209025_100192320 116
228 3300025294 Ga0209025_1002945 Ga0209025_10029453 116
229 3300025294 Ga0209025_1004502 Ga0209025_10045027 116
230 3300025294 Ga0209025_1066678 Ga0209025_10666782 116
231 3300025297 Ga0209758_1026347 Ga0209758_10263472 116
232 3300025299 Ga0209256_1000563 Ga0209256_100056321 116
233 3300025299 Ga0209256_1001087 Ga0209256_10010875 116
234 3300025302 Ga0207426_1007305 Ga0207426_10073054 116
235 3300025315 Ga0207697_10027903 Ga0207697_100279033 116
236 3300025728 Ga0207655_1008209 Ga0207655_10082093 116
237 3300025893 Ga0207682_10029423 Ga0207682_100294233 116
238 3300025899 Ga0207642_10003793 Ga0207642_100037934 116
239 3300025901 Ga0207688_10003727 Ga0207688_100037279 116
240 3300025903 Ga0207680_10645196 Ga0207680_106451962 116
241 3300025904 Ga0207647_10529017 Ga0207647_105290171 116
242 3300025906 Ga0207699_10206138 Ga0207699_102061382 116
243 3300025907 Ga0207645_10009829 Ga0207645_100098294 116
244 3300025908 Ga0207643_10027372 Ga0207643_100273724 116
245 3300025911 Ga0207654_10419983 Ga0207654_104199832 116
246 3300025912 Ga0207707_10006811 Ga0207707_1000681110 116
247 3300025914 Ga0207671_10013352 Ga0207671_100133523 116
248 3300025914 Ga0207671_10015396 Ga0207671_100153963 116
249 3300025914 Ga0207671_10136481 Ga0207671_101364811 116
250 3300025914 Ga0207671_10373467 Ga0207671_103734672 116
251 3300025917 Ga0207660_10020524 Ga0207660_100205246 116
252 3300025918 Ga0207662_10004786 Ga0207662_100047864 116
253 3300025919 Ga0207657_10011345 Ga0207657_100113454 116
254 3300025920 Ga0207649_10006843 Ga0207649_100068436 116
255 3300025921 Ga0207652_10948685 Ga0207652_109486852 116
256 3300025923 Ga0207681_10048604 Ga0207681_100486045 116
257 3300025923 Ga0207681_10171552 Ga0207681_101715523 116
258 3300025925 Ga0207650_10100998 Ga0207650_101009983 116
259 3300025926 Ga0207659_10011952 Ga0207659_100119524 116
260 3300025926 Ga0207659_11505169 Ga0207659_115051691 116
261 3300025927 Ga0207687_10038649 Ga0207687_100386493 116
262 3300025932 Ga0207690_10045047 Ga0207690_100450473 116
263 3300025933 Ga0207706_10017531 Ga0207706_100175317 116
264 3300025933 Ga0207706_11174016 Ga0207706_111740162 116
265 3300025934 Ga0207686_10006773 Ga0207686_100067733 116
266 3300025934 Ga0207686_11552856 Ga0207686_115528561 116
267 3300025935 Ga0207709_10005278 Ga0207709_100052784 116
268 3300025935 Ga0207709_10575110 Ga0207709_105751102 116
269 3300025935 Ga0207709_10825866 Ga0207709_108258661 116
270 3300025936 Ga0207670_10009253 Ga0207670_100092532 116
271 3300025938 Ga0207704_10005560 Ga0207704_100055609 116
272 3300025938 Ga0207704_11708506 Ga0207704_117085061 116
273 3300025940 Ga0207691_10038209 Ga0207691_100382096 116
274 3300025941 Ga0207711_10380874 Ga0207711_103808743 116
275 3300025942 Ga0207689_10000943 Ga0207689_1000094315 116
276 3300025944 Ga0207661_10562316 Ga0207661_105623162 116
277 3300025945 Ga0207679_10025279 Ga0207679_100252792 116
278 3300025949 Ga0207667_10016891 Ga0207667_100168913 116
279 3300025949 Ga0207667_10078349 Ga0207667_100783492 116
280 3300025949 Ga0207667_10651890 Ga0207667_106518902 116
281 3300025960 Ga0207651_10033680 Ga0207651_100336803 116
282 3300025961 Ga0207712_10007718 Ga0207712_100077187 116
283 3300025972 Ga0207668_10046291 Ga0207668_100462913 116
284 3300025981 Ga0207640_10121575 Ga0207640_101215752 116
285 3300025981 Ga0207640_10194988 Ga0207640_101949882 116
286 3300025986 Ga0207658_10021189 Ga0207658_100211892 116
287 3300025986 Ga0207658_10864450 Ga0207658_108644501 116
288 3300026023 Ga0207677_10063644 Ga0207677_100636442 116
289 3300026041 Ga0207639_10156864 Ga0207639_101568642 116
290 3300026041 Ga0207639_10188337 Ga0207639_101883373 116
291 3300026067 Ga0207678_10072848 Ga0207678_100728483 116
292 3300026075 Ga0207708_10000703 Ga0207708_1000070337 116
293 3300026089 Ga0207648_10000250 Ga0207648_1000025039 116
294 3300026089 Ga0207648_10862201 Ga0207648_108622011 116
295 3300026095 Ga0207676_10067503 Ga0207676_100675033 116
296 3300026116 Ga0207674_10022389 Ga0207674_100223894 116
297 3300026118 Ga0207675_100187465 Ga0207675_1001874651 116
298 3300026121 Ga0207683_10001377 Ga0207683_100013775 116
299 3300026142 Ga0207698_11083885 Ga0207698_110838852 116
300 3300027252 Ga0209973_1000353 Ga0209973_10003534 116
301 3300027360 Ga0209969_1008989 Ga0209969_10089893 116
302 3300027364 Ga0209967_1000233 Ga0209967_100023311 116
303 3300027378 Ga0209981_1003271 Ga0209981_10032713 116
304 3300027395 Ga0209996_1000267 Ga0209996_10002675 116
305 3300027424 Ga0209984_1000574 Ga0209984_10005742 116
306 3300027462 Ga0210000_1000015 Ga0210000_10000155 116
307 3300027471 Ga0209995_1000181 Ga0209995_10001816 116
308 3300027526 Ga0209968_1000207 Ga0209968_100020710 116
309 3300027543 Ga0209999_1001387 Ga0209999_10013873 116
310 3300027552 Ga0209982_1000223 Ga0209982_100022310 116
311 3300027614 Ga0209970_1000725 Ga0209970_10007252 116
312 3300027617 Ga0210002_1001638 Ga0210002_10016381 116
313 3300027682 Ga0209971_1000665 Ga0209971_100066514 116
314 3300027695 Ga0209966_1008612 Ga0209966_10086123 116
315 3300027717 Ga0209998_10001373 Ga0209998_100013734 116
316 3300027876 Ga0209974_10001854 Ga0209974_100018546 116
317 3300027907 Ga0207428_10010972 Ga0207428_100109726 116
318 3300028379 Ga0268266_10197520 Ga0268266_101975203 116
319 3300028379 Ga0268266_10212650 Ga0268266_102126502 116
320 3300028379 Ga0268266_11193423 Ga0268266_111934231 116
321 3300028380 Ga0268265_10012925 Ga0268265_100129256 116
322 3300028381 Ga0268264_10215039 Ga0268264_102150394 116
323 3300028794 Ga0307515_10115206 Ga0307515_101152062 116
324 3300031456 Ga0307513_10347227 Ga0307513_103472272 116
325 3300031731 Ga0307405_10003173 Ga0307405_100031733 116
326 3300031824 Ga0307413_10559631 Ga0307413_105596312 116
327 3300032004 Ga0307414_10013386 Ga0307414_100133863 116
328 3300032004 Ga0307414_10375481 Ga0307414_103754812 116
329 3300032004 Ga0307414_11459105 Ga0307414_114591051 116
330 3300035241 Ga0373961_0130889 Ga0373961_0130889_444_794 116
331 3300035691 Ga0373931_0083683 Ga0373931_0083683_1105_1455 116
332 3300037312 Ga0395899_0010529 Ga0395899_0010529_2860_3210 116
333 3300037418 Ga0395900_0567655 Ga0395900_0567655_96_446 116
334 3300037466 Ga0395898_0042122 Ga0395898_0042122_224_589 116
335 3300037471 Ga0395905_0007341 Ga0395905_0007341_10201_10551 116
336 3300038735 Ga0400485_18736 Ga0400485_18736_2601_2975 116
337 3300038741 Ga0400488_15559 Ga0400488_15559_577_951 116
338 3300038742 Ga0400486_20875 Ga0400486_20875_22217_22591 116
339 3300039110 Ga0400487_07374 Ga0400487_07374_25799_26173 116
340 3300039437 Ga0436365_1896915 Ga0436365_1896915_1585_1935 116
341 3300041407 Ga0439447_120943 Ga0439447_120943_28_378 116
342 3300041413 Ga0439465_0031781 Ga0439465_0031781_831_1184 116
343 3300042007 Ga0439449_0056293 Ga0439449_0056293_362_763 116
344 3300042012 Ga0439455_0072951 Ga0439455_0072951_203_553 116
345 3300042157 Ga0439458_0223788 Ga0439458_0223788_112_462 116
346 3300042461 Ga0439460_0073539 Ga0439460_0073539_409_759 116
347 3300044672 Ga0466982_0161775 Ga0466982_0161775_610_960 116
348 3300044683 Ga0466965_0111943 Ga0466965_0111943_604_954 116
349 3300044693 Ga0466961_0196844 Ga0466961_0196844_583_933 116
350 3300044765 Ga0466970_0241085 Ga0466970_0241085_208_582 116
351 3300044765 Ga0466970_0259682 Ga0466970_0259682_603_953 116
352 3300044842 Ga0466957_0244225 Ga0466957_0244225_472_822 116
353 3300044901 Ga0466960_0069803 Ga0466960_0069803_968_1318 116
354 3300044901 Ga0466960_0152191 Ga0466960_0152191_431_781 116
355 3300045051 Ga0451576_0175451 Ga0451576_0175451_1408_1758 116
356 3300045836 Ga0466958_0290065 Ga0466958_0290065_209_559 116
357 3300045836 Ga0466958_0377854 Ga0466958_0377854_281_631 116
358 3300046460 Ga0495638_0000634 Ga0495638_0000634_3761_4114 116
359 3300046474 Ga0495605_0015541 Ga0495605_0015541_2922_3272 116
360 3300046492 Ga0495585_0025792 Ga0495585_0025792_1108_1542 116
361 3300046507 Ga0495606_0062416 Ga0495606_0062416_306_671 116
362 3300046512 Ga0495610_0123664 Ga0495610_0123664_674_1024 116
363 3300046513 Ga0495616_0014701 Ga0495616_0014701_714_1064 116
364 3300046515 Ga0495620_0092968 Ga0495620_0092968_684_1118 116
365 3300046515 Ga0495620_0326307 Ga0495620_0326307_153_506 116
366 3300046518 Ga0495631_0370064 Ga0495631_0370064_112_546 116
367 3300046519 Ga0495632_0035354 Ga0495632_0035354_2068_2421 116
368 3300046519 Ga0495632_0035395 Ga0495632_0035395_1295_1648 116
369 3300046520 Ga0495637_0170539 Ga0495637_0170539_142_576 116
370 3300046522 Ga0495643_0055775 Ga0495643_0055775_133_486 116
371 3300046543 Ga0495645_0191208 Ga0495645_0191208_840_1226 116
372 3300046616 Ga0495668_0015443 Ga0495668_0015443_249_602 116
373 3300046660 Ga0495625_0198309 Ga0495625_0198309_381_815 116
374 3300046660 Ga0495625_0374991 Ga0495625_0374991_142_492 116
375 3300046665 Ga0495661_0086424 Ga0495661_0086424_1045_1479 116
376 3300046690 Ga0495624_0737818 Ga0495624_0737818_194_544 116
377 3300046691 Ga0495670_0237913 Ga0495670_0237913_379_813 116
378 3300046794 Ga0495589_0046117 Ga0495589_0046117_761_1111 116
379 3300047318 Ga0495636_0094761 Ga0495636_0094761_324_677 116
380 3300047319 Ga0495674_0039568 Ga0495674_0039568_3057_3407 116
381 3300047320 Ga0495672_0036425 Ga0495672_0036425_1414_1767 116
382 3300047321 Ga0495676_0071592 Ga0495676_0071592_1019_1408 116
383 3300047443 Ga0495687_059488 Ga0495687_059488_546_896 116
384 3300047443 Ga0495687_098246 Ga0495687_098246_317_673 116
385 3300047472 Ga0495686_0340003 Ga0495686_0340003_304_657 116
386 3300048903 Ga0496100_0408390 Ga0496100_0408390_143_493 116
387 3300048905 Ga0496102_1588371 Ga0496102_1588371_175_525 116
388 3300048910 Ga0496107_0054714 Ga0496107_0054714_2454_2804 116
389 3300048911 Ga0496108_1399664 Ga0496108_1399664_161_526 116
390 3300048913 Ga0496110_0000463 Ga0496110_0000463_26982_27332 116
391 3300048916 Ga0496113_1114107 Ga0496113_1114107_159_512 116
392 3300048919 Ga0496116_0013095 Ga0496116_0013095_5406_5759 116
393 3300048920 Ga0496117_0025069 Ga0496117_0025069_4191_4544 116
394 3300048920 Ga0496117_0074235 Ga0496117_0074235_1779_2132 116
395 3300048921 Ga0496118_0019250 Ga0496118_0019250_3639_3992 116
396 3300048921 Ga0496118_0364888 Ga0496118_0364888_62_412 116
397 3300048922 Ga0496119_0084061 Ga0496119_0084061_658_1011 116
398 3300048924 Ga0496121_0017385 Ga0496121_0017385_6794_7144 116
399 3300048924 Ga0496121_0024020 Ga0496121_0024020_5055_5408 116
400 3300048924 Ga0496121_0083593 Ga0496121_0083593_13_369 116
401 3300048924 Ga0496121_0084583 Ga0496121_0084583_1184_1537 116
402 3300048924 Ga0496121_0202103 Ga0496121_0202103_695_1048 116
403 3300048924 Ga0496121_0265200 Ga0496121_0265200_425_778 116
404 3300048924 Ga0496121_0438945 Ga0496121_0438945_13_366 116
405 3300048925 Ga0496122_0001866 Ga0496122_0001866_1769_2137 116
406 3300048925 Ga0496122_0045032 Ga0496122_0045032_27_380 116
407 3300048925 Ga0496122_0146467 Ga0496122_0146467_586_939 116
408 3300048925 Ga0496122_0245344 Ga0496122_0245344_543_893 116
409 3300048925 Ga0496122_0273912 Ga0496122_0273912_193_546 116
410 3300048926 Ga0496123_0068046 Ga0496123_0068046_1385_1738 116
411 3300048926 Ga0496123_0133323 Ga0496123_0133323_735_1088 116
412 3300048926 Ga0496123_0254807 Ga0496123_0254807_109_462 116
413 3300048927 Ga0496124_0088193 Ga0496124_0088193_358_711 116
414 3300048927 Ga0496124_0122082 Ga0496124_0122082_1486_1836 116
415 3300048927 Ga0496124_0169587 Ga0496124_0169587_391_744 116
416 3300048927 Ga0496124_0530841 Ga0496124_0530841_386_739 116
417 3300048928 Ga0496125_0008336 Ga0496125_0008336_10467_10820 116
418 3300048928 Ga0496125_0346899 Ga0496125_0346899_359_712 116
419 3300048929 Ga0496126_0179729 Ga0496126_0179729_1123_1473 116
420 3300048929 Ga0496126_0203668 Ga0496126_0203668_1132_1485 116
421 3300049459 Ga0495678_077493 Ga0495678_077493_631_984 116
422 3300049568 Ga0501031_0238476 Ga0501031_0238476_144_497 116
423 3300049569 Ga0501032_0140235 Ga0501032_0140235_728_1081 116
424 3300049569 Ga0501032_0575837 Ga0501032_0575837_199_549 116
425 3300049570 Ga0501033_0016220 Ga0501033_0016220_1920_2297 116
426 3300049570 Ga0501033_0231267 Ga0501033_0231267_416_769 116
427 3300049570 Ga0501033_0642686 Ga0501033_0642686_364_714 116
428 3300049571 Ga0501034_0165526 Ga0501034_0165526_407_769 116
429 3300049572 Ga0501036_0220932 Ga0501036_0220932_859_1209 116
430 3300049572 Ga0501036_0804772 Ga0501036_0804772_234_611 116
431 3300049573 Ga0501037_0405360 Ga0501037_0405360_543_893 116
432 3300049573 Ga0501037_0551493 Ga0501037_0551493_326_676 116
433 3300049574 Ga0501038_0488877 Ga0501038_0488877_234_587 116
434 3300049574 Ga0501038_1188324 Ga0501038_1188324_23_373 116
435 3300049575 Ga0501039_0914170 Ga0501039_0914170_250_600 116
436 3300049577 Ga0501041_0525361 Ga0501041_0525361_51_401 116
437 3300049578 Ga0501042_1101794 Ga0501042_1101794_97_447 116
438 3300049579 Ga0501043_0264425 Ga0501043_0264425_512_889 116
439 3300049580 Ga0501046_0460267 Ga0501046_0460267_112_462 116
440 3300049581 Ga0501047_0271094 Ga0501047_0271094_81_431 116
441 3300049581 Ga0501047_0337126 Ga0501047_0337126_837_1187 116
442 3300049582 Ga0501048_0857454 Ga0501048_0857454_69_419 116
443 3300049586 Ga0501070_0062221 Ga0501070_0062221_446_796 116
444 3300049591 Ga0501075_0619963 Ga0501075_0619963_31_381 116
445 3300049671 Ga0501238_020770 Ga0501238_020770_58_408 116
446 3300049681 Ga0501251_019662 Ga0501251_019662_16_372 116
447 3300049742 Ga0501080_0776931 Ga0501080_0776931_274_624 116
448 3300049742 Ga0501080_0946775 Ga0501080_0946775_317_667 116
449 3300049742 Ga0501080_1808811 Ga0501080_1808811_58_408 116
450 3300049743 Ga0501081_1389299 Ga0501081_1389299_105_455 116
451 3300049758 Ga0501241_001084 Ga0501241_001084_381_731 116
452 3300049760 Ga0501263_034065 Ga0501263_034065_261_611 116
453 3300049766 Ga0501269_006079 Ga0501269_006079_87_437 116
454 3300049822 Ga0501035_0002261 Ga0501035_0002261_8694_9044 116
455 3300049822 Ga0501035_0107804 Ga0501035_0107804_989_1366 116
456 3300049822 Ga0501035_0125649 Ga0501035_0125649_1064_1414 116
457 3300049822 Ga0501035_0167321 Ga0501035_0167321_23_373 116
458 3300049822 Ga0501035_0297522 Ga0501035_0297522_451_804 116
459 3300049823 Ga0501044_0001816 Ga0501044_0001816_22887_23237 116
460 3300049823 Ga0501044_0052179 Ga0501044_0052179_233_583 116
461 3300049823 Ga0501044_0103797 Ga0501044_0103797_1921_2298 116
462 3300049823 Ga0501044_0216687 Ga0501044_0216687_1383_1733 116
463 3300049823 Ga0501044_0243705 Ga0501044_0243705_401_754 116
464 3300049823 Ga0501044_0778349 Ga0501044_0778349_325_675 116
465 3300049824 Ga0501045_0333528 Ga0501045_0333528_281_634 116
466 3300050494 nmdc:mga06z11_677874_c1 nmdc:mga06z11_677874_c1_76_432 116
467 3300050496 nmdc:mga07m45_270546_c1 nmdc:mga07m45_270546_c1_238_591 116
468 3300050508 nmdc:mga09592_9443_c1 nmdc:mga09592_9443_c1_3037_3387 116
469 3300050509 nmdc:mga0qj67_121651_c1 nmdc:mga0qj67_121651_c1_424_774 116
470 3300050511 nmdc:mga08y16_45630_c1 nmdc:mga08y16_45630_c1_4087_4437 116
471 3300050512 nmdc:mga0n895_27322_c1 nmdc:mga0n895_27322_c1_1515_1865 116
472 3300050513 nmdc:mga0rr50_19893_c1 nmdc:mga0rr50_19893_c1_1515_1865 116
473 3300050514 nmdc:mga08x19_59220_c1 nmdc:mga08x19_59220_c1_992_1342 116
474 3300050516 nmdc:mga0sz30_10284_c2 nmdc:mga0sz30_10284_c2_2006_2359 116
475 3300053087 Ga0500643_005160 Ga0500643_005160_1495_1845 116
476 3300053098 Ga0500650_0099866 Ga0500650_0099866_972_1325 116
477 3300053125 Ga0500618_020350 Ga0500618_020350_483_836 116
478 3300053131 Ga0500652_213184 Ga0500652_213184_263_616 116
479 3300053134 Ga0500658_0050842 Ga0500658_0050842_446_799 116
480 3300053139 Ga0500568_0002860 Ga0500568_0002860_5905_6258 116
481 3300053142 Ga0500577_0343779 Ga0500577_0343779_74_427 116
482 3300053151 Ga0500604_0327161 Ga0500604_0327161_152_505 116
483 3300053153 Ga0500616_0000989 Ga0500616_0000989_12508_12861 116
484 3300053156 Ga0500622_0000209 Ga0500622_0000209_8028_8378 116
485 3300053156 Ga0500622_0000338 Ga0500622_0000338_39310_39663 116
486 3300053158 Ga0500627_0003670 Ga0500627_0003670_4321_4671 116
487 3300053177 Ga0500636_0293539 Ga0500636_0293539_254_604 116
488 3300053730 Ga0500645_029654 Ga0500645_029654_973_1326 116
489 3300053730 Ga0500645_221355 Ga0500645_221355_119_469 116
490 3300061734 Ga0530510_1089324 Ga0530510_1089324_20_370 116
491 iso_pu_bacteria 2791355123 2792747482 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12681

Glyoxalase_2

Glyoxalase-like domain

25

138

0.87

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

134

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pjs-assembly1.cif.gz_B crystal structure of atu1953, protein of unknown function 0.9679 2 113
2pjs-assembly1.cif.gz_B crystal structure of atu1953, protein of unknown function 0.9514 2 113
5zsz-assembly1.cif.gz_A catechol 2,3-dioxygenase (c23o64) from diaphorobacter sp ds2 0.8799 66 114
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.8751 66 115
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.8643 65 115
ID Description Score Start End Superfamily
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9748 65 113 3.30.720.110
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9592 14 113 3.10.180.10
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9406 14 113 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9196 65 116 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8869 65 112 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6B3GEA4-F1-model_v4 Glyoxalase 1.004 63 116
AF-A0A1Y3ME55-F1-model_v4 deleted 1.002 63 115
AF-A0A448LJI1-F1-model_v4 deleted 0.9946 2 116
AF-A0A1R0XK98-F1-model_v4 deleted 0.9945 1 115
AF-A0A150WHJ5-F1-model_v4 Glyoxalase 0.9934 1 116

Feature Viewer

pLDDT pTM Quality
94.85 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map