F454040

General Info

Members Datasets Scaffolds Average Seq Length
491 288 982 109

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10023557|rootH1_100235576
Length 122
Sequence AAPLDPGRRREVRMSVWEAVLGILGMAAITVITRSFFMIPEREIPLPQWVRDGLRYAPLAALAAVIVPEIVMTQGELIHTWKDARLYATAVGTAYFFWQRGILGTIVSGTAVMLALRVGLGW

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
68 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
141 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
178 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
179 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
180 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
183 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
188 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
189 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
190 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
191 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
195 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
244 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
245 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
246 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
259 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
260 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
261 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
264 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
265 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
266 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
267 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
268 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
271 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
272 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
273 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
274 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
275 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
276 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
279 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
280 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
281 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
282 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
283 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
284 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
285 2721755523 Delftia sp. HK171 Isolate Unclassified
286 2831864461 Roseateles noduli HZ7 Isolate Nodule
287 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
288 2932422444 Comamonas sp. 4034 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 0
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.74
Nodule 1.43
Rhizoplane 6.52
Rhizosphere 63.14
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10023557 3300003316 Bacteria 4763
2 JGI25156J39149_1010217 3300002705 Bacteria 2221
3 JGI25152J39213_1002003 3300002773 Bacteria 8037
4 JGI25153J46596_10001615 3300003215 Bacteria 13371
5 JGI25153J46596_10002191 3300003215 Bacteria 11402
6 rootL2_10001066 3300003322 Bacteria 89444
7 rootH1_10049922 3300003323 Bacteria 4609
8 rootH1_10053669 3300003323 Bacteria 2470
9 Ga0055526_1001240 3300003771 Bacteria 18300
10 Ga0055524_1000140 3300003775 Bacteria 85990
11 Ga0055524_1036596 3300003775 Bacteria 1316
12 Ga0055530_10004184 3300003791 Bacteria 7605
13 Ga0055530_10123133 3300003791 Bacteria 501
14 Ga0055540_1000133 3300003792 Bacteria 75104
15 Ga0055540_1091817 3300003792 Bacteria 572
16 Ga0055531_10015175 3300003794 Bacteria 3416
17 Ga0065165_1001730 3300005262 Bacteria 21830
18 Ga0065165_1005111 3300005262 Bacteria 7608
19 Ga0070676_10013521 3300005328 Bacteria 4473
20 Ga0070683_101665402 3300005329 Bacteria 613
21 Ga0070690_100007700 3300005330 Bacteria 6175
22 Ga0070670_100006722 3300005331 Bacteria 9747
23 Ga0070670_100090555 3300005331 Bacteria 2629
24 Ga0070670_100409428 3300005331 Bacteria 1198
25 Ga0068869_100007134 3300005334 Bacteria 7119
26 Ga0068869_100129701 3300005334 Bacteria 1937
27 Ga0070666_10106833 3300005335 Bacteria 1933
28 Ga0070666_10726576 3300005335 Bacteria 729
29 Ga0070682_100268582 3300005337 Bacteria 1238
30 Ga0070682_100397847 3300005337 Bacteria 1041
31 Ga0068868_100002350 3300005338 Bacteria 13093
32 Ga0068868_100016604 3300005338 Bacteria 5472
33 Ga0068868_101410386 3300005338 Bacteria 650
34 Ga0070689_100012109 3300005340 Bacteria 6202
35 Ga0070661_100543116 3300005344 Bacteria 934
36 Ga0070661_100645003 3300005344 Bacteria 859
37 Ga0070669_101382351 3300005353 Bacteria 611
38 Ga0070675_100022707 3300005354 Bacteria 5012
39 Ga0070675_100275994 3300005354 Bacteria 1476
40 Ga0070671_100010201 3300005355 Bacteria 7541
41 Ga0070671_100026606 3300005355 Bacteria 4756
42 Ga0070671_100130806 3300005355 Bacteria 2114
43 Ga0070674_100664830 3300005356 Bacteria 887
44 Ga0070673_100059269 3300005364 Bacteria 3030
45 Ga0070659_101374245 3300005366 Bacteria 627
46 Ga0070667_100132627 3300005367 Bacteria 2175
47 Ga0070667_100241446 3300005367 Bacteria 1613
48 Ga0070667_100394580 3300005367 Bacteria 1259
49 Ga0070705_101524703 3300005440 Unclassified 560
50 Ga0070663_100011032 3300005455 Bacteria 5655
51 Ga0070678_100272085 3300005456 Bacteria 1429
52 Ga0070662_100608167 3300005457 Bacteria 920
53 Ga0068867_100006872 3300005459 Bacteria 8050
54 Ga0068867_101113788 3300005459 Bacteria 721
55 Ga0068867_101406644 3300005459 Bacteria 647
56 Ga0070685_10176281 3300005466 Bacteria 1373
57 Ga0070684_100334886 3300005535 Bacteria 1391
58 Ga0068853_100830352 3300005539 Bacteria 886
59 Ga0068853_101198687 3300005539 Bacteria 733
60 Ga0070672_100002832 3300005543 Bacteria 11115
61 Ga0070686_100009188 3300005544 Bacteria 5546
62 Ga0070665_100023164 3300005548 Bacteria 6254
63 Ga0070665_100483667 3300005548 Bacteria 1249
64 Ga0070665_101918793 3300005548 Bacteria 598
65 Ga0068855_102066291 3300005563 Bacteria 574
66 Ga0070664_100017067 3300005564 Bacteria 5958
67 Ga0068857_100075171 3300005577 Bacteria 3012
68 Ga0068857_100633031 3300005577 Bacteria 1013
69 Ga0068856_100371163 3300005614 Bacteria 1450
70 Ga0068852_100005168 3300005616 Bacteria 9306
71 Ga0068852_100087578 3300005616 Bacteria 2779
72 Ga0068852_101334922 3300005616 Bacteria 739
73 Ga0068852_102178309 3300005616 Bacteria 576
74 Ga0068859_100030515 3300005617 Bacteria 5410
75 Ga0068859_100972475 3300005617 Bacteria 932
76 Ga0068859_101294453 3300005617 Bacteria 803
77 Ga0068864_100645509 3300005618 Bacteria 1030
78 Ga0068864_102463642 3300005618 Unclassified 526
79 Ga0068861_100421418 3300005719 Bacteria 1189
80 Ga0068851_10090017 3300005834 Bacteria 1614
81 Ga0068863_100005336 3300005841 Bacteria 12677
82 Ga0068863_100240522 3300005841 Bacteria 1747
83 Ga0068858_100031940 3300005842 Bacteria 4891
84 Ga0068858_101935106 3300005842 Bacteria 583
85 Ga0068860_100062413 3300005843 Bacteria 3541
86 Ga0068860_100137506 3300005843 Bacteria 2347
87 Ga0068862_100779931 3300005844 Bacteria 932
88 Ga0068862_100912963 3300005844 Bacteria 864
89 Ga0075363_100189863 3300006048 Bacteria 1172
90 Ga0075363_100235504 3300006048 Bacteria 1052
91 Ga0075364_10730144 3300006051 Bacteria 676
92 Ga0070712_101647717 3300006175 Bacteria 561
93 Ga0075362_10120212 3300006177 Bacteria 1243
94 Ga0075367_10146437 3300006178 Bacteria 1465
95 Ga0075367_10170149 3300006178 Bacteria 1357
96 Ga0075369_10308152 3300006186 Bacteria 740
97 Ga0075366_10059516 3300006195 Bacteria 2268
98 Ga0075366_10228873 3300006195 Bacteria 1133
99 Ga0075366_10551127 3300006195 Bacteria 714
100 Ga0097621_100090173 3300006237 Bacteria 2565
101 Ga0075370_10000170 3300006353 Bacteria 22468
102 Ga0075370_10042579 3300006353 Bacteria 2565
103 Ga0075370_10062188 3300006353 Bacteria 2127
104 Ga0068871_100008034 3300006358 Bacteria 7572
105 Ga0068871_100082224 3300006358 Bacteria 2670
106 Ga0075429_100954261 3300006880 Bacteria 750
107 Ga0068865_100278505 3300006881 Bacteria 1331
108 Ga0097620_100030515 3300006931 Bacteria 5410
109 Ga0097620_100972554 3300006931 Bacteria 932
110 Ga0097620_101294482 3300006931 Bacteria 803
111 Ga0099823_1000064 3300006944 Bacteria 50328
112 Ga0079104_1000053 3300006946 Bacteria 168604
113 Ga0079104_1000226 3300006946 Bacteria 77894
114 Ga0105250_10000883 3300009092 Bacteria 17721
115 Ga0105240_10021275 3300009093 Bacteria 8630
116 Ga0105245_10035891 3300009098 Bacteria 4402
117 Ga0105245_10310536 3300009098 Bacteria 1550
118 Ga0105245_11828693 3300009098 Bacteria 660
119 Ga0105247_10178553 3300009101 Bacteria 1416
120 Ga0114129_10021325 3300009147 Bacteria 9198
121 Ga0105243_10006749 3300009148 Bacteria 8854
122 Ga0105243_10227952 3300009148 Bacteria 1651
123 Ga0105243_10426329 3300009148 Bacteria 1239
124 Ga0105242_10210463 3300009176 Bacteria 1733
125 Ga0105242_11700955 3300009176 Bacteria 667
126 Ga0105248_10030357 3300009177 Bacteria 6034
127 Ga0105248_10033356 3300009177 Bacteria 5751
128 Ga0105248_11860197 3300009177 Bacteria 683
129 Ga0105248_12097523 3300009177 Bacteria 643
130 Ga0105237_10000668 3300009545 Bacteria 47303
131 Ga0105237_10377305 3300009545 Bacteria 1423
132 Ga0105237_10993392 3300009545 Bacteria 846
133 Ga0105238_10003328 3300009551 Bacteria 16042
134 Ga0105238_10005970 3300009551 Bacteria 12076
135 Ga0105238_10723388 3300009551 Bacteria 1008
136 Ga0105239_10001255 3300010375 Bacteria 34466
137 Ga0105239_10048403 3300010375 Bacteria 4662
138 Ga0105239_10345396 3300010375 Bacteria 1680
139 Ga0105246_10153220 3300011119 Bacteria 1747
140 Ga0105246_10154687 3300011119 Bacteria 1740
141 Ga0157371_10531352 3300013102 Bacteria 871
142 Ga0157374_10001952 3300013296 Bacteria 17299
143 Ga0157378_10234096 3300013297 Bacteria 1752
144 Ga0163162_10058987 3300013306 Bacteria 3868
145 Ga0157375_10022170 3300013308 Bacteria 5843
146 Ga0157375_13313841 3300013308 Bacteria 537
147 Ga0163163_10021346 3300014325 Bacteria 6109
148 Ga0157380_10440977 3300014326 Bacteria 1248
149 Ga0157379_10038357 3300014968 Bacteria 4275
150 Ga0157379_10634509 3300014968 Bacteria 999
151 Ga0157376_10017998 3300014969 Bacteria 5405
152 Ga0207425_1001307 3300025245 Bacteria 10745
153 Ga0209759_1000953 3300025256 Bacteria 20596
154 Ga0209129_1000158 3300025258 Bacteria 103711
155 Ga0209565_1026048 3300025263 Bacteria 1176
156 Ga0209673_1004078 3300025273 Bacteria 8053
157 Ga0209673_1023348 3300025273 Bacteria 2109
158 Ga0209673_1048315 3300025273 Bacteria 1146
159 Ga0209673_1053295 3300025273 Bacteria 1056
160 Ga0209675_1026032 3300025291 Bacteria 1463
161 Ga0209564_1000008 3300025295 Bacteria 953227
162 Ga0209564_1000282 3300025295 Bacteria 103837
163 Ga0209758_1000815 3300025297 Bacteria 43876
164 Ga0209758_1000910 3300025297 Bacteria 40059
165 Ga0209050_1000223 3300025298 Bacteria 125465
166 Ga0209050_1001950 3300025298 Bacteria 19526
167 Ga0209050_1012281 3300025298 Bacteria 3945
168 Ga0209050_1033824 3300025298 Bacteria 1542
169 Ga0209256_1000045 3300025299 Bacteria 325506
170 Ga0209256_1000913 3300025299 Bacteria 36128
171 Ga0209051_1000004 3300025303 Bacteria 1155596
172 Ga0209051_1012370 3300025303 Bacteria 4134
173 Ga0209051_1027563 3300025303 Bacteria 2261
174 Ga0209257_1000315 3300025304 Bacteria 102293
175 Ga0209257_1000444 3300025304 Bacteria 78076
176 Ga0209257_1014988 3300025304 Bacteria 3270
177 Ga0209257_1031627 3300025304 Bacteria 1690
178 Ga0207656_10331827 3300025321 Bacteria 757
179 Ga0207696_1000950 3300025711 Bacteria 17699
180 Ga0207710_10095143 3300025900 Bacteria 1399
181 Ga0207680_10587533 3300025903 Bacteria 796
182 Ga0207680_11020299 3300025903 Bacteria 592
183 Ga0207645_10005951 3300025907 Bacteria 8788
184 Ga0207643_10024334 3300025908 Bacteria 3341
185 Ga0207684_10045546 3300025910 Bacteria 3720
186 Ga0207695_10004981 3300025913 Bacteria 17877
187 Ga0207671_10004435 3300025914 Bacteria 13431
188 Ga0207671_10258124 3300025914 Bacteria 1371
189 Ga0207693_11141459 3300025915 Bacteria 590
190 Ga0207649_10611556 3300025920 Bacteria 839
191 Ga0207649_10676364 3300025920 Bacteria 799
192 Ga0207649_11367003 3300025920 Bacteria 560
193 Ga0207694_10005362 3300025924 Bacteria 9871
194 Ga0207694_10114306 3300025924 Bacteria 2150
195 Ga0207694_10123036 3300025924 Bacteria 2073
196 Ga0207650_10051780 3300025925 Bacteria 3039
197 Ga0207650_10134431 3300025925 Bacteria 1938
198 Ga0207650_10437832 3300025925 Bacteria 1086
199 Ga0207659_10037848 3300025926 Bacteria 3352
200 Ga0207687_10920175 3300025927 Bacteria 749
201 Ga0207644_10263256 3300025931 Bacteria 1379
202 Ga0207644_10790843 3300025931 Bacteria 793
203 Ga0207644_11556298 3300025931 Bacteria 555
204 Ga0207644_11616758 3300025931 Bacteria 543
205 Ga0207706_10032559 3300025933 Bacteria 4642
206 Ga0207706_10042537 3300025933 Bacteria 4026
207 Ga0207706_10217684 3300025933 Bacteria 1673
208 Ga0207706_10473484 3300025933 Bacteria 1082
209 Ga0207686_10185761 3300025934 Bacteria 1478
210 Ga0207709_10000151 3300025935 Bacteria 94184
211 Ga0207670_10057065 3300025936 Bacteria 2647
212 Ga0207704_11020295 3300025938 Bacteria 700
213 Ga0207691_10009672 3300025940 Bacteria 9248
214 Ga0207711_10020574 3300025941 Bacteria 5505
215 Ga0207711_10048382 3300025941 Bacteria 3638
216 Ga0207689_10019740 3300025942 Bacteria 5679
217 Ga0207679_10966554 3300025945 Bacteria 780
218 Ga0207658_10044823 3300025986 Bacteria 3222
219 Ga0207658_10082072 3300025986 Bacteria 2474
220 Ga0207658_10213455 3300025986 Bacteria 1619
221 Ga0207677_10258407 3300026023 Bacteria 1418
222 Ga0207677_10414806 3300026023 Bacteria 1145
223 Ga0207703_10423458 3300026035 Bacteria 1239
224 Ga0207703_11021712 3300026035 Bacteria 793
225 Ga0207639_10354584 3300026041 Bacteria 1311
226 Ga0207639_10686077 3300026041 Bacteria 949
227 Ga0207678_10005808 3300026067 Bacteria 11000
228 Ga0207702_10288666 3300026078 Bacteria 1553
229 Ga0207641_10008413 3300026088 Bacteria 8526
230 Ga0207641_10122397 3300026088 Bacteria 2324
231 Ga0207641_10219494 3300026088 Bacteria 1762
232 Ga0207648_10004116 3300026089 Bacteria 15050
233 Ga0207648_10528027 3300026089 Bacteria 1082
234 Ga0207648_11045261 3300026089 Bacteria 765
235 Ga0207676_10015672 3300026095 Bacteria 5475
236 Ga0207676_10172419 3300026095 Bacteria 1886
237 Ga0207676_10584090 3300026095 Bacteria 1071
238 Ga0207674_10049618 3300026116 Bacteria 4291
239 Ga0207674_10147891 3300026116 Bacteria 2307
240 Ga0207674_11032470 3300026116 Bacteria 791
241 Ga0207674_11182310 3300026116 Bacteria 734
242 Ga0207674_11334902 3300026116 Bacteria 687
243 Ga0207675_102257750 3300026118 Bacteria 558
244 Ga0207683_10195880 3300026121 Bacteria 1836
245 Ga0207683_10327942 3300026121 Bacteria 1403
246 Ga0207683_11841103 3300026121 Bacteria 554
247 Ga0207698_10057436 3300026142 Bacteria 3011
248 Ga0207698_10108141 3300026142 Bacteria 2323
249 Ga0207698_10827507 3300026142 Bacteria 930
250 Ga0207698_11136268 3300026142 Bacteria 794
251 Ga0209281_1000002 3300027111 Bacteria 1924012
252 Ga0209281_1000147 3300027111 Bacteria 168586
253 Ga0209389_1017567 3300027296 Bacteria 6458
254 Ga0268266_10189741 3300028379 Bacteria 1876
255 Ga0268265_10657347 3300028380 Bacteria 1008
256 Ga0268264_10135337 3300028381 Bacteria 2190
257 Ga0268264_10244259 3300028381 Bacteria 1664
258 Ga0307517_10004429 3300028786 Bacteria 21580
259 Ga0307517_10208666 3300028786 Bacteria 1207
260 Ga0307517_10293760 3300028786 Bacteria 916
261 Ga0307515_10000089 3300028794 Bacteria 215736
262 Ga0307515_10007880 3300028794 Bacteria 20929
263 Ga0307515_10080120 3300028794 Bacteria 4264
264 Ga0307515_10096015 3300028794 Bacteria 3641
265 Ga0307515_10140346 3300028794 Bacteria 2596
266 Ga0307515_10441188 3300028794 Bacteria 919
267 Ga0307512_10092478 3300030522 Bacteria 2098
268 Ga0265327_10288489 3300031251 Bacteria 724
269 Ga0307513_10000475 3300031456 Bacteria 57792
270 Ga0307509_10017705 3300031507 Bacteria 8190
271 Ga0307509_10041437 3300031507 Bacteria 4995
272 Ga0307509_10093255 3300031507 Bacteria 3074
273 Ga0307509_10616608 3300031507 Bacteria 756
274 Ga0307408_100352167 3300031548 Bacteria 1250
275 Ga0307508_10000144 3300031616 Bacteria 84437
276 Ga0307508_10055973 3300031616 Bacteria 3493
277 Ga0307514_10126492 3300031649 Bacteria 1770
278 Ga0307514_10331856 3300031649 Bacteria 826
279 Ga0307516_10088801 3300031730 Bacteria 2923
280 Ga0307516_10154544 3300031730 Bacteria 2051
281 Ga0307516_10276430 3300031730 Bacteria 1363
282 Ga0307405_10156348 3300031731 Bacteria 1610
283 Ga0307410_12078798 3300031852 Unclassified 508
284 Ga0307409_102374344 3300031995 Bacteria 559
285 Ga0307416_100870370 3300032002 Bacteria 1000
286 Ga0307414_10716338 3300032004 Bacteria 907
287 Ga0307414_10938308 3300032004 Bacteria 795
288 Ga0307411_10823343 3300032005 Bacteria 819
289 Ga0307507_10153752 3300033179 Bacteria 1722
290 Ga0307507_10516069 3300033179 Bacteria 639
291 Ga0307510_10007895 3300033180 Bacteria 12678
292 Ga0307510_10126112 3300033180 Bacteria 2248
293 Ga0373928_0117018 3300035084 Bacteria 711
294 Ga0373949_0094409 3300035090 Bacteria 813
295 Ga0373932_0007566 3300035112 Bacteria 2587
296 Ga0373932_0118438 3300035112 Bacteria 881
297 Ga0373960_0207118 3300035121 Bacteria 696
298 Ga0373931_0017238 3300035691 Bacteria 3568
299 Ga0373931_0075197 3300035691 Bacteria 1852
300 Ga0373931_0724364 3300035691 Bacteria 658
301 Ga0373937_0929233 3300036401 Bacteria 819
302 Ga0373925_0325813 3300037068 Bacteria 1244
303 Ga0373925_1047039 3300037068 Bacteria 672
304 Ga0395900_0000869 3300037418 Bacteria 39681
305 Ga0395898_0009228 3300037466 Bacteria 10377
306 Ga0395905_0012575 3300037471 Bacteria 8141
307 Ga0395905_0084422 3300037471 Bacteria 2975
308 Ga0395905_0428291 3300037471 Bacteria 1220
309 Ga0395901_1601539 3300038443 Bacteria 605
310 Ga0436361_0366200 3300039447 Bacteria 1018
311 Ga0439439_0074404 3300041406 Bacteria 913
312 Ga0451793_0733237 3300041452 Bacteria 693
313 Ga0451795_0897661 3300041456 Bacteria 725
314 Ga0451795_1285723 3300041456 Bacteria 911
315 Ga0451798_0819528 3300041458 Bacteria 3544
316 Ga0451800_0069993 3300041459 Bacteria 1071
317 Ga0451802_1800870 3300041460 Bacteria 663
318 Ga0451807_1373274 3300041486 Bacteria 998
319 Ga0451841_1298502 3300041498 Bacteria 1137
320 Ga0451847_0697530 3300041503 Bacteria 928
321 Ga0439448_0222816 3300042005 Bacteria 663
322 Ga0439449_0047296 3300042007 Bacteria 1594
323 Ga0439462_0008750 3300042015 Bacteria 2559
324 Ga0450919_000586 3300042121 Bacteria 4599
325 Ga0450920_015351 3300042122 Bacteria 1456
326 Ga0450898_082792 3300042134 Bacteria 654
327 Ga0439446_0074468 3300042156 Bacteria 1043
328 Ga0439446_0353337 3300042156 Bacteria 524
329 Ga0450918_000057 3300042531 Bacteria 22722
330 Ga0451577_0119805 3300042876 Bacteria 2357
331 Ga0451577_0140601 3300042876 Bacteria 2169
332 Ga0466969_0002591 3300044656 Bacteria 9659
333 Ga0466969_0109067 3300044656 Bacteria 1297
334 Ga0466972_0000630 3300044658 Bacteria 17098
335 Ga0466972_0156347 3300044658 Bacteria 1071
336 Ga0466972_0185454 3300044658 Bacteria 975
337 Ga0466972_0205010 3300044658 Bacteria 923
338 Ga0466965_0024396 3300044683 Bacteria 2925
339 Ga0466965_0031728 3300044683 Bacteria 2577
340 Ga0466965_0147192 3300044683 Bacteria 1229
341 Ga0466965_0271240 3300044683 Bacteria 914
342 Ga0466966_0101933 3300044684 Bacteria 1775
343 Ga0466966_0757044 3300044684 Bacteria 585
344 Ga0466961_0005069 3300044693 Bacteria 8287
345 Ga0466961_0191454 3300044693 Bacteria 1267
346 Ga0466961_0432865 3300044693 Bacteria 797
347 Ga0466963_0626243 3300044694 Bacteria 759
348 Ga0466963_0874907 3300044694 Bacteria 633
349 Ga0466964_0115516 3300044706 Bacteria 1202
350 Ga0466964_0119963 3300044706 Bacteria 1184
351 Ga0453684_0172542 3300044712 Bacteria 2547
352 Ga0453684_0403032 3300044712 Bacteria 1532
353 Ga0453684_1616616 3300044712 Bacteria 665
354 Ga0453684_2198634 3300044712 Bacteria 551
355 Ga0453684_2205649 3300044712 Bacteria 550
356 Ga0466971_0345442 3300044719 Bacteria 719
357 Ga0466968_0242920 3300044735 Bacteria 853
358 Ga0466970_0033281 3300044765 Bacteria 2724
359 Ga0466970_0164431 3300044765 Bacteria 1228
360 Ga0466970_0647744 3300044765 Bacteria 614
361 Ga0466957_0036480 3300044842 Bacteria 2956
362 Ga0466960_0076021 3300044901 Bacteria 1681
363 Ga0466960_0113216 3300044901 Bacteria 1412
364 Ga0466960_0698919 3300044901 Bacteria 608
365 Ga0466959_0053425 3300045049 Bacteria 2953
366 Ga0466959_0174062 3300045049 Bacteria 1508
367 Ga0451576_0073732 3300045051 Bacteria 3552
368 Ga0451576_0187372 3300045051 Bacteria 2160
369 Ga0451576_0848785 3300045051 Bacteria 959
370 Ga0466958_0161076 3300045836 Bacteria 1417
371 Ga0466967_0256246 3300045976 Bacteria 1673
372 Ga0466967_0345910 3300045976 Bacteria 1438
373 Ga0495629_0164106 3300046459 Bacteria 1543
374 Ga0495638_0080839 3300046460 Bacteria 1974
375 Ga0495638_0093012 3300046460 Bacteria 1814
376 Ga0495641_0164735 3300046461 Bacteria 992
377 Ga0495641_0215947 3300046461 Bacteria 860
378 Ga0495607_0043335 3300046501 Bacteria 2662
379 Ga0495630_0478701 3300046517 Bacteria 954
380 Ga0495632_0003897 3300046519 Bacteria 10371
381 Ga0495632_0043688 3300046519 Bacteria 2239
382 Ga0495663_0273117 3300046525 Bacteria 604
383 Ga0495666_0129965 3300046526 Bacteria 1177
384 Ga0495666_0443838 3300046526 Unclassified 581
385 Ga0495645_0317518 3300046543 Bacteria 1013
386 Ga0495633_0007309 3300046558 Bacteria 6374
387 Ga0495634_0770862 3300046642 Bacteria 550
388 Ga0495624_0018629 3300046690 Bacteria 4642
389 Ga0495670_0276668 3300046691 Bacteria 897
390 Ga0495676_0149588 3300047321 Bacteria 1664
391 Ga0495593_0013515 3300047673 Bacteria 4655
392 Ga0496102_0007028 3300048905 Bacteria 9611
393 Ga0496102_0206116 3300048905 Bacteria 1854
394 Ga0496103_0740306 3300048906 Unclassified 622
395 Ga0496104_0010474 3300048907 Bacteria 8283
396 Ga0496104_0043128 3300048907 Bacteria 4237
397 Ga0496104_0198994 3300048907 Bacteria 1915
398 Ga0496105_0162550 3300048908 Bacteria 1833
399 Ga0496105_0167590 3300048908 Bacteria 1802
400 Ga0496106_0619769 3300048909 Bacteria 866
401 Ga0496108_0016786 3300048911 Bacteria 5981
402 Ga0496108_0352402 3300048911 Bacteria 1284
403 Ga0496109_0122863 3300048912 Bacteria 2419
404 Ga0496109_0128238 3300048912 Bacteria 2366
405 Ga0496109_0393533 3300048912 Bacteria 1309
406 Ga0496109_1715933 3300048912 Bacteria 562
407 Ga0496110_0324790 3300048913 Bacteria 1402
408 Ga0496111_0345714 3300048914 Bacteria 1101
409 Ga0496112_0071325 3300048915 Bacteria 3433
410 Ga0496112_1715617 3300048915 Unclassified 540
411 Ga0496113_0015801 3300048916 Bacteria 5201
412 Ga0496113_0112442 3300048916 Bacteria 2121
413 Ga0496114_0002938 3300048917 Bacteria 13073
414 Ga0496114_0014146 3300048917 Bacteria 6399
415 Ga0496114_1203024 3300048917 Bacteria 644
416 Ga0496115_0370754 3300048918 Bacteria 1165
417 Ga0496122_0331472 3300048925 Bacteria 804
418 Ga0496123_0039564 3300048926 Bacteria 3296
419 Ga0496123_0167983 3300048926 Bacteria 1161
420 Ga0496124_0000733 3300048927 Bacteria 53604
421 Ga0496124_0152061 3300048927 Bacteria 1814
422 Ga0496125_0002986 3300048928 Bacteria 21227
423 Ga0496125_0006417 3300048928 Bacteria 12714
424 Ga0496125_0109890 3300048928 Bacteria 2000
425 Ga0496126_0042132 3300048929 Bacteria 4218
426 Ga0496126_0327763 3300048929 Bacteria 1257
427 Ga0496126_1340342 3300048929 Bacteria 519
428 Ga0501198_000007 3300049649 Bacteria 129700
429 Ga0501222_000005 3300049662 Bacteria 129724
430 Ga0501252_014309 3300049682 Bacteria 979
431 Ga0501266_073208 3300049763 Unclassified 569
432 Ga0501035_0176113 3300049822 Bacteria 1845
433 nmdc:mga03683_284887_c1 3300050489 Bacteria 772
434 nmdc:mga03n38_127941_c1 3300050490 Bacteria 1256
435 nmdc:mga03n38_807404_c1 3300050490 Bacteria 546
436 nmdc:mga00v17_540051_c1 3300050491 Bacteria 754
437 nmdc:mga0k408_143288_c1 3300050493 Bacteria 1422
438 nmdc:mga0k408_219978_c1 3300050493 Bacteria 1134
439 nmdc:mga0k408_242922_c1 3300050493 Bacteria 1075
440 nmdc:mga0k408_378896_c1 3300050493 Bacteria 843
441 nmdc:mga0k408_815313_c1 3300050493 Bacteria 543
442 nmdc:mga0k408_9114_c1 3300050493 Bacteria 5343
443 nmdc:mga06z11_231297_c1 3300050494 Bacteria 1083
444 nmdc:mga06z11_631931_c1 3300050494 Bacteria 652
445 nmdc:mga07m45_2138_c1 3300050496 Bacteria 9202
446 nmdc:mga07m45_502071_c1 3300050496 Bacteria 702
447 nmdc:mga07m45_664861_c1 3300050496 Bacteria 600
448 nmdc:mga07m45_70448_c1 3300050496 Bacteria 1989
449 nmdc:mga07m45_9684_c1 3300050496 Bacteria 5008
450 nmdc:mga05p37_333374_c1 3300050507 Bacteria 1791
451 nmdc:mga09592_1333395_c1 3300050508 Bacteria 589
452 nmdc:mga0n895_1206366_c1 3300050512 Bacteria 730
453 Ga0495601_0077392 3300053077 Bacteria 2130
454 Ga0500578_0008751 3300053086 Bacteria 6604
455 Ga0500578_0206202 3300053086 Bacteria 1201
456 Ga0500643_151232 3300053087 Bacteria 623
457 Ga0500646_0012964 3300053090 Bacteria 2156
458 Ga0500583_0447144 3300053092 Bacteria 614
459 Ga0500651_0000274 3300053093 Bacteria 30518
460 Ga0500651_0148959 3300053093 Bacteria 1406
461 Ga0500650_0129849 3300053098 Bacteria 1172
462 Ga0500650_0181323 3300053098 Bacteria 965
463 Ga0500555_156941 3300053103 Bacteria 556
464 Ga0500628_047394 3300053129 Bacteria 1006
465 Ga0500642_0010703 3300053130 Bacteria 3247
466 Ga0500652_001460 3300053131 Bacteria 7316
467 Ga0500655_004558 3300053133 Bacteria 2494
468 Ga0500568_0006876 3300053139 Bacteria 5659
469 Ga0500568_0066393 3300053139 Bacteria 1387
470 Ga0500577_0485915 3300053142 Bacteria 539
471 Ga0500588_0187081 3300053146 Bacteria 763
472 Ga0500604_0119524 3300053151 Bacteria 880
473 Ga0500604_0250234 3300053151 Bacteria 613
474 Ga0500622_0000198 3300053156 Bacteria 63633
475 Ga0500622_0071831 3300053156 Bacteria 1748
476 Ga0500634_0090953 3300053161 Bacteria 1549
477 Ga0500596_029920 3300053735 Bacteria 842
478 Ga0590071_023730 3300059421 Bacteria 1452
479 Ga0501082_0843071 3300060353 Bacteria 802
480 Ga0466962_0037086 3300061719 Bacteria 2333
481 Ga0466962_0096775 3300061719 Bacteria 1415
482 2587725939 2585428057 Bacteria 6737412
483 2587735590 2585428058 Bacteria 6853932
484 2643967957 2643221592 Bacteria 6608788
485 2644143143 2643221625 Bacteria 6512927
486 2644247721 2643221644 Bacteria 6865017
487 2644271769 2643221648 Bacteria 6521465
488 2722886340 2721755523 Bacteria 6430384
489 2831867560 2831864461 Bacteria 6502356
490 2839141979 2839138175 Bacteria 6549354
491 2932422501 2932422444 Bacteria 4678430
492 rootH1_10023557
493 JGI25156J39149_1010217
494 JGI25152J39213_1002003
495 JGI25153J46596_10001615
496 JGI25153J46596_10002191
497 rootL2_10001066
498 rootH1_10049922
499 rootH1_10053669
500 Ga0055526_1001240
501 Ga0055524_1000140
502 Ga0055524_1036596
503 Ga0055530_10004184
504 Ga0055530_10123133
505 Ga0055540_1000133
506 Ga0055540_1091817
507 Ga0055531_10015175
508 Ga0065165_1001730
509 Ga0065165_1005111
510 Ga0070676_10013521
511 Ga0070683_101665402
512 Ga0070690_100007700
513 Ga0070670_100006722
514 Ga0070670_100090555
515 Ga0070670_100409428
516 Ga0068869_100007134
517 Ga0068869_100129701
518 Ga0070666_10106833
519 Ga0070666_10726576
520 Ga0070682_100268582
521 Ga0070682_100397847
522 Ga0068868_100002350
523 Ga0068868_100016604
524 Ga0068868_101410386
525 Ga0070689_100012109
526 Ga0070661_100543116
527 Ga0070661_100645003
528 Ga0070669_101382351
529 Ga0070675_100022707
530 Ga0070675_100275994
531 Ga0070671_100010201
532 Ga0070671_100026606
533 Ga0070671_100130806
534 Ga0070674_100664830
535 Ga0070673_100059269
536 Ga0070659_101374245
537 Ga0070667_100132627
538 Ga0070667_100241446
539 Ga0070667_100394580
540 Ga0070705_101524703
541 Ga0070663_100011032
542 Ga0070678_100272085
543 Ga0070662_100608167
544 Ga0068867_100006872
545 Ga0068867_101113788
546 Ga0068867_101406644
547 Ga0070685_10176281
548 Ga0070684_100334886
549 Ga0068853_100830352
550 Ga0068853_101198687
551 Ga0070672_100002832
552 Ga0070686_100009188
553 Ga0070665_100023164
554 Ga0070665_100483667
555 Ga0070665_101918793
556 Ga0068855_102066291
557 Ga0070664_100017067
558 Ga0068857_100075171
559 Ga0068857_100633031
560 Ga0068856_100371163
561 Ga0068852_100005168
562 Ga0068852_100087578
563 Ga0068852_101334922
564 Ga0068852_102178309
565 Ga0068859_100030515
566 Ga0068859_100972475
567 Ga0068859_101294453
568 Ga0068864_100645509
569 Ga0068864_102463642
570 Ga0068861_100421418
571 Ga0068851_10090017
572 Ga0068863_100005336
573 Ga0068863_100240522
574 Ga0068858_100031940
575 Ga0068858_101935106
576 Ga0068860_100062413
577 Ga0068860_100137506
578 Ga0068862_100779931
579 Ga0068862_100912963
580 Ga0075363_100189863
581 Ga0075363_100235504
582 Ga0075364_10730144
583 Ga0070712_101647717
584 Ga0075362_10120212
585 Ga0075367_10146437
586 Ga0075367_10170149
587 Ga0075369_10308152
588 Ga0075366_10059516
589 Ga0075366_10228873
590 Ga0075366_10551127
591 Ga0097621_100090173
592 Ga0075370_10000170
593 Ga0075370_10042579
594 Ga0075370_10062188
595 Ga0068871_100008034
596 Ga0068871_100082224
597 Ga0075429_100954261
598 Ga0068865_100278505
599 Ga0097620_100030515
600 Ga0097620_100972554
601 Ga0097620_101294482
602 Ga0099823_1000064
603 Ga0079104_1000053
604 Ga0079104_1000226
605 Ga0105250_10000883
606 Ga0105240_10021275
607 Ga0105245_10035891
608 Ga0105245_10310536
609 Ga0105245_11828693
610 Ga0105247_10178553
611 Ga0114129_10021325
612 Ga0105243_10006749
613 Ga0105243_10227952
614 Ga0105243_10426329
615 Ga0105242_10210463
616 Ga0105242_11700955
617 Ga0105248_10030357
618 Ga0105248_10033356
619 Ga0105248_11860197
620 Ga0105248_12097523
621 Ga0105237_10000668
622 Ga0105237_10377305
623 Ga0105237_10993392
624 Ga0105238_10003328
625 Ga0105238_10005970
626 Ga0105238_10723388
627 Ga0105239_10001255
628 Ga0105239_10048403
629 Ga0105239_10345396
630 Ga0105246_10153220
631 Ga0105246_10154687
632 Ga0157371_10531352
633 Ga0157374_10001952
634 Ga0157378_10234096
635 Ga0163162_10058987
636 Ga0157375_10022170
637 Ga0157375_13313841
638 Ga0163163_10021346
639 Ga0157380_10440977
640 Ga0157379_10038357
641 Ga0157379_10634509
642 Ga0157376_10017998
643 Ga0207425_1001307
644 Ga0209759_1000953
645 Ga0209129_1000158
646 Ga0209565_1026048
647 Ga0209673_1004078
648 Ga0209673_1023348
649 Ga0209673_1048315
650 Ga0209673_1053295
651 Ga0209675_1026032
652 Ga0209564_1000008
653 Ga0209564_1000282
654 Ga0209758_1000815
655 Ga0209758_1000910
656 Ga0209050_1000223
657 Ga0209050_1001950
658 Ga0209050_1012281
659 Ga0209050_1033824
660 Ga0209256_1000045
661 Ga0209256_1000913
662 Ga0209051_1000004
663 Ga0209051_1012370
664 Ga0209051_1027563
665 Ga0209257_1000315
666 Ga0209257_1000444
667 Ga0209257_1014988
668 Ga0209257_1031627
669 Ga0207656_10331827
670 Ga0207696_1000950
671 Ga0207710_10095143
672 Ga0207680_10587533
673 Ga0207680_11020299
674 Ga0207645_10005951
675 Ga0207643_10024334
676 Ga0207684_10045546
677 Ga0207695_10004981
678 Ga0207671_10004435
679 Ga0207671_10258124
680 Ga0207693_11141459
681 Ga0207649_10611556
682 Ga0207649_10676364
683 Ga0207649_11367003
684 Ga0207694_10005362
685 Ga0207694_10114306
686 Ga0207694_10123036
687 Ga0207650_10051780
688 Ga0207650_10134431
689 Ga0207650_10437832
690 Ga0207659_10037848
691 Ga0207687_10920175
692 Ga0207644_10263256
693 Ga0207644_10790843
694 Ga0207644_11556298
695 Ga0207644_11616758
696 Ga0207706_10032559
697 Ga0207706_10042537
698 Ga0207706_10217684
699 Ga0207706_10473484
700 Ga0207686_10185761
701 Ga0207709_10000151
702 Ga0207670_10057065
703 Ga0207704_11020295
704 Ga0207691_10009672
705 Ga0207711_10020574
706 Ga0207711_10048382
707 Ga0207689_10019740
708 Ga0207679_10966554
709 Ga0207658_10044823
710 Ga0207658_10082072
711 Ga0207658_10213455
712 Ga0207677_10258407
713 Ga0207677_10414806
714 Ga0207703_10423458
715 Ga0207703_11021712
716 Ga0207639_10354584
717 Ga0207639_10686077
718 Ga0207678_10005808
719 Ga0207702_10288666
720 Ga0207641_10008413
721 Ga0207641_10122397
722 Ga0207641_10219494
723 Ga0207648_10004116
724 Ga0207648_10528027
725 Ga0207648_11045261
726 Ga0207676_10015672
727 Ga0207676_10172419
728 Ga0207676_10584090
729 Ga0207674_10049618
730 Ga0207674_10147891
731 Ga0207674_11032470
732 Ga0207674_11182310
733 Ga0207674_11334902
734 Ga0207675_102257750
735 Ga0207683_10195880
736 Ga0207683_10327942
737 Ga0207683_11841103
738 Ga0207698_10057436
739 Ga0207698_10108141
740 Ga0207698_10827507
741 Ga0207698_11136268
742 Ga0209281_1000002
743 Ga0209281_1000147
744 Ga0209389_1017567
745 Ga0268266_10189741
746 Ga0268265_10657347
747 Ga0268264_10135337
748 Ga0268264_10244259
749 Ga0307517_10004429
750 Ga0307517_10208666
751 Ga0307517_10293760
752 Ga0307515_10000089
753 Ga0307515_10007880
754 Ga0307515_10080120
755 Ga0307515_10096015
756 Ga0307515_10140346
757 Ga0307515_10441188
758 Ga0307512_10092478
759 Ga0265327_10288489
760 Ga0307513_10000475
761 Ga0307509_10017705
762 Ga0307509_10041437
763 Ga0307509_10093255
764 Ga0307509_10616608
765 Ga0307408_100352167
766 Ga0307508_10000144
767 Ga0307508_10055973
768 Ga0307514_10126492
769 Ga0307514_10331856
770 Ga0307516_10088801
771 Ga0307516_10154544
772 Ga0307516_10276430
773 Ga0307405_10156348
774 Ga0307410_12078798
775 Ga0307409_102374344
776 Ga0307416_100870370
777 Ga0307414_10716338
778 Ga0307414_10938308
779 Ga0307411_10823343
780 Ga0307507_10153752
781 Ga0307507_10516069
782 Ga0307510_10007895
783 Ga0307510_10126112
784 Ga0373928_0117018
785 Ga0373949_0094409
786 Ga0373932_0007566
787 Ga0373932_0118438
788 Ga0373960_0207118
789 Ga0373931_0017238
790 Ga0373931_0075197
791 Ga0373931_0724364
792 Ga0373937_0929233
793 Ga0373925_0325813
794 Ga0373925_1047039
795 Ga0395900_0000869
796 Ga0395898_0009228
797 Ga0395905_0012575
798 Ga0395905_0084422
799 Ga0395905_0428291
800 Ga0395901_1601539
801 Ga0436361_0366200
802 Ga0439439_0074404
803 Ga0451793_0733237
804 Ga0451795_0897661
805 Ga0451795_1285723
806 Ga0451798_0819528
807 Ga0451800_0069993
808 Ga0451802_1800870
809 Ga0451807_1373274
810 Ga0451841_1298502
811 Ga0451847_0697530
812 Ga0439448_0222816
813 Ga0439449_0047296
814 Ga0439462_0008750
815 Ga0450919_000586
816 Ga0450920_015351
817 Ga0450898_082792
818 Ga0439446_0074468
819 Ga0439446_0353337
820 Ga0450918_000057
821 Ga0451577_0119805
822 Ga0451577_0140601
823 Ga0466969_0002591
824 Ga0466969_0109067
825 Ga0466972_0000630
826 Ga0466972_0156347
827 Ga0466972_0185454
828 Ga0466972_0205010
829 Ga0466965_0024396
830 Ga0466965_0031728
831 Ga0466965_0147192
832 Ga0466965_0271240
833 Ga0466966_0101933
834 Ga0466966_0757044
835 Ga0466961_0005069
836 Ga0466961_0191454
837 Ga0466961_0432865
838 Ga0466963_0626243
839 Ga0466963_0874907
840 Ga0466964_0115516
841 Ga0466964_0119963
842 Ga0453684_0172542
843 Ga0453684_0403032
844 Ga0453684_1616616
845 Ga0453684_2198634
846 Ga0453684_2205649
847 Ga0466971_0345442
848 Ga0466968_0242920
849 Ga0466970_0033281
850 Ga0466970_0164431
851 Ga0466970_0647744
852 Ga0466957_0036480
853 Ga0466960_0076021
854 Ga0466960_0113216
855 Ga0466960_0698919
856 Ga0466959_0053425
857 Ga0466959_0174062
858 Ga0451576_0073732
859 Ga0451576_0187372
860 Ga0451576_0848785
861 Ga0466958_0161076
862 Ga0466967_0256246
863 Ga0466967_0345910
864 Ga0495629_0164106
865 Ga0495638_0080839
866 Ga0495638_0093012
867 Ga0495641_0164735
868 Ga0495641_0215947
869 Ga0495607_0043335
870 Ga0495630_0478701
871 Ga0495632_0003897
872 Ga0495632_0043688
873 Ga0495663_0273117
874 Ga0495666_0129965
875 Ga0495666_0443838
876 Ga0495645_0317518
877 Ga0495633_0007309
878 Ga0495634_0770862
879 Ga0495624_0018629
880 Ga0495670_0276668
881 Ga0495676_0149588
882 Ga0495593_0013515
883 Ga0496102_0007028
884 Ga0496102_0206116
885 Ga0496103_0740306
886 Ga0496104_0010474
887 Ga0496104_0043128
888 Ga0496104_0198994
889 Ga0496105_0162550
890 Ga0496105_0167590
891 Ga0496106_0619769
892 Ga0496108_0016786
893 Ga0496108_0352402
894 Ga0496109_0122863
895 Ga0496109_0128238
896 Ga0496109_0393533
897 Ga0496109_1715933
898 Ga0496110_0324790
899 Ga0496111_0345714
900 Ga0496112_0071325
901 Ga0496112_1715617
902 Ga0496113_0015801
903 Ga0496113_0112442
904 Ga0496114_0002938
905 Ga0496114_0014146
906 Ga0496114_1203024
907 Ga0496115_0370754
908 Ga0496122_0331472
909 Ga0496123_0039564
910 Ga0496123_0167983
911 Ga0496124_0000733
912 Ga0496124_0152061
913 Ga0496125_0002986
914 Ga0496125_0006417
915 Ga0496125_0109890
916 Ga0496126_0042132
917 Ga0496126_0327763
918 Ga0496126_1340342
919 Ga0501198_000007
920 Ga0501222_000005
921 Ga0501252_014309
922 Ga0501266_073208
923 Ga0501035_0176113
924 nmdc:mga03683_284887_c1
925 nmdc:mga03n38_127941_c1
926 nmdc:mga03n38_807404_c1
927 nmdc:mga00v17_540051_c1
928 nmdc:mga0k408_143288_c1
929 nmdc:mga0k408_219978_c1
930 nmdc:mga0k408_242922_c1
931 nmdc:mga0k408_378896_c1
932 nmdc:mga0k408_815313_c1
933 nmdc:mga0k408_9114_c1
934 nmdc:mga06z11_231297_c1
935 nmdc:mga06z11_631931_c1
936 nmdc:mga07m45_2138_c1
937 nmdc:mga07m45_502071_c1
938 nmdc:mga07m45_664861_c1
939 nmdc:mga07m45_70448_c1
940 nmdc:mga07m45_9684_c1
941 nmdc:mga05p37_333374_c1
942 nmdc:mga09592_1333395_c1
943 nmdc:mga0n895_1206366_c1
944 Ga0495601_0077392
945 Ga0500578_0008751
946 Ga0500578_0206202
947 Ga0500643_151232
948 Ga0500646_0012964
949 Ga0500583_0447144
950 Ga0500651_0000274
951 Ga0500651_0148959
952 Ga0500650_0129849
953 Ga0500650_0181323
954 Ga0500555_156941
955 Ga0500628_047394
956 Ga0500642_0010703
957 Ga0500652_001460
958 Ga0500655_004558
959 Ga0500568_0006876
960 Ga0500568_0066393
961 Ga0500577_0485915
962 Ga0500588_0187081
963 Ga0500604_0119524
964 Ga0500604_0250234
965 Ga0500622_0000198
966 Ga0500622_0071831
967 Ga0500634_0090953
968 Ga0500596_029920
969 Ga0590071_023730
970 Ga0501082_0843071
971 Ga0466962_0037086
972 Ga0466962_0096775
973 2587725939
974 2587735590
975 2643967957
976 2644143143
977 2644247721
978 2644271769
979 2722886340
980 2831867560
981 2839141979
982 2932422501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05437

AzlD

Branched-chain amino acid transport protein (AzlD)

19

117

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o3s-assembly1.cif.gz_A nmr solution structure of luffin p1 0.681 71 108
6o3s-assembly1.cif.gz_A nmr solution structure of luffin p1 0.5841 71 108
4evx-assembly1.cif.gz_A crystal structure of putative phage endolysin from s. enterica 0.4975 74 106
8bef-assembly1.cif.gz_Y cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane core) 0.4541 28 105
4u2v-assembly2.cif.gz_A bak bh3-in-groove dimer (gfp) 0.4337 44 105
ID Description Score Start End Superfamily
af_Q7TT23_218_505_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9424 71 108 3.90.230.10
6o3sA00 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.681 71 108 6.10.250.890
6o3sA00 Special;Helix non-globular;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.5841 71 108 6.10.250.890
af_Q5NBD8_1_100_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.4552 70 106 1.10.10.1740
af_F6WYW0_8_93_1.20.920.50 Mainly Alpha;Up-down Bundle;Histone Acetyltransferase; Chain A; 0.4485 48 106 1.20.920.50
ID Description Score Start End GO Terms
AF-A0A7H1JC84-F1-model_v4 AzlD domain-containing protein 0.8454 59 109 GO:0016020
AF-A0A433VM27-F1-model_v4 Branched-chain amino acid ABC transporter 0.8123 14 105 GO:0016020
AF-A0A5S4F8C7-F1-model_v4 AzlD domain-containing protein 0.7969 14 105 GO:0016020
AF-A0A7H1JC84-F1-model_v4 AzlD domain-containing protein 0.7894 59 109 GO:0016020
AF-A0A356ZB68-F1-model_v4 AzlD domain-containing protein 0.7862 43 109 GO:0016020

Map