F453966

General Info

Members Datasets Scaffolds Average Seq Length
490 258 980 315

Family's Representative Sequence

Representative Sequence 3300035120|Ga0373957_0013888|Ga0373957_0013888_1440_2483
Length 347
Sequence MPTAKGTPTRIEGAAMPSNTPGKITPKKVAVGVGLMEFPFSGAAAYWRWVDLCEAGGVDSIWQTDRLVSPTPFLECMSVMAALAGRTRRIKFGVNVLSLAMRDAVLVARQCATIDFLSNGRLLPAFGIGSPLGPEWKTLNLDTKTRGRKTDEGLEVIRRLWSEDKVDFEGVHYHLSGASLSPKPVQPDLPMWIGGSSEAAIRRTALLGTGWQAGPETPEQARVVVAAISAAAIEAGRPIDDDHYGAGIPFRFGAADDPALVPLFDAYKKRTGRDPKDYFAIGDAEAITGRIAAYVDAGVSKFILRPAAKGDDEIMAQTRRLIAEVLPLVATRWPKPAKRRAAAQAAE

Samples

Sample ID Description Type Environment
1 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
158 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
250 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
251 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
252 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
253 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
254 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
255 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
256 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
257 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
258 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.41
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 0.2
Rhizoplane 6.12
Rhizosphere 82.45
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373957_0013888 3300035120 Bacteria 2743
2 rootH1_10099256 3300003323 Bacteria 5696
3 JGI25404J52841_10000190 3300003659 Bacteria 7211
4 Ga0070683_100123720 3300005329 Bacteria 2444
5 Ga0070670_100000022 3300005331 Bacteria 199146
6 Ga0070670_100005325 3300005331 Bacteria 10854
7 Ga0070666_10005583 3300005335 Bacteria 7716
8 Ga0070682_100279866 3300005337 Bacteria 1215
9 Ga0070689_100200546 3300005340 Bacteria 1629
10 Ga0070661_100156098 3300005344 Bacteria 1727
11 Ga0070668_100000316 3300005347 Bacteria 31896
12 Ga0070668_100008736 3300005347 Bacteria 7524
13 Ga0070668_100016943 3300005347 Bacteria 5450
14 Ga0070668_100046131 3300005347 Bacteria 3345
15 Ga0070668_100257090 3300005347 Bacteria 1451
16 Ga0070675_100213377 3300005354 Bacteria 1679
17 Ga0070671_100011757 3300005355 Bacteria 7040
18 Ga0070671_100158059 3300005355 Bacteria 1915
19 Ga0070671_100171180 3300005355 Bacteria 1837
20 Ga0070673_100224971 3300005364 Bacteria 1626
21 Ga0070659_100372897 3300005366 Bacteria 1201
22 Ga0070667_100000292 3300005367 Bacteria 56417
23 Ga0070667_100002243 3300005367 Bacteria 17027
24 Ga0070667_100009074 3300005367 Bacteria 8227
25 Ga0070667_100212751 3300005367 Bacteria 1719
26 Ga0070709_10042796 3300005434 Bacteria 2799
27 Ga0070709_10094782 3300005434 Bacteria 1975
28 Ga0070714_100095430 3300005435 Bacteria 2612
29 Ga0070714_100105663 3300005435 Bacteria 2487
30 Ga0070714_100257649 3300005435 Bacteria 1615
31 Ga0070714_100420213 3300005435 Bacteria 1266
32 Ga0070713_100027910 3300005436 Bacteria 4451
33 Ga0070713_100051192 3300005436 Bacteria 3415
34 Ga0070710_10066507 3300005437 Bacteria 2066
35 Ga0070711_100023156 3300005439 Bacteria 4035
36 Ga0070711_100171646 3300005439 Bacteria 1653
37 Ga0070708_100104908 3300005445 Bacteria 2592
38 Ga0070678_100008334 3300005456 Bacteria 6206
39 Ga0070678_100042023 3300005456 Bacteria 3246
40 Ga0070681_10000644 3300005458 Bacteria 28769
41 Ga0070706_100075971 3300005467 Bacteria 3109
42 Ga0070707_100005696 3300005468 Bacteria 11628
43 Ga0070698_100003027 3300005471 Bacteria 18526
44 Ga0070699_100133973 3300005518 Bacteria 2185
45 Ga0070699_100168961 3300005518 Bacteria 1937
46 Ga0070679_100054785 3300005530 Bacteria 3972
47 Ga0070679_100114085 3300005530 Bacteria 2687
48 Ga0070697_100197748 3300005536 Bacteria 1708
49 Ga0068853_100158071 3300005539 Bacteria 2043
50 Ga0068853_100374048 3300005539 Bacteria 1330
51 Ga0070665_100000311 3300005548 Bacteria 75738
52 Ga0070665_100002161 3300005548 Bacteria 21928
53 Ga0070665_100073510 3300005548 Bacteria 3424
54 Ga0070665_100114735 3300005548 Bacteria 2696
55 Ga0070665_100115488 3300005548 Bacteria 2687
56 Ga0070665_100159115 3300005548 Bacteria 2260
57 Ga0070665_100314606 3300005548 Bacteria 1570
58 Ga0068855_100014874 3300005563 Bacteria 9373
59 Ga0070664_100219751 3300005564 Bacteria 1700
60 Ga0068857_100129320 3300005577 Bacteria 2277
61 Ga0068854_100248398 3300005578 Bacteria 1420
62 Ga0068856_100199271 3300005614 Bacteria 2017
63 Ga0068856_100536194 3300005614 Bacteria 1191
64 Ga0068852_100094804 3300005616 Bacteria 2678
65 Ga0068859_100022764 3300005617 Bacteria 6283
66 Ga0068864_100000131 3300005618 Bacteria 72744
67 Ga0068864_100016267 3300005618 Bacteria 6192
68 Ga0068864_100030069 3300005618 Bacteria 4604
69 Ga0068864_100040022 3300005618 Bacteria 4009
70 Ga0068864_100211989 3300005618 Bacteria 1784
71 Ga0068864_100223643 3300005618 Bacteria 1738
72 Ga0068861_100038614 3300005719 Bacteria 3558
73 Ga0068861_100062068 3300005719 Bacteria 2869
74 Ga0068861_100126091 3300005719 Bacteria 2071
75 Ga0068861_100239523 3300005719 Bacteria 1542
76 Ga0068863_100000914 3300005841 Bacteria 29640
77 Ga0068863_100009874 3300005841 Bacteria 9296
78 Ga0068863_100086956 3300005841 Bacteria 2962
79 Ga0068858_100006573 3300005842 Bacteria 11311
80 Ga0068858_100032838 3300005842 Bacteria 4820
81 Ga0068858_100128160 3300005842 Bacteria 2378
82 Ga0068858_100208763 3300005842 Bacteria 1848
83 Ga0068860_100000051 3300005843 Bacteria 208179
84 Ga0068860_100000136 3300005843 Bacteria 120083
85 Ga0068860_100004951 3300005843 Bacteria 13574
86 Ga0068860_100010015 3300005843 Bacteria 9396
87 Ga0068860_100059855 3300005843 Bacteria 3620
88 Ga0068860_100204183 3300005843 Unclassified 1916
89 Ga0068860_100337770 3300005843 Bacteria 1481
90 Ga0068862_100003345 3300005844 Bacteria 13842
91 Ga0068862_100015604 3300005844 Bacteria 6310
92 Ga0068862_100070333 3300005844 Bacteria 3021
93 Ga0068862_100076638 3300005844 Bacteria 2894
94 Ga0068862_100259085 3300005844 Bacteria 1587
95 Ga0081540_1000370 3300005983 Bacteria 45002
96 Ga0081540_1005450 3300005983 Bacteria 9494
97 Ga0081540_1015999 3300005983 Bacteria 4723
98 Ga0070717_10015962 3300006028 Bacteria 5813
99 Ga0070717_10078791 3300006028 Bacteria 2762
100 Ga0075365_10046652 3300006038 Bacteria 2846
101 Ga0075363_100002481 3300006048 Bacteria 7551
102 Ga0075363_100039879 3300006048 Bacteria 2474
103 Ga0070716_100156835 3300006173 Bacteria 1471
104 Ga0070712_100038116 3300006175 Bacteria 3282
105 Ga0070712_100123975 3300006175 Bacteria 1948
106 Ga0075367_10002181 3300006178 Bacteria 8816
107 Ga0075369_10040591 3300006186 Unclassified 1990
108 Ga0075366_10101255 3300006195 Bacteria 1729
109 Ga0068871_100423114 3300006358 Bacteria 1190
110 Ga0075428_100578083 3300006844 Bacteria 1201
111 Ga0075436_100044159 3300006914 Bacteria 3072
112 Ga0097620_100022764 3300006931 Bacteria 6283
113 Ga0099795_10006586 3300007788 Bacteria 3181
114 Ga0099795_10024467 3300007788 Bacteria 2015
115 Ga0105240_10005185 3300009093 Bacteria 19495
116 Ga0105240_10054475 3300009093 Bacteria 5013
117 Ga0111539_10009850 3300009094 Bacteria 12057
118 Ga0111539_10187711 3300009094 Bacteria 2413
119 Ga0111539_10553125 3300009094 Unclassified 1340
120 Ga0105245_10378087 3300009098 Bacteria 1410
121 Ga0105241_10160344 3300009174 Bacteria 1848
122 Ga0105248_10055025 3300009177 Bacteria 4463
123 Ga0105248_10201317 3300009177 Bacteria 2243
124 Ga0105248_10455210 3300009177 Bacteria 1442
125 Ga0105248_10735827 3300009177 Bacteria 1113
126 Ga0105238_10056841 3300009551 Bacteria 3924
127 Ga0105238_10402227 3300009551 Bacteria 1363
128 Ga0105249_10000296 3300009553 Bacteria 51256
129 Ga0105249_10179360 3300009553 Bacteria 2059
130 Ga0099796_10046826 3300010159 Bacteria 1486
131 Ga0105239_10054439 3300010375 Bacteria 4389
132 Ga0105239_10281401 3300010375 Bacteria 1872
133 Ga0157370_10051609 3300013104 Bacteria 3928
134 Ga0157369_10116388 3300013105 Bacteria 2839
135 Ga0157378_10499080 3300013297 Bacteria 1215
136 Ga0163162_10151505 3300013306 Bacteria 2437
137 Ga0163162_10430055 3300013306 Bacteria 1452
138 Ga0163163_10010325 3300014325 Bacteria 8393
139 Ga0163163_10442099 3300014325 Bacteria 1360
140 Ga0157380_10060531 3300014326 Bacteria 3026
141 Ga0182008_10077592 3300014497 Bacteria 1634
142 Ga0157379_10116980 3300014968 Bacteria 2398
143 Ga0157379_10363628 3300014968 Bacteria 1326
144 Ga0206354_10100611 3300020081 Bacteria 1055
145 Ga0213876_10004677 3300021384 Bacteria 7626
146 Ga0213876_10058127 3300021384 Bacteria 2042
147 Ga0213875_10000023 3300021388 Bacteria 213455
148 Ga0213875_10002319 3300021388 Bacteria 11514
149 Ga0213875_10006322 3300021388 Bacteria 6234
150 Ga0213875_10019947 3300021388 Bacteria 3219
151 Ga0213875_10052143 3300021388 Unclassified 1916
152 Ga0224712_10100810 3300022467 Bacteria 1224
153 Ga0209758_1035555 3300025297 Bacteria 1961
154 Ga0207656_10009567 3300025321 Bacteria 3600
155 Ga0207699_10027534 3300025906 Bacteria 3149
156 Ga0207699_10033181 3300025906 Bacteria 2916
157 Ga0207699_10070853 3300025906 Bacteria 2130
158 Ga0207699_10250187 3300025906 Bacteria 1221
159 Ga0207645_10117269 3300025907 Bacteria 1727
160 Ga0207707_10000134 3300025912 Bacteria 77031
161 Ga0207695_10016068 3300025913 Bacteria 8778
162 Ga0207671_10199275 3300025914 Bacteria 1563
163 Ga0207693_10007511 3300025915 Bacteria 8952
164 Ga0207693_10009000 3300025915 Bacteria 8150
165 Ga0207693_10053041 3300025915 Bacteria 3181
166 Ga0207693_10286681 3300025915 Bacteria 1290
167 Ga0207663_10040761 3300025916 Bacteria 2825
168 Ga0207663_10049811 3300025916 Bacteria 2600
169 Ga0207649_10247330 3300025920 Bacteria 1283
170 Ga0207652_10209674 3300025921 Bacteria 1754
171 Ga0207646_10010803 3300025922 Bacteria 8877
172 Ga0207694_10052789 3300025924 Bacteria 3151
173 Ga0207650_10000234 3300025925 Bacteria 61636
174 Ga0207650_10030075 3300025925 Bacteria 3910
175 Ga0207687_10036524 3300025927 Bacteria 3347
176 Ga0207687_10425069 3300025927 Bacteria 1097
177 Ga0207700_10009393 3300025928 Bacteria 6105
178 Ga0207700_10019585 3300025928 Bacteria 4573
179 Ga0207700_10110285 3300025928 Bacteria 2213
180 Ga0207700_10149282 3300025928 Bacteria 1930
181 Ga0207700_10382770 3300025928 Bacteria 1231
182 Ga0207664_10018843 3300025929 Bacteria 5090
183 Ga0207664_10056980 3300025929 Bacteria 3105
184 Ga0207664_10081070 3300025929 Bacteria 2639
185 Ga0207644_10134601 3300025931 Bacteria 1896
186 Ga0207644_10142776 3300025931 Bacteria 1845
187 Ga0207644_10241887 3300025931 Bacteria 1437
188 Ga0207690_10141656 3300025932 Bacteria 1772
189 Ga0207691_10097142 3300025940 Bacteria 2633
190 Ga0207711_10036563 3300025941 Bacteria 4167
191 Ga0207711_10089866 3300025941 Bacteria 2699
192 Ga0207689_10019070 3300025942 Bacteria 5784
193 Ga0207661_10071220 3300025944 Bacteria 2840
194 Ga0207661_10115692 3300025944 Bacteria 2275
195 Ga0207667_10020881 3300025949 Bacteria 7269
196 Ga0207667_10337043 3300025949 Bacteria 1539
197 Ga0207712_10000472 3300025961 Bacteria 33923
198 Ga0207712_10063946 3300025961 Bacteria 2621
199 Ga0207712_10179036 3300025961 Bacteria 1664
200 Ga0207712_10368659 3300025961 Unclassified 1198
201 Ga0207712_10468350 3300025961 Bacteria 1072
202 Ga0207668_10000088 3300025972 Bacteria 69295
203 Ga0207668_10000090 3300025972 Bacteria 68790
204 Ga0207668_10002738 3300025972 Bacteria 10291
205 Ga0207668_10075959 3300025972 Bacteria 2417
206 Ga0207668_10340124 3300025972 Bacteria 1251
207 Ga0207640_10380096 3300025981 Bacteria 1144
208 Ga0207658_10000084 3300025986 Bacteria 104409
209 Ga0207658_10018704 3300025986 Bacteria 4789
210 Ga0207677_10191322 3300026023 Bacteria 1619
211 Ga0207703_10004582 3300026035 Bacteria 11324
212 Ga0207703_10011079 3300026035 Bacteria 7024
213 Ga0207703_10054691 3300026035 Bacteria 3247
214 Ga0207703_10201674 3300026035 Bacteria 1768
215 Ga0207639_10103065 3300026041 Bacteria 2311
216 Ga0207639_10248399 3300026041 Bacteria 1550
217 Ga0207639_10274066 3300026041 Bacteria 1481
218 Ga0207708_10139789 3300026075 Bacteria 1898
219 Ga0207702_10426439 3300026078 Bacteria 1283
220 Ga0207641_10000535 3300026088 Bacteria 42612
221 Ga0207641_10025768 3300026088 Bacteria 4850
222 Ga0207641_10200314 3300026088 Bacteria 1840
223 Ga0207676_10000055 3300026095 Bacteria 124678
224 Ga0207676_10014337 3300026095 Bacteria 5701
225 Ga0207676_10130750 3300026095 Bacteria 2134
226 Ga0207676_10150773 3300026095 Bacteria 2002
227 Ga0207674_10035614 3300026116 Bacteria 5195
228 Ga0207674_10336864 3300026116 Bacteria 1458
229 Ga0207675_100082329 3300026118 Bacteria 3018
230 Ga0207675_100251582 3300026118 Unclassified 1710
231 Ga0207675_100334999 3300026118 Bacteria 1480
232 Ga0207683_10067556 3300026121 Bacteria 3154
233 Ga0207683_10371945 3300026121 Bacteria 1313
234 Ga0207683_10500341 3300026121 Unclassified 1122
235 Ga0209179_1002174 3300027512 Bacteria 2598
236 Ga0209813_10051094 3300027866 Bacteria 1292
237 Ga0207428_10022552 3300027907 Bacteria 5310
238 Ga0268266_10001409 3300028379 Bacteria 28696
239 Ga0268266_10002250 3300028379 Bacteria 21031
240 Ga0268266_10002577 3300028379 Bacteria 19232
241 Ga0268266_10005218 3300028379 Bacteria 12220
242 Ga0268266_10020428 3300028379 Bacteria 5644
243 Ga0268266_10064508 3300028379 Bacteria 3164
244 Ga0268265_10001633 3300028380 Bacteria 18446
245 Ga0268265_10004040 3300028380 Bacteria 10330
246 Ga0268265_10008915 3300028380 Bacteria 6780
247 Ga0268265_10014055 3300028380 Bacteria 5454
248 Ga0268265_10049366 3300028380 Bacteria 3164
249 Ga0268265_10181234 3300028380 Bacteria 1810
250 Ga0268265_10250956 3300028380 Bacteria 1567
251 Ga0268264_10000021 3300028381 Bacteria 481580
252 Ga0268264_10001582 3300028381 Bacteria 21076
253 Ga0268264_10003724 3300028381 Bacteria 13097
254 Ga0268264_10105078 3300028381 Bacteria 2462
255 Ga0268264_10122193 3300028381 Bacteria 2296
256 Ga0268264_10240197 3300028381 Bacteria 1677
257 Ga0265334_10014814 3300028573 Bacteria 3245
258 Ga0265338_10004795 3300028800 Bacteria 18074
259 Ga0265340_10054363 3300031247 Bacteria 1931
260 Ga0307513_10128052 3300031456 Bacteria 2490
261 Ga0307509_10016846 3300031507 Bacteria 8436
262 Ga0307410_10256132 3300031852 Bacteria 1363
263 Ga0307415_100031337 3300032126 Bacteria 3425
264 Ga0307510_10002894 3300033180 Bacteria 19752
265 Ga0373926_0017847 3300035083 Bacteria 2438
266 Ga0373926_0034381 3300035083 Bacteria 1794
267 Ga0373932_0004671 3300035112 Bacteria 3234
268 Ga0373932_0023907 3300035112 Bacteria 1639
269 Ga0373954_0081108 3300035118 Bacteria 1550
270 Ga0373954_0083130 3300035118 Bacteria 1532
271 Ga0373957_0065628 3300035120 Bacteria 1413
272 Ga0373943_0064794 3300035170 Bacteria 1836
273 Ga0373943_0138143 3300035170 Bacteria 1310
274 Ga0373946_0056942 3300035171 Bacteria 1652
275 Ga0373946_0092223 3300035171 Bacteria 1344
276 Ga0373942_0007849 3300035207 Bacteria 2481
277 Ga0373924_0045924 3300035410 Bacteria 1797
278 Ga0373924_0063718 3300035410 Bacteria 1546
279 Ga0373931_0000538 3300035691 Bacteria 15536
280 Ga0373935_0083624 3300035692 Bacteria 2078
281 Ga0373935_0329910 3300035692 Bacteria 1084
282 Ga0373927_0065516 3300035695 Bacteria 2350
283 Ga0373927_0087818 3300035695 Bacteria 2018
284 Ga0373927_0090668 3300035695 Bacteria 1985
285 Ga0373933_0003868 3300035724 Bacteria 8263
286 Ga0373947_0024124 3300035725 Bacteria 3542
287 Ga0373947_0039541 3300035725 Bacteria 2806
288 Ga0373947_0098656 3300035725 Bacteria 1833
289 Ga0373947_0149959 3300035725 Unclassified 1501
290 Ga0373937_0014619 3300036401 Bacteria 6932
291 Ga0373937_0015846 3300036401 Bacteria 6680
292 Ga0373937_0018989 3300036401 Bacteria 6149
293 Ga0373937_0077064 3300036401 Bacteria 3081
294 Ga0373937_0085274 3300036401 Bacteria 2923
295 Ga0373937_0148652 3300036401 Bacteria 2194
296 Ga0373925_0066644 3300037068 Bacteria 2714
297 Ga0373925_0185228 3300037068 Unclassified 1650
298 Ga0373925_0256310 3300037068 Bacteria 1404
299 Ga0395899_0012612 3300037312 Bacteria 6478
300 Ga0395900_0012819 3300037418 Bacteria 8566
301 Ga0395900_0024317 3300037418 Bacteria 6202
302 Ga0395900_0075675 3300037418 Bacteria 3461
303 Ga0395898_0010787 3300037466 Bacteria 9544
304 Ga0395898_0062506 3300037466 Bacteria 3616
305 Ga0436364_0010042 3300037853 Bacteria 102214
306 Ga0436364_0616684 3300037853 Bacteria 34041
307 Ga0436364_0849285 3300037853 Bacteria 39310
308 Ga0436364_0935599 3300037853 Unclassified 1916
309 Ga0436364_1260460 3300037853 Bacteria 34019
310 Ga0436364_1445224 3300037853 Bacteria 3511
311 Ga0395901_0007690 3300038443 Bacteria 10873
312 Ga0395901_0014831 3300038443 Bacteria 7916
313 Ga0395901_0070382 3300038443 Bacteria 3644
314 Ga0395901_0072153 3300038443 Bacteria 3598
315 Ga0436365_0389918 3300039437 Bacteria 2949
316 Ga0436365_0452150 3300039437 Bacteria 1205
317 Ga0436365_0595441 3300039437 Bacteria 2439
318 Ga0436365_1010562 3300039437 Bacteria 3077
319 Ga0436365_1311771 3300039437 Bacteria 1774
320 Ga0436365_1346508 3300039437 Bacteria 1523
321 Ga0436365_1463747 3300039437 Bacteria 11274
322 Ga0436365_1493627 3300039437 Bacteria 6006
323 Ga0436360_0760014 3300039438 Bacteria 1717
324 Ga0436361_0192543 3300039447 Bacteria 1113
325 Ga0436361_0518528 3300039447 Bacteria 2546
326 Ga0436363_1021071 3300039450 Bacteria 1641
327 Ga0436362_0698259 3300039453 Bacteria 1068
328 Ga0439465_0018769 3300041413 Bacteria 2160
329 Ga0439435_0014780 3300042436 Bacteria 1934
330 Ga0439440_0032071 3300042993 Bacteria 1246
331 Ga0466966_0210791 3300044684 Bacteria 1174
332 Ga0466963_0013530 3300044694 Bacteria 5011
333 Ga0466959_0007106 3300045049 Bacteria 7833
334 Ga0466967_0345936 3300045976 Bacteria 1438
335 Ga0495617_007811 3300046452 Bacteria 3702
336 Ga0495592_0037919 3300046454 Bacteria 3627
337 Ga0495603_0008302 3300046455 Bacteria 6277
338 Ga0495603_0012272 3300046455 Bacteria 5187
339 Ga0495603_0068970 3300046455 Bacteria 2080
340 Ga0495603_0079616 3300046455 Bacteria 1920
341 Ga0495591_038893 3300046458 Bacteria 1367
342 Ga0495629_0000708 3300046459 Bacteria 27003
343 Ga0495629_0259448 3300046459 Bacteria 1195
344 Ga0495638_0114799 3300046460 Unclassified 1596
345 Ga0495651_0046722 3300046462 Bacteria 3350
346 Ga0495580_0010335 3300046472 Bacteria 7275
347 Ga0495582_0012779 3300046473 Bacteria 4625
348 Ga0495605_0144418 3300046474 Bacteria 1065
349 Ga0495662_0023817 3300046476 Bacteria 2956
350 Ga0495664_0019068 3300046477 Bacteria 3939
351 Ga0495664_0051419 3300046477 Bacteria 2446
352 Ga0495664_0064052 3300046477 Bacteria 2191
353 Ga0495664_0165802 3300046477 Bacteria 1340
354 Ga0495585_0025943 3300046492 Bacteria 3351
355 Ga0495594_0004174 3300046499 Bacteria 7418
356 Ga0495606_0101959 3300046507 Bacteria 1746
357 Ga0495608_0178791 3300046511 Bacteria 1343
358 Ga0495608_0233466 3300046511 Bacteria 1151
359 Ga0495618_0038811 3300046514 Bacteria 2994
360 Ga0495628_0036029 3300046516 Bacteria 3974
361 Ga0495628_0121609 3300046516 Bacteria 2002
362 Ga0495628_0312311 3300046516 Bacteria 1161
363 Ga0495630_0002613 3300046517 Bacteria 12475
364 Ga0495631_0025467 3300046518 Bacteria 2724
365 Ga0495666_0102852 3300046526 Bacteria 1345
366 Ga0495652_0100726 3300046529 Bacteria 2343
367 Ga0495652_0112823 3300046529 Bacteria 2183
368 Ga0495665_0015268 3300046531 Bacteria 4137
369 Ga0495640_0099415 3300046533 Bacteria 1911
370 Ga0495640_0114530 3300046533 Bacteria 1758
371 Ga0495640_0237781 3300046533 Bacteria 1144
372 Ga0495586_0118619 3300046535 Bacteria 1477
373 Ga0495597_0081777 3300046542 Bacteria 1381
374 Ga0495645_0016193 3300046543 Bacteria 5316
375 Ga0495645_0022504 3300046543 Bacteria 4560
376 Ga0495645_0244358 3300046543 Bacteria 1196
377 Ga0495622_0021126 3300046557 Bacteria 3033
378 Ga0495667_0008808 3300046559 Bacteria 6861
379 Ga0495667_0034670 3300046559 Bacteria 3375
380 Ga0495667_0057878 3300046559 Bacteria 2547
381 Ga0495656_0003901 3300046615 Bacteria 5072
382 Ga0495668_0007060 3300046616 Bacteria 7234
383 Ga0495635_0004326 3300046663 Bacteria 9836
384 Ga0495635_0074198 3300046663 Bacteria 2330
385 Ga0495635_0214293 3300046663 Bacteria 1304
386 Ga0495588_0001004 3300046674 Bacteria 12297
387 Ga0495657_0057472 3300046675 Bacteria 2586
388 Ga0495599_0014634 3300046678 Bacteria 4858
389 Ga0495599_0156229 3300046678 Bacteria 1411
390 Ga0495623_0045102 3300046679 Bacteria 2801
391 Ga0495646_0019886 3300046680 Bacteria 4246
392 Ga0495646_0075069 3300046680 Bacteria 1983
393 Ga0495647_0012842 3300046681 Bacteria 2890
394 Ga0495647_0153685 3300046681 Bacteria 988
395 Ga0495658_0121458 3300046683 Bacteria 1580
396 Ga0495658_0130437 3300046683 Bacteria 1529
397 Ga0495613_0014107 3300046689 Bacteria 5927
398 Ga0495624_0035282 3300046690 Bacteria 3229
399 Ga0495649_0105857 3300046694 Bacteria 1493
400 Ga0495600_0012613 3300046809 Bacteria 5291
401 Ga0495581_0001031 3300047315 Bacteria 15076
402 Ga0495604_0071448 3300047317 Bacteria 2625
403 Ga0495604_0175463 3300047317 Bacteria 1503
404 Ga0495636_0065155 3300047318 Bacteria 1547
405 Ga0495674_0032695 3300047319 Bacteria 4716
406 Ga0495674_0048565 3300047319 Bacteria 3755
407 Ga0495674_0475308 3300047319 Bacteria 1002
408 Ga0495680_0081555 3300047322 Unclassified 2442
409 Ga0495675_0045101 3300047444 Bacteria 2807
410 Ga0495675_0113527 3300047444 Unclassified 1690
411 Ga0495684_0013456 3300047471 Bacteria 6297
412 Ga0495684_0082193 3300047471 Bacteria 2444
413 Ga0495593_0001063 3300047673 Bacteria 16031
414 Ga0495602_0012528 3300048088 Bacteria 8708
415 Ga0495614_0063070 3300048089 Bacteria 1593
416 Ga0496100_0029249 3300048903 Bacteria 3406
417 Ga0496100_0065009 3300048903 Bacteria 2415
418 Ga0496101_0054337 3300048904 Bacteria 2891
419 Ga0496101_0245596 3300048904 Bacteria 1394
420 Ga0496102_0025542 3300048905 Bacteria 5259
421 Ga0496102_0033954 3300048905 Bacteria 4587
422 Ga0496102_0042330 3300048905 Bacteria 4127
423 Ga0496102_0138331 3300048905 Bacteria 2282
424 Ga0496103_0033146 3300048906 Bacteria 3155
425 Ga0496104_0093806 3300048907 Bacteria 2871
426 Ga0496104_0120171 3300048907 Bacteria 2522
427 Ga0496105_0012533 3300048908 Bacteria 6714
428 Ga0496105_0016031 3300048908 Bacteria 5978
429 Ga0496107_0006787 3300048910 Bacteria 7882
430 Ga0496107_0022744 3300048910 Bacteria 4431
431 Ga0496109_0055186 3300048912 Bacteria 3624
432 Ga0496109_0280788 3300048912 Bacteria 1569
433 Ga0496110_0037367 3300048913 Bacteria 4220
434 Ga0496110_0340325 3300048913 Bacteria 1366
435 Ga0496111_0014169 3300048914 Bacteria 5440
436 Ga0496112_0001395 3300048915 Bacteria 18455
437 Ga0496112_0074109 3300048915 Bacteria 3366
438 Ga0496112_0318226 3300048915 Bacteria 1500
439 Ga0496113_0020027 3300048916 Bacteria 4694
440 Ga0496113_0023936 3300048916 Bacteria 4335
441 Ga0496114_0043519 3300048917 Bacteria 3723
442 Ga0496114_0103175 3300048917 Bacteria 2437
443 Ga0496114_0278979 3300048917 Bacteria 1473
444 Ga0496115_0003983 3300048918 Bacteria 10652
445 Ga0496115_0090391 3300048918 Bacteria 2501
446 Ga0496119_0023141 3300048922 Bacteria 4421
447 Ga0496121_0105401 3300048924 Bacteria 2164
448 Ga0496126_0055331 3300048929 Bacteria 3590
449 Ga0496126_0133908 3300048929 Bacteria 2139
450 Ga0501034_0022831 3300049571 Bacteria 6373
451 Ga0501034_0250103 3300049571 Bacteria 1717
452 Ga0501068_0027578 3300049584 Bacteria 3354
453 Ga0501080_0003669 3300049742 Bacteria 13546
454 Ga0501044_0005641 3300049823 Bacteria 13898
455 Ga0501044_0086711 3300049823 Bacteria 3162
456 Ga0501044_0340536 3300049823 Bacteria 1421
457 nmdc:mga03n38_24016_c1 3300050490 Bacteria 2488
458 nmdc:mga03n38_70549_c1 3300050490 Bacteria 1616
459 nmdc:mga00v17_212332_c1 3300050491 Bacteria 1252
460 nmdc:mga0yw44_15276_c1 3300050492 Bacteria 4107
461 nmdc:mga0k408_26208_c1 3300050493 Bacteria 3304
462 nmdc:mga06z11_156361_c1 3300050494 Bacteria 1300
463 nmdc:mga06z11_2643_c1 3300050494 Bacteria 6869
464 nmdc:mga09592_34097_c1 3300050508 Bacteria 4255
465 nmdc:mga08y16_37631_c1 3300050511 Bacteria 5080
466 nmdc:mga08y16_408226_c1 3300050511 Unclassified 1389
467 nmdc:mga08y16_549448_c1 3300050511 Bacteria 1169
468 nmdc:mga08x19_33888_c1 3300050514 Bacteria 3225
469 Ga0495601_0001667 3300053077 Bacteria 12258
470 Ga0495601_0027797 3300053077 Bacteria 3499
471 Ga0495601_0050968 3300053077 Bacteria 2612
472 Ga0495601_0169248 3300053077 Bacteria 1428
473 Ga0495601_0202948 3300053077 Bacteria 1295
474 Ga0495612_0007457 3300053078 Bacteria 4470
475 Ga0495595_0017935 3300053084 Bacteria 3051
476 Ga0495595_0027970 3300053084 Bacteria 2515
477 Ga0495619_0130159 3300053085 Bacteria 1729
478 Ga0495619_0133856 3300053085 Bacteria 1704
479 Ga0495619_0242326 3300053085 Bacteria 1249
480 Ga0500646_0025156 3300053090 Bacteria 1607
481 Ga0500647_0118497 3300053091 Bacteria 1254
482 Ga0500650_0142328 3300053098 Bacteria 1112
483 Ga0500562_046593 3300053108 Bacteria 1156
484 Ga0500595_004444 3300053119 Bacteria 6293
485 Ga0500595_014867 3300053119 Bacteria 2941
486 Ga0500655_012249 3300053133 Bacteria 1558
487 Ga0500577_0045264 3300053142 Bacteria 1625
488 Ga0500589_102526 3300053147 Bacteria 1241
489 Ga0500590_023450 3300053148 Bacteria 3203
490 2513888111 2513237141 Bacteria 8496279
491 Ga0373957_0013888
492 rootH1_10099256
493 JGI25404J52841_10000190
494 Ga0070683_100123720
495 Ga0070670_100000022
496 Ga0070670_100005325
497 Ga0070666_10005583
498 Ga0070682_100279866
499 Ga0070689_100200546
500 Ga0070661_100156098
501 Ga0070668_100000316
502 Ga0070668_100008736
503 Ga0070668_100016943
504 Ga0070668_100046131
505 Ga0070668_100257090
506 Ga0070675_100213377
507 Ga0070671_100011757
508 Ga0070671_100158059
509 Ga0070671_100171180
510 Ga0070673_100224971
511 Ga0070659_100372897
512 Ga0070667_100000292
513 Ga0070667_100002243
514 Ga0070667_100009074
515 Ga0070667_100212751
516 Ga0070709_10042796
517 Ga0070709_10094782
518 Ga0070714_100095430
519 Ga0070714_100105663
520 Ga0070714_100257649
521 Ga0070714_100420213
522 Ga0070713_100027910
523 Ga0070713_100051192
524 Ga0070710_10066507
525 Ga0070711_100023156
526 Ga0070711_100171646
527 Ga0070708_100104908
528 Ga0070678_100008334
529 Ga0070678_100042023
530 Ga0070681_10000644
531 Ga0070706_100075971
532 Ga0070707_100005696
533 Ga0070698_100003027
534 Ga0070699_100133973
535 Ga0070699_100168961
536 Ga0070679_100054785
537 Ga0070679_100114085
538 Ga0070697_100197748
539 Ga0068853_100158071
540 Ga0068853_100374048
541 Ga0070665_100000311
542 Ga0070665_100002161
543 Ga0070665_100073510
544 Ga0070665_100114735
545 Ga0070665_100115488
546 Ga0070665_100159115
547 Ga0070665_100314606
548 Ga0068855_100014874
549 Ga0070664_100219751
550 Ga0068857_100129320
551 Ga0068854_100248398
552 Ga0068856_100199271
553 Ga0068856_100536194
554 Ga0068852_100094804
555 Ga0068859_100022764
556 Ga0068864_100000131
557 Ga0068864_100016267
558 Ga0068864_100030069
559 Ga0068864_100040022
560 Ga0068864_100211989
561 Ga0068864_100223643
562 Ga0068861_100038614
563 Ga0068861_100062068
564 Ga0068861_100126091
565 Ga0068861_100239523
566 Ga0068863_100000914
567 Ga0068863_100009874
568 Ga0068863_100086956
569 Ga0068858_100006573
570 Ga0068858_100032838
571 Ga0068858_100128160
572 Ga0068858_100208763
573 Ga0068860_100000051
574 Ga0068860_100000136
575 Ga0068860_100004951
576 Ga0068860_100010015
577 Ga0068860_100059855
578 Ga0068860_100204183
579 Ga0068860_100337770
580 Ga0068862_100003345
581 Ga0068862_100015604
582 Ga0068862_100070333
583 Ga0068862_100076638
584 Ga0068862_100259085
585 Ga0081540_1000370
586 Ga0081540_1005450
587 Ga0081540_1015999
588 Ga0070717_10015962
589 Ga0070717_10078791
590 Ga0075365_10046652
591 Ga0075363_100002481
592 Ga0075363_100039879
593 Ga0070716_100156835
594 Ga0070712_100038116
595 Ga0070712_100123975
596 Ga0075367_10002181
597 Ga0075369_10040591
598 Ga0075366_10101255
599 Ga0068871_100423114
600 Ga0075428_100578083
601 Ga0075436_100044159
602 Ga0097620_100022764
603 Ga0099795_10006586
604 Ga0099795_10024467
605 Ga0105240_10005185
606 Ga0105240_10054475
607 Ga0111539_10009850
608 Ga0111539_10187711
609 Ga0111539_10553125
610 Ga0105245_10378087
611 Ga0105241_10160344
612 Ga0105248_10055025
613 Ga0105248_10201317
614 Ga0105248_10455210
615 Ga0105248_10735827
616 Ga0105238_10056841
617 Ga0105238_10402227
618 Ga0105249_10000296
619 Ga0105249_10179360
620 Ga0099796_10046826
621 Ga0105239_10054439
622 Ga0105239_10281401
623 Ga0157370_10051609
624 Ga0157369_10116388
625 Ga0157378_10499080
626 Ga0163162_10151505
627 Ga0163162_10430055
628 Ga0163163_10010325
629 Ga0163163_10442099
630 Ga0157380_10060531
631 Ga0182008_10077592
632 Ga0157379_10116980
633 Ga0157379_10363628
634 Ga0206354_10100611
635 Ga0213876_10004677
636 Ga0213876_10058127
637 Ga0213875_10000023
638 Ga0213875_10002319
639 Ga0213875_10006322
640 Ga0213875_10019947
641 Ga0213875_10052143
642 Ga0224712_10100810
643 Ga0209758_1035555
644 Ga0207656_10009567
645 Ga0207699_10027534
646 Ga0207699_10033181
647 Ga0207699_10070853
648 Ga0207699_10250187
649 Ga0207645_10117269
650 Ga0207707_10000134
651 Ga0207695_10016068
652 Ga0207671_10199275
653 Ga0207693_10007511
654 Ga0207693_10009000
655 Ga0207693_10053041
656 Ga0207693_10286681
657 Ga0207663_10040761
658 Ga0207663_10049811
659 Ga0207649_10247330
660 Ga0207652_10209674
661 Ga0207646_10010803
662 Ga0207694_10052789
663 Ga0207650_10000234
664 Ga0207650_10030075
665 Ga0207687_10036524
666 Ga0207687_10425069
667 Ga0207700_10009393
668 Ga0207700_10019585
669 Ga0207700_10110285
670 Ga0207700_10149282
671 Ga0207700_10382770
672 Ga0207664_10018843
673 Ga0207664_10056980
674 Ga0207664_10081070
675 Ga0207644_10134601
676 Ga0207644_10142776
677 Ga0207644_10241887
678 Ga0207690_10141656
679 Ga0207691_10097142
680 Ga0207711_10036563
681 Ga0207711_10089866
682 Ga0207689_10019070
683 Ga0207661_10071220
684 Ga0207661_10115692
685 Ga0207667_10020881
686 Ga0207667_10337043
687 Ga0207712_10000472
688 Ga0207712_10063946
689 Ga0207712_10179036
690 Ga0207712_10368659
691 Ga0207712_10468350
692 Ga0207668_10000088
693 Ga0207668_10000090
694 Ga0207668_10002738
695 Ga0207668_10075959
696 Ga0207668_10340124
697 Ga0207640_10380096
698 Ga0207658_10000084
699 Ga0207658_10018704
700 Ga0207677_10191322
701 Ga0207703_10004582
702 Ga0207703_10011079
703 Ga0207703_10054691
704 Ga0207703_10201674
705 Ga0207639_10103065
706 Ga0207639_10248399
707 Ga0207639_10274066
708 Ga0207708_10139789
709 Ga0207702_10426439
710 Ga0207641_10000535
711 Ga0207641_10025768
712 Ga0207641_10200314
713 Ga0207676_10000055
714 Ga0207676_10014337
715 Ga0207676_10130750
716 Ga0207676_10150773
717 Ga0207674_10035614
718 Ga0207674_10336864
719 Ga0207675_100082329
720 Ga0207675_100251582
721 Ga0207675_100334999
722 Ga0207683_10067556
723 Ga0207683_10371945
724 Ga0207683_10500341
725 Ga0209179_1002174
726 Ga0209813_10051094
727 Ga0207428_10022552
728 Ga0268266_10001409
729 Ga0268266_10002250
730 Ga0268266_10002577
731 Ga0268266_10005218
732 Ga0268266_10020428
733 Ga0268266_10064508
734 Ga0268265_10001633
735 Ga0268265_10004040
736 Ga0268265_10008915
737 Ga0268265_10014055
738 Ga0268265_10049366
739 Ga0268265_10181234
740 Ga0268265_10250956
741 Ga0268264_10000021
742 Ga0268264_10001582
743 Ga0268264_10003724
744 Ga0268264_10105078
745 Ga0268264_10122193
746 Ga0268264_10240197
747 Ga0265334_10014814
748 Ga0265338_10004795
749 Ga0265340_10054363
750 Ga0307513_10128052
751 Ga0307509_10016846
752 Ga0307410_10256132
753 Ga0307415_100031337
754 Ga0307510_10002894
755 Ga0373926_0017847
756 Ga0373926_0034381
757 Ga0373932_0004671
758 Ga0373932_0023907
759 Ga0373954_0081108
760 Ga0373954_0083130
761 Ga0373957_0065628
762 Ga0373943_0064794
763 Ga0373943_0138143
764 Ga0373946_0056942
765 Ga0373946_0092223
766 Ga0373942_0007849
767 Ga0373924_0045924
768 Ga0373924_0063718
769 Ga0373931_0000538
770 Ga0373935_0083624
771 Ga0373935_0329910
772 Ga0373927_0065516
773 Ga0373927_0087818
774 Ga0373927_0090668
775 Ga0373933_0003868
776 Ga0373947_0024124
777 Ga0373947_0039541
778 Ga0373947_0098656
779 Ga0373947_0149959
780 Ga0373937_0014619
781 Ga0373937_0015846
782 Ga0373937_0018989
783 Ga0373937_0077064
784 Ga0373937_0085274
785 Ga0373937_0148652
786 Ga0373925_0066644
787 Ga0373925_0185228
788 Ga0373925_0256310
789 Ga0395899_0012612
790 Ga0395900_0012819
791 Ga0395900_0024317
792 Ga0395900_0075675
793 Ga0395898_0010787
794 Ga0395898_0062506
795 Ga0436364_0010042
796 Ga0436364_0616684
797 Ga0436364_0849285
798 Ga0436364_0935599
799 Ga0436364_1260460
800 Ga0436364_1445224
801 Ga0395901_0007690
802 Ga0395901_0014831
803 Ga0395901_0070382
804 Ga0395901_0072153
805 Ga0436365_0389918
806 Ga0436365_0452150
807 Ga0436365_0595441
808 Ga0436365_1010562
809 Ga0436365_1311771
810 Ga0436365_1346508
811 Ga0436365_1463747
812 Ga0436365_1493627
813 Ga0436360_0760014
814 Ga0436361_0192543
815 Ga0436361_0518528
816 Ga0436363_1021071
817 Ga0436362_0698259
818 Ga0439465_0018769
819 Ga0439435_0014780
820 Ga0439440_0032071
821 Ga0466966_0210791
822 Ga0466963_0013530
823 Ga0466959_0007106
824 Ga0466967_0345936
825 Ga0495617_007811
826 Ga0495592_0037919
827 Ga0495603_0008302
828 Ga0495603_0012272
829 Ga0495603_0068970
830 Ga0495603_0079616
831 Ga0495591_038893
832 Ga0495629_0000708
833 Ga0495629_0259448
834 Ga0495638_0114799
835 Ga0495651_0046722
836 Ga0495580_0010335
837 Ga0495582_0012779
838 Ga0495605_0144418
839 Ga0495662_0023817
840 Ga0495664_0019068
841 Ga0495664_0051419
842 Ga0495664_0064052
843 Ga0495664_0165802
844 Ga0495585_0025943
845 Ga0495594_0004174
846 Ga0495606_0101959
847 Ga0495608_0178791
848 Ga0495608_0233466
849 Ga0495618_0038811
850 Ga0495628_0036029
851 Ga0495628_0121609
852 Ga0495628_0312311
853 Ga0495630_0002613
854 Ga0495631_0025467
855 Ga0495666_0102852
856 Ga0495652_0100726
857 Ga0495652_0112823
858 Ga0495665_0015268
859 Ga0495640_0099415
860 Ga0495640_0114530
861 Ga0495640_0237781
862 Ga0495586_0118619
863 Ga0495597_0081777
864 Ga0495645_0016193
865 Ga0495645_0022504
866 Ga0495645_0244358
867 Ga0495622_0021126
868 Ga0495667_0008808
869 Ga0495667_0034670
870 Ga0495667_0057878
871 Ga0495656_0003901
872 Ga0495668_0007060
873 Ga0495635_0004326
874 Ga0495635_0074198
875 Ga0495635_0214293
876 Ga0495588_0001004
877 Ga0495657_0057472
878 Ga0495599_0014634
879 Ga0495599_0156229
880 Ga0495623_0045102
881 Ga0495646_0019886
882 Ga0495646_0075069
883 Ga0495647_0012842
884 Ga0495647_0153685
885 Ga0495658_0121458
886 Ga0495658_0130437
887 Ga0495613_0014107
888 Ga0495624_0035282
889 Ga0495649_0105857
890 Ga0495600_0012613
891 Ga0495581_0001031
892 Ga0495604_0071448
893 Ga0495604_0175463
894 Ga0495636_0065155
895 Ga0495674_0032695
896 Ga0495674_0048565
897 Ga0495674_0475308
898 Ga0495680_0081555
899 Ga0495675_0045101
900 Ga0495675_0113527
901 Ga0495684_0013456
902 Ga0495684_0082193
903 Ga0495593_0001063
904 Ga0495602_0012528
905 Ga0495614_0063070
906 Ga0496100_0029249
907 Ga0496100_0065009
908 Ga0496101_0054337
909 Ga0496101_0245596
910 Ga0496102_0025542
911 Ga0496102_0033954
912 Ga0496102_0042330
913 Ga0496102_0138331
914 Ga0496103_0033146
915 Ga0496104_0093806
916 Ga0496104_0120171
917 Ga0496105_0012533
918 Ga0496105_0016031
919 Ga0496107_0006787
920 Ga0496107_0022744
921 Ga0496109_0055186
922 Ga0496109_0280788
923 Ga0496110_0037367
924 Ga0496110_0340325
925 Ga0496111_0014169
926 Ga0496112_0001395
927 Ga0496112_0074109
928 Ga0496112_0318226
929 Ga0496113_0020027
930 Ga0496113_0023936
931 Ga0496114_0043519
932 Ga0496114_0103175
933 Ga0496114_0278979
934 Ga0496115_0003983
935 Ga0496115_0090391
936 Ga0496119_0023141
937 Ga0496121_0105401
938 Ga0496126_0055331
939 Ga0496126_0133908
940 Ga0501034_0022831
941 Ga0501034_0250103
942 Ga0501068_0027578
943 Ga0501080_0003669
944 Ga0501044_0005641
945 Ga0501044_0086711
946 Ga0501044_0340536
947 nmdc:mga03n38_24016_c1
948 nmdc:mga03n38_70549_c1
949 nmdc:mga00v17_212332_c1
950 nmdc:mga0yw44_15276_c1
951 nmdc:mga0k408_26208_c1
952 nmdc:mga06z11_156361_c1
953 nmdc:mga06z11_2643_c1
954 nmdc:mga09592_34097_c1
955 nmdc:mga08y16_37631_c1
956 nmdc:mga08y16_408226_c1
957 nmdc:mga08y16_549448_c1
958 nmdc:mga08x19_33888_c1
959 Ga0495601_0001667
960 Ga0495601_0027797
961 Ga0495601_0050968
962 Ga0495601_0169248
963 Ga0495601_0202948
964 Ga0495612_0007457
965 Ga0495595_0017935
966 Ga0495595_0027970
967 Ga0495619_0130159
968 Ga0495619_0133856
969 Ga0495619_0242326
970 Ga0500646_0025156
971 Ga0500647_0118497
972 Ga0500650_0142328
973 Ga0500562_046593
974 Ga0500595_004444
975 Ga0500595_014867
976 Ga0500655_012249
977 Ga0500577_0045264
978 Ga0500589_102526
979 Ga0500590_023450
980 2513888111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

24

275

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.8694 4 306
1rhc-assembly1.cif.gz_A-2 f420-dependent secondary alcohol dehydrogenase in complex with an f420-acetone adduct 0.8613 1 303
3c8n-assembly2.cif.gz_C crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.8612 2 304
1brl-assembly2.cif.gz_C three-dimensional structure of bacterial luciferase from vibrio harveyi at 2.4 angstroms resolution 0.8524 4 301
3c8n-assembly2.cif.gz_D crystal structure of apo-fgd1 from mycobacterium tuberculosis 0.842 2 304
ID Description Score Start End Superfamily
1rhcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8613 1 303 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8507 4 306 3.20.20.30
af_I6X9T8_35_343_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8428 28 303 3.20.20.30
af_P95278_1_358_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8393 4 304 3.20.20.30
1bslA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.839 4 302 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A7C3NYM9-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9817 1 137 GO:0008726
GO:0046306
AF-A0A7C3NYM9-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9747 1 137 GO:0008726
GO:0046306
AF-A0A6L7MRI3-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9675 163 306 GO:0016705
AF-A0A358A3S5-F1-model_v4 TIGR03854 family LLM class F420-dependent oxidoreductase 0.9555 53 168 GO:0008726
GO:0046306
AF-A0A6L7MRI3-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9546 163 306 GO:0016705

Map