F453836

General Info

Members Datasets Scaffolds Average Seq Length
489 291 978 117

Family's Representative Sequence

Representative Sequence 3300046477|Ga0495664_0054213|Ga0495664_0054213_881_1303
Length 140
Sequence MSIRGGHVRVAGESTRDHREEHAMKQYLISIYQPDGPXXXXEVLDKVMADIEAIRAELREAGSWVFGAGLHAPSTATVLRHKDGDVLITDGPFAEGKEHLGGFTIVKAPDLDAALEWGRRYALVTSLPIEVRPFQGETED

Samples

Sample ID Description Type Environment
1 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
153 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
156 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
189 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
236 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
290 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
291 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.41
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 3.27
Rhizosphere 94.68
Stem 0
Stem Tuber 0
Unclassified 2.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495664_0054213 3300046477 Bacteria 2384
2 JGI24751J29686_10011608 3300002459 Bacteria 1816
3 JGI25407J50210_10069367 3300003373 Bacteria 880
4 Ga0065707_10326981 3300005295 Bacteria 956
5 Ga0065707_10651902 3300005295 Bacteria 663
6 Ga0070658_10023889 3300005327 Bacteria 4904
7 Ga0070683_102118837 3300005329 Unclassified 540
8 Ga0070683_102196611 3300005329 Bacteria 530
9 Ga0070670_100118303 3300005331 Bacteria 2285
10 Ga0070670_100170755 3300005331 Bacteria 1886
11 Ga0070670_101729362 3300005331 Unclassified 576
12 Ga0070677_10006378 3300005333 Bacteria 3916
13 Ga0068869_100308977 3300005334 Bacteria 1279
14 Ga0070666_10266613 3300005335 Bacteria 1215
15 Ga0070666_10358070 3300005335 Bacteria 1045
16 Ga0068868_100142414 3300005338 Bacteria 1969
17 Ga0070689_100098895 3300005340 Bacteria 2308
18 Ga0070689_100176391 3300005340 Bacteria 1734
19 Ga0070689_100373292 3300005340 Bacteria 1201
20 Ga0070687_100033663 3300005343 Bacteria 2531
21 Ga0070661_100199172 3300005344 Bacteria 1529
22 Ga0070661_100330788 3300005344 Bacteria 1192
23 Ga0070692_10364956 3300005345 Bacteria 901
24 Ga0070692_11257938 3300005345 Bacteria 529
25 Ga0070669_101013340 3300005353 Bacteria 713
26 Ga0070675_100065258 3300005354 Bacteria 3010
27 Ga0070675_100147899 3300005354 Bacteria 2012
28 Ga0070675_101344455 3300005354 Bacteria 659
29 Ga0070671_100059141 3300005355 Bacteria 3189
30 Ga0070674_100216461 3300005356 Bacteria 1488
31 Ga0070674_100739280 3300005356 Bacteria 844
32 Ga0070673_100077691 3300005364 Bacteria 2683
33 Ga0070673_100569341 3300005364 Bacteria 1031
34 Ga0070673_101092610 3300005364 Bacteria 745
35 Ga0070688_100035329 3300005365 Bacteria 3035
36 Ga0070688_100265616 3300005365 Bacteria 1227
37 Ga0070688_100486029 3300005365 Bacteria 929
38 Ga0070659_100675600 3300005366 Bacteria 892
39 Ga0070667_100401044 3300005367 Bacteria 1248
40 Ga0070709_10023758 3300005434 Bacteria 3604
41 Ga0070714_100004318 3300005435 Bacteria 10715
42 Ga0070714_100039063 3300005435 Bacteria 3994
43 Ga0070714_100260281 3300005435 Bacteria 1606
44 Ga0070714_100386978 3300005435 Bacteria 1319
45 Ga0070713_100010831 3300005436 Bacteria 6609
46 Ga0070713_100340959 3300005436 Bacteria 1388
47 Ga0070710_10002567 3300005437 Bacteria 8621
48 Ga0070710_10561291 3300005437 Bacteria 790
49 Ga0070701_10185393 3300005438 Bacteria 1221
50 Ga0070701_10748700 3300005438 Bacteria 662
51 Ga0070711_100004698 3300005439 Bacteria 8087
52 Ga0070711_100430792 3300005439 Bacteria 1076
53 Ga0070700_100291344 3300005441 Bacteria 1188
54 Ga0070708_100068993 3300005445 Bacteria 3179
55 Ga0070678_100053989 3300005456 Bacteria 2925
56 Ga0070678_100393722 3300005456 Bacteria 1202
57 Ga0070678_100441630 3300005456 Bacteria 1138
58 Ga0070662_101131816 3300005457 Bacteria 672
59 Ga0068867_100359287 3300005459 Bacteria 1218
60 Ga0068867_100378356 3300005459 Bacteria 1189
61 Ga0070685_10022134 3300005466 Bacteria 3462
62 Ga0070685_10375138 3300005466 Bacteria 979
63 Ga0070685_10516425 3300005466 Bacteria 848
64 Ga0070685_10799647 3300005466 Bacteria 695
65 Ga0070706_100021532 3300005467 Bacteria 5936
66 Ga0070706_100861310 3300005467 Bacteria 838
67 Ga0070707_100000183 3300005468 Bacteria 61638
68 Ga0070707_100023867 3300005468 Bacteria 5785
69 Ga0070698_100000350 3300005471 Bacteria 47668
70 Ga0070698_100846140 3300005471 Bacteria 860
71 Ga0070679_101977356 3300005530 Bacteria 532
72 Ga0070684_100132668 3300005535 Bacteria 2247
73 Ga0070697_100027312 3300005536 Bacteria 4566
74 Ga0068853_100841778 3300005539 Bacteria 880
75 Ga0070672_100173638 3300005543 Bacteria 1793
76 Ga0070672_100193155 3300005543 Bacteria 1700
77 Ga0070686_101923447 3300005544 Bacteria 505
78 Ga0070665_100561618 3300005548 Bacteria 1154
79 Ga0070665_102215827 3300005548 Bacteria 553
80 Ga0070704_100259880 3300005549 Bacteria 1430
81 Ga0070664_100011758 3300005564 Bacteria 7105
82 Ga0070664_100390530 3300005564 Bacteria 1271
83 Ga0070664_102101333 3300005564 Bacteria 536
84 Ga0068857_100007225 3300005577 Bacteria 9564
85 Ga0068857_100033722 3300005577 Bacteria 4528
86 Ga0070702_100410656 3300005615 Bacteria 971
87 Ga0070702_101136586 3300005615 Bacteria 626
88 Ga0068852_100343436 3300005616 Bacteria 1456
89 Ga0068852_101038998 3300005616 Bacteria 839
90 Ga0068852_101469943 3300005616 Bacteria 704
91 Ga0068859_100024268 3300005617 Bacteria 6084
92 Ga0068859_100144209 3300005617 Bacteria 2456
93 Ga0068859_100316064 3300005617 Bacteria 1656
94 Ga0068859_102375432 3300005617 Unclassified 584
95 Ga0068864_100186691 3300005618 Bacteria 1898
96 Ga0068864_100752568 3300005618 Bacteria 955
97 Ga0068864_101804189 3300005618 Bacteria 617
98 Ga0068861_100075759 3300005719 Bacteria 2620
99 Ga0068861_101474975 3300005719 Bacteria 667
100 Ga0068851_10068939 3300005834 Bacteria 1826
101 Ga0068851_10917859 3300005834 Bacteria 549
102 Ga0068870_10023430 3300005840 Bacteria 3044
103 Ga0068870_10028052 3300005840 Bacteria 2822
104 Ga0068863_100147603 3300005841 Bacteria 2250
105 Ga0068863_100422222 3300005841 Bacteria 1306
106 Ga0068863_101143032 3300005841 Bacteria 784
107 Ga0068858_100075528 3300005842 Bacteria 3130
108 Ga0068862_100058092 3300005844 Bacteria 3318
109 Ga0068862_100266205 3300005844 Bacteria 1566
110 Ga0068862_100374327 3300005844 Bacteria 1327
111 Ga0068862_100633265 3300005844 Bacteria 1030
112 Ga0081538_10001955 3300005981 Bacteria 20645
113 Ga0081538_10002215 3300005981 Bacteria 19256
114 Ga0081538_10065648 3300005981 Bacteria 2041
115 Ga0081540_1235840 3300005983 Bacteria 643
116 Ga0070717_10155084 3300006028 Bacteria 1983
117 Ga0070717_10674643 3300006028 Bacteria 938
118 Ga0070717_11439399 3300006028 Bacteria 626
119 Ga0070715_10246270 3300006163 Bacteria 932
120 Ga0070716_100003420 3300006173 Bacteria 7464
121 Ga0070716_100251812 3300006173 Bacteria 1203
122 Ga0070712_100009935 3300006175 Bacteria 5999
123 Ga0070712_100042437 3300006175 Bacteria 3128
124 Ga0070712_100043368 3300006175 Bacteria 3096
125 Ga0070712_100431827 3300006175 Bacteria 1093
126 Ga0070712_101039601 3300006175 Bacteria 710
127 Ga0075367_10336471 3300006178 Bacteria 952
128 Ga0097621_100227460 3300006237 Bacteria 1628
129 Ga0068871_100036648 3300006358 Bacteria 3906
130 Ga0075431_101088981 3300006847 Bacteria 764
131 Ga0068865_100385698 3300006881 Bacteria 1144
132 Ga0068865_100583730 3300006881 Bacteria 942
133 Ga0075436_100120140 3300006914 Bacteria 1838
134 Ga0097620_100024269 3300006931 Bacteria 6084
135 Ga0097620_100144200 3300006931 Bacteria 2456
136 Ga0097620_100316052 3300006931 Bacteria 1656
137 Ga0097620_102374540 3300006931 Unclassified 584
138 Ga0099794_10480605 3300007265 Bacteria 653
139 Ga0111539_10481962 3300009094 Bacteria 1445
140 Ga0111539_10799093 3300009094 Bacteria 1098
141 Ga0105245_10740768 3300009098 Bacteria 1018
142 Ga0105247_11070574 3300009101 Bacteria 634
143 Ga0105243_10193488 3300009148 Bacteria 1778
144 Ga0105242_10025288 3300009176 Bacteria 4697
145 Ga0105248_10583961 3300009177 Bacteria 1261
146 Ga0105248_11751551 3300009177 Bacteria 704
147 Ga0105238_10513950 3300009551 Bacteria 1200
148 Ga0105249_11324357 3300009553 Bacteria 792
149 Ga0105249_11587329 3300009553 Bacteria 727
150 Ga0105246_10188346 3300011119 Bacteria 1595
151 Ga0157369_10090577 3300013105 Bacteria 3265
152 Ga0157374_12358800 3300013296 Unclassified 559
153 Ga0157378_10109400 3300013297 Bacteria 2531
154 Ga0157378_11116047 3300013297 Bacteria 826
155 Ga0163162_10380583 3300013306 Bacteria 1545
156 Ga0163162_10557127 3300013306 Bacteria 1274
157 Ga0163162_11952239 3300013306 Bacteria 672
158 Ga0157372_10307593 3300013307 Bacteria 1844
159 Ga0157375_10158993 3300013308 Bacteria 2400
160 Ga0157375_10233880 3300013308 Unclassified 1997
161 Ga0157375_10584780 3300013308 Bacteria 1277
162 Ga0157375_10780206 3300013308 Bacteria 1105
163 Ga0157375_11090843 3300013308 Bacteria 934
164 Ga0163163_10110811 3300014325 Bacteria 2773
165 Ga0163163_10207859 3300014325 Bacteria 2006
166 Ga0157380_10379009 3300014326 Bacteria 1334
167 Ga0157380_10431977 3300014326 Bacteria 1259
168 Ga0157377_10207401 3300014745 Bacteria 1248
169 Ga0157377_10468507 3300014745 Bacteria 874
170 Ga0157379_10354232 3300014968 Bacteria 1344
171 Ga0157376_10290259 3300014969 Bacteria 1544
172 Ga0157376_11341101 3300014969 Bacteria 746
173 Ga0157376_11834878 3300014969 Bacteria 643
174 Ga0163161_10082670 3300017792 Bacteria 2366
175 Ga0163161_10148970 3300017792 Bacteria 1777
176 Ga0224712_10281940 3300022467 Bacteria 774
177 Ga0207656_10045004 3300025321 Bacteria 1887
178 Ga0207656_10310208 3300025321 Bacteria 782
179 Ga0207682_10009229 3300025893 Bacteria 3897
180 Ga0207692_10012229 3300025898 Bacteria 3680
181 Ga0207692_10143305 3300025898 Bacteria 1361
182 Ga0207692_10791101 3300025898 Bacteria 620
183 Ga0207642_10047009 3300025899 Bacteria 1927
184 Ga0207710_10010129 3300025900 Bacteria 3966
185 Ga0207710_10059156 3300025900 Bacteria 1734
186 Ga0207688_10181847 3300025901 Bacteria 1254
187 Ga0207688_10203957 3300025901 Bacteria 1186
188 Ga0207680_10344393 3300025903 Bacteria 1046
189 Ga0207647_10699951 3300025904 Bacteria 552
190 Ga0207685_10242871 3300025905 Bacteria 867
191 Ga0207699_10030027 3300025906 Bacteria 3038
192 Ga0207699_10035900 3300025906 Bacteria 2823
193 Ga0207699_10049969 3300025906 Bacteria 2464
194 Ga0207645_10455879 3300025907 Bacteria 863
195 Ga0207643_10003875 3300025908 Bacteria 8047
196 Ga0207643_10017011 3300025908 Bacteria 3970
197 Ga0207705_10153431 3300025909 Bacteria 1727
198 Ga0207684_10004304 3300025910 Bacteria 13470
199 Ga0207684_11391521 3300025910 Bacteria 574
200 Ga0207693_10004035 3300025915 Bacteria 12478
201 Ga0207693_10016027 3300025915 Bacteria 5999
202 Ga0207693_10061763 3300025915 Bacteria 2935
203 Ga0207663_11025482 3300025916 Bacteria 662
204 Ga0207662_10014840 3300025918 Bacteria 4376
205 Ga0207657_10116367 3300025919 Bacteria 2203
206 Ga0207657_10380124 3300025919 Bacteria 1112
207 Ga0207649_10154307 3300025920 Bacteria 1584
208 Ga0207646_10000071 3300025922 Bacteria 141799
209 Ga0207646_10151548 3300025922 Bacteria 2091
210 Ga0207681_10229023 3300025923 Bacteria 1441
211 Ga0207681_10734262 3300025923 Bacteria 822
212 Ga0207694_10301311 3300025924 Bacteria 1320
213 Ga0207650_10018755 3300025925 Bacteria 4859
214 Ga0207650_10190004 3300025925 Bacteria 1640
215 Ga0207659_10004516 3300025926 Bacteria 8416
216 Ga0207659_10216627 3300025926 Bacteria 1537
217 Ga0207659_10277801 3300025926 Bacteria 1368
218 Ga0207659_10381854 3300025926 Bacteria 1175
219 Ga0207687_10075605 3300025927 Bacteria 2418
220 Ga0207687_10829504 3300025927 Bacteria 789
221 Ga0207700_10010684 3300025928 Bacteria 5809
222 Ga0207700_10049582 3300025928 Bacteria 3124
223 Ga0207700_10087941 3300025928 Bacteria 2445
224 Ga0207664_10008850 3300025929 Bacteria 7043
225 Ga0207664_10046883 3300025929 Bacteria 3393
226 Ga0207664_10056936 3300025929 Bacteria 3106
227 Ga0207664_10240883 3300025929 Bacteria 1575
228 Ga0207664_11639831 3300025929 Bacteria 565
229 Ga0207644_11563442 3300025931 Bacteria 553
230 Ga0207706_10026703 3300025933 Bacteria 5169
231 Ga0207706_10551365 3300025933 Bacteria 992
232 Ga0207686_10428478 3300025934 Bacteria 1013
233 Ga0207686_10544783 3300025934 Unclassified 906
234 Ga0207670_10233494 3300025936 Bacteria 1413
235 Ga0207670_10366441 3300025936 Bacteria 1144
236 Ga0207669_10069861 3300025937 Bacteria 2199
237 Ga0207669_10126518 3300025937 Bacteria 1747
238 Ga0207669_10873795 3300025937 Bacteria 750
239 Ga0207704_10014226 3300025938 Bacteria 4012
240 Ga0207704_10386708 3300025938 Bacteria 1100
241 Ga0207704_10740582 3300025938 Bacteria 817
242 Ga0207665_10000529 3300025939 Bacteria 25748
243 Ga0207665_10093052 3300025939 Bacteria 2092
244 Ga0207691_10010206 3300025940 Bacteria 9009
245 Ga0207691_10072891 3300025940 Bacteria 3097
246 Ga0207711_10121218 3300025941 Unclassified 2335
247 Ga0207711_11905968 3300025941 Bacteria 537
248 Ga0207661_10165929 3300025944 Bacteria 1919
249 Ga0207661_10248350 3300025944 Bacteria 1581
250 Ga0207679_10075465 3300025945 Bacteria 2558
251 Ga0207679_11738158 3300025945 Bacteria 570
252 Ga0207651_10095597 3300025960 Bacteria 2188
253 Ga0207651_10107705 3300025960 Bacteria 2084
254 Ga0207712_11799117 3300025961 Bacteria 549
255 Ga0207668_10106103 3300025972 Bacteria 2098
256 Ga0207658_10729895 3300025986 Bacteria 896
257 Ga0207677_10171764 3300026023 Bacteria 1696
258 Ga0207677_10212936 3300026023 Bacteria 1544
259 Ga0207703_10706848 3300026035 Bacteria 959
260 Ga0207639_10938970 3300026041 Bacteria 809
261 Ga0207678_10208826 3300026067 Bacteria 1670
262 Ga0207678_10575702 3300026067 Bacteria 986
263 Ga0207678_10647903 3300026067 Bacteria 928
264 Ga0207708_10155591 3300026075 Bacteria 1802
265 Ga0207641_10411976 3300026088 Bacteria 1300
266 Ga0207641_10667073 3300026088 Bacteria 1022
267 Ga0207648_10011471 3300026089 Bacteria 8343
268 Ga0207648_10562602 3300026089 Bacteria 1048
269 Ga0207648_11699598 3300026089 Bacteria 593
270 Ga0207676_10170585 3300026095 Bacteria 1895
271 Ga0207676_10610643 3300026095 Bacteria 1049
272 Ga0207676_10852316 3300026095 Bacteria 891
273 Ga0207674_10010548 3300026116 Bacteria 10458
274 Ga0207674_10054630 3300026116 Bacteria 4065
275 Ga0207674_10124876 3300026116 Bacteria 2539
276 Ga0207683_10074827 3300026121 Bacteria 2997
277 Ga0207683_10360822 3300026121 Bacteria 1334
278 Ga0207698_10029625 3300026142 Bacteria 3924
279 Ga0207698_10715448 3300026142 Bacteria 997
280 Ga0207428_10794325 3300027907 Bacteria 673
281 Ga0268266_10454997 3300028379 Bacteria 1217
282 Ga0268265_10053157 3300028380 Bacteria 3068
283 Ga0268265_10219685 3300028380 Bacteria 1662
284 Ga0268265_10407927 3300028380 Bacteria 1258
285 Ga0268265_10911009 3300028380 Bacteria 864
286 Ga0268264_10177404 3300028381 Bacteria 1932
287 Ga0268264_11315915 3300028381 Bacteria 733
288 Ga0268264_11507437 3300028381 Bacteria 683
289 Ga0265326_10012830 3300028558 Bacteria 2457
290 Ga0265319_1048606 3300028563 Unclassified 1407
291 Ga0265334_10004319 3300028573 Bacteria 6324
292 Ga0265318_10018852 3300028577 Unclassified 2807
293 Ga0265336_10017823 3300028666 Bacteria 2308
294 Ga0307515_10079257 3300028794 Bacteria 4305
295 Ga0265338_10030008 3300028800 Bacteria 5373
296 Ga0265338_10095727 3300028800 Bacteria 2438
297 Ga0265324_10007995 3300029957 Bacteria 4238
298 Ga0265760_10060915 3300031090 Bacteria 1147
299 Ga0265332_10022689 3300031238 Bacteria 2769
300 Ga0265320_10009241 3300031240 Bacteria 5960
301 Ga0265325_10021402 3300031241 Bacteria 3552
302 Ga0265340_10012454 3300031247 Bacteria 4491
303 Ga0265339_10014948 3300031249 Bacteria 4667
304 Ga0265331_10046805 3300031250 Bacteria 2084
305 Ga0265316_10061549 3300031344 Unclassified 2915
306 Ga0307513_10324224 3300031456 Bacteria 1297
307 Ga0307513_10791755 3300031456 Bacteria 654
308 Ga0265314_10205506 3300031711 Unclassified 1160
309 Ga0265342_10028291 3300031712 Bacteria 3495
310 Ga0307410_10396455 3300031852 Bacteria 1114
311 Ga0307407_10306425 3300031903 Bacteria 1109
312 Ga0307407_10811721 3300031903 Bacteria 712
313 Ga0307416_100128763 3300032002 Bacteria 2273
314 Ga0307416_101164138 3300032002 Bacteria 876
315 Ga0307414_10927908 3300032004 Bacteria 799
316 Ga0307411_10553858 3300032005 Bacteria 981
317 Ga0307510_10491138 3300033180 Bacteria 670
318 Ga0373935_0270044 3300035692 Bacteria 1195
319 Ga0373935_0582665 3300035692 Bacteria 817
320 Ga0373935_1204792 3300035692 Bacteria 564
321 Ga0373947_0405905 3300035725 Bacteria 919
322 Ga0373925_0427060 3300037068 Bacteria 1083
323 Ga0373925_0441947 3300037068 Bacteria 1064
324 Ga0395899_0101055 3300037312 Bacteria 2081
325 Ga0395900_0009418 3300037418 Bacteria 10014
326 Ga0395900_0375077 3300037418 Bacteria 1392
327 Ga0395900_0407097 3300037418 Bacteria 1323
328 Ga0395898_0000273 3300037466 Bacteria 126023
329 Ga0395898_0714145 3300037466 Bacteria 944
330 Ga0395898_1182880 3300037466 Bacteria 696
331 Ga0436364_0928799 3300037853 Bacteria 84097
332 Ga0395901_0041108 3300038443 Bacteria 4791
333 Ga0436360_0578439 3300039438 Bacteria 744
334 Ga0439461_0184685 3300041410 Bacteria 554
335 Ga0451853_2445409 3300041512 Bacteria 873
336 Ga0439443_088255 3300042003 Bacteria 583
337 Ga0439449_0069751 3300042007 Bacteria 1296
338 Ga0439464_0174947 3300042439 Bacteria 678
339 Ga0466972_0481221 3300044658 Bacteria 584
340 Ga0466965_0691746 3300044683 Bacteria 584
341 Ga0466966_0353248 3300044684 Bacteria 883
342 Ga0466961_0143621 3300044693 Bacteria 1493
343 Ga0466961_0913207 3300044693 Bacteria 523
344 Ga0466963_0206578 3300044694 Bacteria 1374
345 Ga0466963_0809201 3300044694 Bacteria 661
346 Ga0466971_0124953 3300044719 Bacteria 1192
347 Ga0466971_0219306 3300044719 Bacteria 901
348 Ga0466968_0080204 3300044735 Bacteria 1433
349 Ga0466968_0167624 3300044735 Bacteria 1016
350 Ga0466957_0140143 3300044842 Bacteria 1557
351 Ga0466960_0088099 3300044901 Bacteria 1577
352 Ga0466960_0091844 3300044901 Bacteria 1549
353 Ga0466959_0080470 3300045049 Bacteria 2348
354 Ga0466959_0128562 3300045049 Bacteria 1797
355 Ga0466959_0195994 3300045049 Bacteria 1408
356 Ga0466959_0369028 3300045049 Bacteria 977
357 Ga0466959_0966654 3300045049 Bacteria 567
358 Ga0466958_0719997 3300045836 Bacteria 650
359 Ga0466967_0070309 3300045976 Bacteria 3131
360 Ga0466967_0276525 3300045976 Bacteria 1610
361 Ga0466967_1046401 3300045976 Bacteria 813
362 Ga0466967_1169684 3300045976 Bacteria 766
363 Ga0466967_1438551 3300045976 Bacteria 687
364 Ga0466967_1722101 3300045976 Bacteria 624
365 Ga0466967_2311078 3300045976 Bacteria 533
366 Ga0495629_0077400 3300046459 Bacteria 2321
367 Ga0495641_0032005 3300046461 Bacteria 2507
368 Ga0495580_0091315 3300046472 Bacteria 2119
369 Ga0495582_0030128 3300046473 Bacteria 2977
370 Ga0495639_0134151 3300046475 Bacteria 1187
371 Ga0495594_0288048 3300046499 Bacteria 936
372 Ga0495596_0087484 3300046500 Bacteria 1209
373 Ga0495618_0093327 3300046514 Bacteria 1924
374 Ga0495618_0449760 3300046514 Bacteria 782
375 Ga0495618_0649083 3300046514 Bacteria 624
376 Ga0495628_0061461 3300046516 Bacteria 2946
377 Ga0495628_0744933 3300046516 Bacteria 689
378 Ga0495630_0168818 3300046517 Bacteria 1666
379 Ga0495630_0553608 3300046517 Bacteria 882
380 Ga0495632_0111872 3300046519 Bacteria 1282
381 Ga0495666_0011523 3300046526 Bacteria 4408
382 Ga0495665_0020042 3300046531 Bacteria 3594
383 Ga0495640_0077115 3300046533 Bacteria 2222
384 Ga0495640_0286696 3300046533 Bacteria 1025
385 Ga0495621_0008829 3300046539 Bacteria 3036
386 Ga0495645_0059573 3300046543 Bacteria 2768
387 Ga0495645_0094099 3300046543 Bacteria 2138
388 Ga0495667_0454633 3300046559 Bacteria 804
389 Ga0495634_0012761 3300046642 Bacteria 6081
390 Ga0495634_0384719 3300046642 Bacteria 836
391 Ga0495635_0061571 3300046663 Bacteria 2577
392 Ga0495588_0101281 3300046674 Bacteria 1514
393 Ga0495599_0148277 3300046678 Bacteria 1454
394 Ga0495599_0881884 3300046678 Bacteria 508
395 Ga0495647_0223715 3300046681 Bacteria 831
396 Ga0495658_0043706 3300046683 Bacteria 2508
397 Ga0495669_0409718 3300046684 Bacteria 657
398 Ga0495613_0085992 3300046689 Bacteria 2280
399 Ga0495624_0128525 3300046690 Bacteria 1554
400 Ga0495581_0113935 3300047315 Bacteria 1572
401 Ga0495604_0486805 3300047317 Bacteria 802
402 Ga0495674_0134504 3300047319 Bacteria 2081
403 Ga0495672_0173587 3300047320 Unclassified 1097
404 Ga0495676_0232276 3300047321 Bacteria 1266
405 Ga0495680_0135332 3300047322 Bacteria 1807
406 Ga0495677_0040980 3300047445 Bacteria 1694
407 Ga0495684_0023467 3300047471 Bacteria 4742
408 Ga0495593_0199825 3300047673 Bacteria 1005
409 Ga0495602_0426735 3300048088 Bacteria 940
410 Ga0495614_0046636 3300048089 Bacteria 1858
411 Ga0495615_0034487 3300048090 Bacteria 1232
412 Ga0496100_0521324 3300048903 Bacteria 917
413 Ga0496101_0641012 3300048904 Bacteria 840
414 Ga0496101_0753256 3300048904 Bacteria 768
415 Ga0496102_0916888 3300048905 Bacteria 798
416 Ga0496102_1355408 3300048905 Bacteria 630
417 Ga0496104_0022098 3300048907 Bacteria 5846
418 Ga0496105_0828173 3300048908 Bacteria 702
419 Ga0496106_0561650 3300048909 Bacteria 915
420 Ga0496107_0060399 3300048910 Bacteria 2744
421 Ga0496107_0270499 3300048910 Bacteria 1265
422 Ga0496108_0025831 3300048911 Bacteria 4843
423 Ga0496109_0488032 3300048912 Bacteria 1163
424 Ga0496110_0432014 3300048913 Bacteria 1200
425 Ga0496114_0009797 3300048917 Bacteria 7612
426 Ga0496114_0881570 3300048917 Bacteria 775
427 Ga0496115_0156473 3300048918 Bacteria 1883
428 Ga0496117_0029193 3300048920 Bacteria 4255
429 Ga0501031_0130589 3300049568 Bacteria 1641
430 Ga0501031_0131923 3300049568 Bacteria 1632
431 Ga0501032_0000557 3300049569 Bacteria 30210
432 Ga0501032_0005681 3300049569 Bacteria 9241
433 Ga0501034_0009406 3300049571 Bacteria 10238
434 Ga0501036_0013173 3300049572 Bacteria 6869
435 Ga0501036_0626198 3300049572 Bacteria 891
436 Ga0501037_0046256 3300049573 Bacteria 3192
437 Ga0501037_0864148 3300049573 Bacteria 594
438 Ga0501038_0004032 3300049574 Bacteria 13655
439 Ga0501038_0019543 3300049574 Bacteria 6105
440 Ga0501039_0000967 3300049575 Bacteria 20928
441 Ga0501039_0100565 3300049575 Bacteria 2256
442 Ga0501040_1244591 3300049576 Bacteria 540
443 Ga0501043_0098242 3300049579 Bacteria 2301
444 Ga0501043_0107563 3300049579 Bacteria 2190
445 Ga0501046_0000201 3300049580 Bacteria 61759
446 Ga0501046_0172760 3300049580 Bacteria 1620
447 Ga0501047_0001125 3300049581 Bacteria 26581
448 Ga0501047_0253348 3300049581 Bacteria 1608
449 Ga0501048_0011716 3300049582 Bacteria 6540
450 Ga0501067_0039252 3300049583 Bacteria 2629
451 Ga0501068_0002490 3300049584 Bacteria 9780
452 Ga0501068_0208506 3300049584 Bacteria 1240
453 Ga0501069_0048866 3300049585 Bacteria 2350
454 Ga0501069_0075870 3300049585 Bacteria 1889
455 Ga0501069_0610429 3300049585 Bacteria 655
456 Ga0501070_0232748 3300049586 Bacteria 1509
457 Ga0501073_0019667 3300049589 Bacteria 4872
458 Ga0501073_0022952 3300049589 Bacteria 4487
459 Ga0501074_0291728 3300049590 Bacteria 1159
460 Ga0501077_0645187 3300049593 Bacteria 680
461 Ga0501259_145659 3300049688 Bacteria 583
462 Ga0501079_0233794 3300049741 Bacteria 1436
463 Ga0501080_0005869 3300049742 Bacteria 10996
464 Ga0501080_0588488 3300049742 Bacteria 988
465 Ga0501080_0783730 3300049742 Bacteria 837
466 Ga0501083_0081591 3300049744 Bacteria 2144
467 Ga0501035_0084651 3300049822 Bacteria 2796
468 Ga0501044_0006463 3300049823 Bacteria 12945
469 Ga0501044_0485941 3300049823 Bacteria 1137
470 Ga0501212_093596 3300049851 Bacteria 557
471 nmdc:mga0n895_1057983_c1 3300050512 Bacteria 790
472 nmdc:mga08x19_146287_c1 3300050514 Bacteria 1598
473 Ga0495601_0008177 3300053077 Bacteria 6169
474 Ga0495601_0133854 3300053077 Bacteria 1615
475 Ga0495601_0147793 3300053077 Bacteria 1534
476 Ga0495612_0046997 3300053078 Bacteria 1768
477 Ga0495612_0104818 3300053078 Bacteria 1206
478 Ga0495595_0010500 3300053084 Bacteria 3850
479 Ga0495619_0002594 3300053085 Bacteria 11808
480 Ga0495619_0063178 3300053085 Bacteria 2466
481 Ga0501084_0563998 3300054114 Bacteria 962
482 Ga0501082_0002094 3300060353 Bacteria 17578
483 Ga0501082_0426941 3300060353 Bacteria 1157
484 Ga0466962_0025299 3300061719 Bacteria 2850
485 Ga0466962_0128280 3300061719 Bacteria 1225
486 Ga0530510_0418949 3300061734 Bacteria 1011
487 2795784437 2795385470 Bacteria 8317180
488 2995467809 2995463766 Bacteria 8577691
489 2995469590 2995463766 Bacteria 8577691
490 Ga0495664_0054213
491 JGI24751J29686_10011608
492 JGI25407J50210_10069367
493 Ga0065707_10326981
494 Ga0065707_10651902
495 Ga0070658_10023889
496 Ga0070683_102118837
497 Ga0070683_102196611
498 Ga0070670_100118303
499 Ga0070670_100170755
500 Ga0070670_101729362
501 Ga0070677_10006378
502 Ga0068869_100308977
503 Ga0070666_10266613
504 Ga0070666_10358070
505 Ga0068868_100142414
506 Ga0070689_100098895
507 Ga0070689_100176391
508 Ga0070689_100373292
509 Ga0070687_100033663
510 Ga0070661_100199172
511 Ga0070661_100330788
512 Ga0070692_10364956
513 Ga0070692_11257938
514 Ga0070669_101013340
515 Ga0070675_100065258
516 Ga0070675_100147899
517 Ga0070675_101344455
518 Ga0070671_100059141
519 Ga0070674_100216461
520 Ga0070674_100739280
521 Ga0070673_100077691
522 Ga0070673_100569341
523 Ga0070673_101092610
524 Ga0070688_100035329
525 Ga0070688_100265616
526 Ga0070688_100486029
527 Ga0070659_100675600
528 Ga0070667_100401044
529 Ga0070709_10023758
530 Ga0070714_100004318
531 Ga0070714_100039063
532 Ga0070714_100260281
533 Ga0070714_100386978
534 Ga0070713_100010831
535 Ga0070713_100340959
536 Ga0070710_10002567
537 Ga0070710_10561291
538 Ga0070701_10185393
539 Ga0070701_10748700
540 Ga0070711_100004698
541 Ga0070711_100430792
542 Ga0070700_100291344
543 Ga0070708_100068993
544 Ga0070678_100053989
545 Ga0070678_100393722
546 Ga0070678_100441630
547 Ga0070662_101131816
548 Ga0068867_100359287
549 Ga0068867_100378356
550 Ga0070685_10022134
551 Ga0070685_10375138
552 Ga0070685_10516425
553 Ga0070685_10799647
554 Ga0070706_100021532
555 Ga0070706_100861310
556 Ga0070707_100000183
557 Ga0070707_100023867
558 Ga0070698_100000350
559 Ga0070698_100846140
560 Ga0070679_101977356
561 Ga0070684_100132668
562 Ga0070697_100027312
563 Ga0068853_100841778
564 Ga0070672_100173638
565 Ga0070672_100193155
566 Ga0070686_101923447
567 Ga0070665_100561618
568 Ga0070665_102215827
569 Ga0070704_100259880
570 Ga0070664_100011758
571 Ga0070664_100390530
572 Ga0070664_102101333
573 Ga0068857_100007225
574 Ga0068857_100033722
575 Ga0070702_100410656
576 Ga0070702_101136586
577 Ga0068852_100343436
578 Ga0068852_101038998
579 Ga0068852_101469943
580 Ga0068859_100024268
581 Ga0068859_100144209
582 Ga0068859_100316064
583 Ga0068859_102375432
584 Ga0068864_100186691
585 Ga0068864_100752568
586 Ga0068864_101804189
587 Ga0068861_100075759
588 Ga0068861_101474975
589 Ga0068851_10068939
590 Ga0068851_10917859
591 Ga0068870_10023430
592 Ga0068870_10028052
593 Ga0068863_100147603
594 Ga0068863_100422222
595 Ga0068863_101143032
596 Ga0068858_100075528
597 Ga0068862_100058092
598 Ga0068862_100266205
599 Ga0068862_100374327
600 Ga0068862_100633265
601 Ga0081538_10001955
602 Ga0081538_10002215
603 Ga0081538_10065648
604 Ga0081540_1235840
605 Ga0070717_10155084
606 Ga0070717_10674643
607 Ga0070717_11439399
608 Ga0070715_10246270
609 Ga0070716_100003420
610 Ga0070716_100251812
611 Ga0070712_100009935
612 Ga0070712_100042437
613 Ga0070712_100043368
614 Ga0070712_100431827
615 Ga0070712_101039601
616 Ga0075367_10336471
617 Ga0097621_100227460
618 Ga0068871_100036648
619 Ga0075431_101088981
620 Ga0068865_100385698
621 Ga0068865_100583730
622 Ga0075436_100120140
623 Ga0097620_100024269
624 Ga0097620_100144200
625 Ga0097620_100316052
626 Ga0097620_102374540
627 Ga0099794_10480605
628 Ga0111539_10481962
629 Ga0111539_10799093
630 Ga0105245_10740768
631 Ga0105247_11070574
632 Ga0105243_10193488
633 Ga0105242_10025288
634 Ga0105248_10583961
635 Ga0105248_11751551
636 Ga0105238_10513950
637 Ga0105249_11324357
638 Ga0105249_11587329
639 Ga0105246_10188346
640 Ga0157369_10090577
641 Ga0157374_12358800
642 Ga0157378_10109400
643 Ga0157378_11116047
644 Ga0163162_10380583
645 Ga0163162_10557127
646 Ga0163162_11952239
647 Ga0157372_10307593
648 Ga0157375_10158993
649 Ga0157375_10233880
650 Ga0157375_10584780
651 Ga0157375_10780206
652 Ga0157375_11090843
653 Ga0163163_10110811
654 Ga0163163_10207859
655 Ga0157380_10379009
656 Ga0157380_10431977
657 Ga0157377_10207401
658 Ga0157377_10468507
659 Ga0157379_10354232
660 Ga0157376_10290259
661 Ga0157376_11341101
662 Ga0157376_11834878
663 Ga0163161_10082670
664 Ga0163161_10148970
665 Ga0224712_10281940
666 Ga0207656_10045004
667 Ga0207656_10310208
668 Ga0207682_10009229
669 Ga0207692_10012229
670 Ga0207692_10143305
671 Ga0207692_10791101
672 Ga0207642_10047009
673 Ga0207710_10010129
674 Ga0207710_10059156
675 Ga0207688_10181847
676 Ga0207688_10203957
677 Ga0207680_10344393
678 Ga0207647_10699951
679 Ga0207685_10242871
680 Ga0207699_10030027
681 Ga0207699_10035900
682 Ga0207699_10049969
683 Ga0207645_10455879
684 Ga0207643_10003875
685 Ga0207643_10017011
686 Ga0207705_10153431
687 Ga0207684_10004304
688 Ga0207684_11391521
689 Ga0207693_10004035
690 Ga0207693_10016027
691 Ga0207693_10061763
692 Ga0207663_11025482
693 Ga0207662_10014840
694 Ga0207657_10116367
695 Ga0207657_10380124
696 Ga0207649_10154307
697 Ga0207646_10000071
698 Ga0207646_10151548
699 Ga0207681_10229023
700 Ga0207681_10734262
701 Ga0207694_10301311
702 Ga0207650_10018755
703 Ga0207650_10190004
704 Ga0207659_10004516
705 Ga0207659_10216627
706 Ga0207659_10277801
707 Ga0207659_10381854
708 Ga0207687_10075605
709 Ga0207687_10829504
710 Ga0207700_10010684
711 Ga0207700_10049582
712 Ga0207700_10087941
713 Ga0207664_10008850
714 Ga0207664_10046883
715 Ga0207664_10056936
716 Ga0207664_10240883
717 Ga0207664_11639831
718 Ga0207644_11563442
719 Ga0207706_10026703
720 Ga0207706_10551365
721 Ga0207686_10428478
722 Ga0207686_10544783
723 Ga0207670_10233494
724 Ga0207670_10366441
725 Ga0207669_10069861
726 Ga0207669_10126518
727 Ga0207669_10873795
728 Ga0207704_10014226
729 Ga0207704_10386708
730 Ga0207704_10740582
731 Ga0207665_10000529
732 Ga0207665_10093052
733 Ga0207691_10010206
734 Ga0207691_10072891
735 Ga0207711_10121218
736 Ga0207711_11905968
737 Ga0207661_10165929
738 Ga0207661_10248350
739 Ga0207679_10075465
740 Ga0207679_11738158
741 Ga0207651_10095597
742 Ga0207651_10107705
743 Ga0207712_11799117
744 Ga0207668_10106103
745 Ga0207658_10729895
746 Ga0207677_10171764
747 Ga0207677_10212936
748 Ga0207703_10706848
749 Ga0207639_10938970
750 Ga0207678_10208826
751 Ga0207678_10575702
752 Ga0207678_10647903
753 Ga0207708_10155591
754 Ga0207641_10411976
755 Ga0207641_10667073
756 Ga0207648_10011471
757 Ga0207648_10562602
758 Ga0207648_11699598
759 Ga0207676_10170585
760 Ga0207676_10610643
761 Ga0207676_10852316
762 Ga0207674_10010548
763 Ga0207674_10054630
764 Ga0207674_10124876
765 Ga0207683_10074827
766 Ga0207683_10360822
767 Ga0207698_10029625
768 Ga0207698_10715448
769 Ga0207428_10794325
770 Ga0268266_10454997
771 Ga0268265_10053157
772 Ga0268265_10219685
773 Ga0268265_10407927
774 Ga0268265_10911009
775 Ga0268264_10177404
776 Ga0268264_11315915
777 Ga0268264_11507437
778 Ga0265326_10012830
779 Ga0265319_1048606
780 Ga0265334_10004319
781 Ga0265318_10018852
782 Ga0265336_10017823
783 Ga0307515_10079257
784 Ga0265338_10030008
785 Ga0265338_10095727
786 Ga0265324_10007995
787 Ga0265760_10060915
788 Ga0265332_10022689
789 Ga0265320_10009241
790 Ga0265325_10021402
791 Ga0265340_10012454
792 Ga0265339_10014948
793 Ga0265331_10046805
794 Ga0265316_10061549
795 Ga0307513_10324224
796 Ga0307513_10791755
797 Ga0265314_10205506
798 Ga0265342_10028291
799 Ga0307410_10396455
800 Ga0307407_10306425
801 Ga0307407_10811721
802 Ga0307416_100128763
803 Ga0307416_101164138
804 Ga0307414_10927908
805 Ga0307411_10553858
806 Ga0307510_10491138
807 Ga0373935_0270044
808 Ga0373935_0582665
809 Ga0373935_1204792
810 Ga0373947_0405905
811 Ga0373925_0427060
812 Ga0373925_0441947
813 Ga0395899_0101055
814 Ga0395900_0009418
815 Ga0395900_0375077
816 Ga0395900_0407097
817 Ga0395898_0000273
818 Ga0395898_0714145
819 Ga0395898_1182880
820 Ga0436364_0928799
821 Ga0395901_0041108
822 Ga0436360_0578439
823 Ga0439461_0184685
824 Ga0451853_2445409
825 Ga0439443_088255
826 Ga0439449_0069751
827 Ga0439464_0174947
828 Ga0466972_0481221
829 Ga0466965_0691746
830 Ga0466966_0353248
831 Ga0466961_0143621
832 Ga0466961_0913207
833 Ga0466963_0206578
834 Ga0466963_0809201
835 Ga0466971_0124953
836 Ga0466971_0219306
837 Ga0466968_0080204
838 Ga0466968_0167624
839 Ga0466957_0140143
840 Ga0466960_0088099
841 Ga0466960_0091844
842 Ga0466959_0080470
843 Ga0466959_0128562
844 Ga0466959_0195994
845 Ga0466959_0369028
846 Ga0466959_0966654
847 Ga0466958_0719997
848 Ga0466967_0070309
849 Ga0466967_0276525
850 Ga0466967_1046401
851 Ga0466967_1169684
852 Ga0466967_1438551
853 Ga0466967_1722101
854 Ga0466967_2311078
855 Ga0495629_0077400
856 Ga0495641_0032005
857 Ga0495580_0091315
858 Ga0495582_0030128
859 Ga0495639_0134151
860 Ga0495594_0288048
861 Ga0495596_0087484
862 Ga0495618_0093327
863 Ga0495618_0449760
864 Ga0495618_0649083
865 Ga0495628_0061461
866 Ga0495628_0744933
867 Ga0495630_0168818
868 Ga0495630_0553608
869 Ga0495632_0111872
870 Ga0495666_0011523
871 Ga0495665_0020042
872 Ga0495640_0077115
873 Ga0495640_0286696
874 Ga0495621_0008829
875 Ga0495645_0059573
876 Ga0495645_0094099
877 Ga0495667_0454633
878 Ga0495634_0012761
879 Ga0495634_0384719
880 Ga0495635_0061571
881 Ga0495588_0101281
882 Ga0495599_0148277
883 Ga0495599_0881884
884 Ga0495647_0223715
885 Ga0495658_0043706
886 Ga0495669_0409718
887 Ga0495613_0085992
888 Ga0495624_0128525
889 Ga0495581_0113935
890 Ga0495604_0486805
891 Ga0495674_0134504
892 Ga0495672_0173587
893 Ga0495676_0232276
894 Ga0495680_0135332
895 Ga0495677_0040980
896 Ga0495684_0023467
897 Ga0495593_0199825
898 Ga0495602_0426735
899 Ga0495614_0046636
900 Ga0495615_0034487
901 Ga0496100_0521324
902 Ga0496101_0641012
903 Ga0496101_0753256
904 Ga0496102_0916888
905 Ga0496102_1355408
906 Ga0496104_0022098
907 Ga0496105_0828173
908 Ga0496106_0561650
909 Ga0496107_0060399
910 Ga0496107_0270499
911 Ga0496108_0025831
912 Ga0496109_0488032
913 Ga0496110_0432014
914 Ga0496114_0009797
915 Ga0496114_0881570
916 Ga0496115_0156473
917 Ga0496117_0029193
918 Ga0501031_0130589
919 Ga0501031_0131923
920 Ga0501032_0000557
921 Ga0501032_0005681
922 Ga0501034_0009406
923 Ga0501036_0013173
924 Ga0501036_0626198
925 Ga0501037_0046256
926 Ga0501037_0864148
927 Ga0501038_0004032
928 Ga0501038_0019543
929 Ga0501039_0000967
930 Ga0501039_0100565
931 Ga0501040_1244591
932 Ga0501043_0098242
933 Ga0501043_0107563
934 Ga0501046_0000201
935 Ga0501046_0172760
936 Ga0501047_0001125
937 Ga0501047_0253348
938 Ga0501048_0011716
939 Ga0501067_0039252
940 Ga0501068_0002490
941 Ga0501068_0208506
942 Ga0501069_0048866
943 Ga0501069_0075870
944 Ga0501069_0610429
945 Ga0501070_0232748
946 Ga0501073_0019667
947 Ga0501073_0022952
948 Ga0501074_0291728
949 Ga0501077_0645187
950 Ga0501259_145659
951 Ga0501079_0233794
952 Ga0501080_0005869
953 Ga0501080_0588488
954 Ga0501080_0783730
955 Ga0501083_0081591
956 Ga0501035_0084651
957 Ga0501044_0006463
958 Ga0501044_0485941
959 Ga0501212_093596
960 nmdc:mga0n895_1057983_c1
961 nmdc:mga08x19_146287_c1
962 Ga0495601_0008177
963 Ga0495601_0133854
964 Ga0495601_0147793
965 Ga0495612_0046997
966 Ga0495612_0104818
967 Ga0495595_0010500
968 Ga0495619_0002594
969 Ga0495619_0063178
970 Ga0501084_0563998
971 Ga0501082_0002094
972 Ga0501082_0426941
973 Ga0466962_0025299
974 Ga0466962_0128280
975 Ga0530510_0418949
976 2795784437
977 2995467809
978 2995469590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

24

135

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9152 2 113
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8705 2 113
4f3n-assembly1.cif.gz_A high resolution native crystal structure of an uncharacterized acr, cog1565 superfamily protein from burkholderia thailandensis, solved by iodide ion sad 0.7958 12 52
8d0b-assembly1.cif.gz_E human cst-dna polymerase alpha/primase preinitiation complex bound to 4xtel-foldback template 0.7661 10 39
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.6743 3 117
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9152 2 113 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8705 2 113 3.30.70.1060
4f3nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7958 12 52 3.40.50.12710
af_O74761_2_257_1.20.930.80 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A; 0.7414 10 39 1.20.930.80
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7352 3 114 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A399VG70-F1-model_v4 deleted 0.9787 1 113
AF-A0A4R6VMW9-F1-model_v4 YCII-related domain-containing protein 0.9708 1 113
AF-A0A399VG70-F1-model_v4 deleted 0.9703 1 113
AF-A0A0K8QD08-F1-model_v4 Uncharacterized protein R00369 0.97 25 114
AF-A0A543I5X8-F1-model_v4 YCII-related domain-containing protein 0.9634 1 113

Map