F453819

General Info

Members Datasets Scaffolds Average Seq Length
489 438 236 424

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0643514|Ga0436360_0643514_176_1627
Length 472
Sequence VASAQWSLVSGLAQLLTKRDLGYALTGPVALVQSRRMLASRPAAPGLVENERMSIALNGAFAMSELALISARRARLLVLERKGVPGAALASTLAADPQRFLPTVQVGITLIGILTGVFGGARIGSELAGWLKQVPLMGPVAETLSIGLVVVVITYLSMVIGELVPKQLALRRPELIAVRVARPLAALARVTGPVVWLLSHSSALVMRLFGRQTKQPTVTEEELRALVAEGEQAGVFETEERDMIERVLRLADKPVRAIMTPRNDLVWIDRTDSPKEIVATLKSAPHSRFVVCDGAVDNVVGVVQAKDILDRILSGGELSVAAALRQPLILPDTVTALDALERLKPDLLGLALVMDEYGSFEGVVTAADVLEAIVGDLTEPAPPEGGVGAAKEGALVMDGMMPVDELKARLGLPDLPFEGGYHTLGGLLLALLRRVPRIGDRIVFAGWRFEVLEMDGRRVDRVRATKEPLAEA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
5 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
6 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
7 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
8 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
9 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
10 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
11 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
12 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
13 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
14 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
15 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
16 2516143018 Ensifer sp. BR816 Isolate Nodule
17 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
18 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
19 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
20 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
21 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
22 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
23 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
24 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
25 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
26 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
27 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
28 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
29 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
30 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
31 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
32 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
33 2643221557 Ensifer sp. Root558 Isolate Unclassified
34 2643221610 Ensifer sp. Root74 Isolate Unclassified
35 2643221618 Ensifer sp. Root231 Isolate Unclassified
36 2643221626 Ensifer sp. Root31 Isolate Unclassified
37 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
38 2643221655 Ensifer sp. Root1252 Isolate Unclassified
39 2643221659 Ensifer sp. Root127 Isolate Unclassified
40 2643221668 Ensifer sp. Root423 Isolate Unclassified
41 2643221675 Ensifer sp. Root1298 Isolate Unclassified
42 2643221680 Ensifer sp. Root1312 Isolate Unclassified
43 2643221698 Ensifer sp. Root142 Isolate Unclassified
44 2643221712 Ensifer sp. Root258 Isolate Unclassified
45 2643221718 Rhizobium sp. Root268 Isolate Unclassified
46 2643221723 Ensifer sp. Root278 Isolate Unclassified
47 2643221726 Ensifer sp. Root954 Isolate Unclassified
48 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
49 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
50 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
51 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
52 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
53 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
54 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
55 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
56 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
57 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
58 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
59 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
60 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
61 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
62 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
63 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
64 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
65 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
66 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
67 2844163670 Ensifer sp. 1H6 Isolate Unclassified
68 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
69 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
70 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
71 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
72 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
73 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
74 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
75 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
76 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
77 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
78 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
79 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
80 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
81 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
82 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
83 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
84 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
85 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
86 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
87 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
88 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
89 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
90 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
91 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
92 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
93 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
94 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
95 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
96 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
97 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
98 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
99 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
100 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
101 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
102 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
103 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
104 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
105 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
106 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
107 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
108 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
109 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
110 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
111 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
112 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
113 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
114 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
115 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
116 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
117 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
118 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
119 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
120 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
121 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
122 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
123 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
124 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
125 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
126 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
127 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
128 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
129 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
130 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
131 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
132 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
133 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
134 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
135 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
136 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
137 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
138 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
139 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
140 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
141 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
142 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
143 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
144 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
145 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
146 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
147 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
148 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
149 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
150 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
151 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
152 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
153 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
154 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
155 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
156 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
157 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
158 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
159 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
160 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
161 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
162 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
163 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
164 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
165 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
166 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
167 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
168 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
169 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
170 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
171 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
172 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
173 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
174 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
175 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
176 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
177 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
178 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
179 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
180 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
181 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
182 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
183 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
184 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
185 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
186 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
187 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
188 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
189 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
190 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
191 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
192 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
193 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
194 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
195 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
196 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
197 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
198 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
199 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
200 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
201 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
202 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
203 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
204 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
205 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
206 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
207 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
208 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
209 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
210 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
211 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
212 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
213 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
214 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
215 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
216 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
217 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
218 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
219 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
220 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
221 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
222 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
223 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
224 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
225 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
226 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
227 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
228 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
229 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
230 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
231 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
232 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
233 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
234 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
235 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
236 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
237 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
238 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
239 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
240 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
241 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
242 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
243 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
244 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
245 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
246 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
247 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
248 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
249 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
250 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
251 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
252 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
253 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
254 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
255 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
256 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
257 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
258 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
259 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
260 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
261 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
262 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
263 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
264 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
265 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
266 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
267 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
268 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
269 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
270 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
271 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
272 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
273 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
274 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
275 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
276 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
277 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
278 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
279 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
280 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
281 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
282 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
283 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
284 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
285 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
286 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
287 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
288 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
289 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
290 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
291 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
292 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
293 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
294 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
295 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
296 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
297 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
298 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
299 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
300 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
301 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
302 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
303 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
304 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
305 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
306 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
307 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
308 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
309 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
310 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
311 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
312 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
313 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
314 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
315 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
317 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
319 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
320 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
322 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
323 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
324 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
325 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
326 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
327 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
355 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
356 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
360 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
361 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
362 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
363 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
364 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
365 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
366 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
367 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
368 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
369 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
370 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
371 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
372 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
373 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
374 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
375 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
376 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
377 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
378 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
379 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
380 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
381 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
382 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
383 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
384 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
385 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
386 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
387 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
388 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
389 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
390 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
391 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
392 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
393 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
394 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
395 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
396 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
397 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
398 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
399 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
400 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
401 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
402 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
403 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
404 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
405 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
413 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
414 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
415 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
416 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
417 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
418 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
419 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
422 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
423 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
424 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
425 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
426 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
427 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
428 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
429 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
430 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
431 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
432 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
433 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
434 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
435 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
436 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
437 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
438 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 48.26
Metatranscriptomes 0
Isolates 51.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.54
Nodule 45.81
Rhizoplane 0.61
Rhizosphere 35.79
Stem 0
Stem Tuber 0
Unclassified 11.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1001178 3300001976 Bacteria 3547
2 JGI25159J45721_1000121 3300002987 Bacteria 37205
3 JGI25406J46586_10000221 3300003203 Bacteria 25171
4 JGI25153J46596_10007643 3300003215 Bacteria 5275
5 JGI25160J50197_1000019 3300003354 Bacteria 233980
6 JGI25161J50226_1000480 3300003374 Bacteria 18086
7 Ga0055526_1004467 3300003771 Bacteria 8391
8 Ga0055524_1000533 3300003775 Bacteria 28994
9 Ga0055536_1018674 3300003781 Bacteria 2213
10 Ga0055531_10001596 3300003794 Bacteria 16473
11 Ga0055543_1000428 3300004625 Bacteria 26055
12 Ga0065165_1000149 3300005262 Bacteria 122370
13 Ga0065165_1006457 3300005262 Bacteria 6137
14 Ga0065704_10070772 3300005289 Bacteria 16376
15 Ga0065704_10089049 3300005289 Bacteria 2889
16 Ga0065707_10098540 3300005295 Bacteria 3077
17 Ga0070658_10024280 3300005327 Bacteria 4864
18 Ga0070658_10055846 3300005327 Bacteria 3208
19 Ga0070683_100063393 3300005329 Bacteria 3438
20 Ga0070670_100007105 3300005331 Bacteria 9480
21 Ga0070670_100025908 3300005331 Bacteria 5045
22 Ga0070666_10000182 3300005335 Bacteria 43137
23 Ga0070682_100052520 3300005337 Bacteria 2551
24 Ga0070660_100082857 3300005339 Bacteria 2519
25 Ga0070661_100002236 3300005344 Bacteria 13278
26 Ga0070668_100050622 3300005347 Bacteria 3199
27 Ga0070669_100000001 3300005353 Bacteria 537589
28 Ga0070671_100000002 3300005355 Bacteria 292733
29 Ga0070671_100005733 3300005355 Bacteria 9888
30 Ga0070667_100101843 3300005367 Bacteria 2481
31 Ga0070713_100169921 3300005436 Bacteria 1953
32 Ga0070681_10062843 3300005458 Bacteria 3686
33 Ga0070679_100004001 3300005530 Bacteria 13577
34 Ga0070679_100178928 3300005530 Bacteria 2093
35 Ga0068853_100002747 3300005539 Bacteria 13282
36 Ga0070665_100000101 3300005548 Bacteria 159353
37 Ga0068855_100132141 3300005563 Bacteria 2850
38 Ga0068854_100049869 3300005578 Bacteria 2993
39 Ga0068852_100007260 3300005616 Bacteria 8079
40 Ga0068859_100000571 3300005617 Bacteria 36743
41 Ga0068859_100266709 3300005617 Bacteria 1804
42 Ga0068864_100004727 3300005618 Bacteria 11154
43 Ga0068861_100037506 3300005719 Bacteria 3603
44 Ga0068851_10000619 3300005834 Bacteria 15212
45 Ga0068863_100009586 3300005841 Bacteria 9446
46 Ga0068863_100012805 3300005841 Bacteria 8089
47 Ga0068858_100003312 3300005842 Bacteria 16038
48 Ga0068860_100039444 3300005843 Bacteria 4517
49 Ga0068860_100123139 3300005843 Bacteria 2484
50 Ga0068862_100001481 3300005844 Bacteria 21520
51 Ga0068862_100031769 3300005844 Bacteria 4459
52 Ga0068862_100202872 3300005844 Bacteria 1789
53 Ga0081455_10120640 3300005937 Bacteria 2066
54 Ga0081539_10000076 3300005985 Bacteria 229037
55 Ga0070712_100189578 3300006175 Bacteria 1608
56 Ga0075430_100130797 3300006846 Bacteria 2092
57 Ga0075431_100008812 3300006847 Bacteria 10108
58 Ga0097620_100000571 3300006931 Bacteria 36743
59 Ga0097620_100266732 3300006931 Bacteria 1804
60 Ga0079104_1004616 3300006946 Bacteria 5805
61 Ga0079104_1011355 3300006946 Bacteria 2868
62 Ga0105247_10007587 3300009101 Bacteria 6646
63 Ga0114129_10002004 3300009147 Bacteria 27885
64 Ga0105243_10088475 3300009148 Bacteria 2545
65 Ga0105241_10183468 3300009174 Bacteria 1737
66 Ga0105238_10033297 3300009551 Bacteria 5245
67 Ga0105249_10332314 3300009553 Bacteria 1534
68 Ga0105239_10023078 3300010375 Bacteria 6860
69 Ga0105239_10249092 3300010375 Bacteria 1995
70 Ga0157373_10013975 3300013100 Bacteria 5887
71 Ga0171463_1008 3300013249 Bacteria 299022
72 Ga0163162_10014858 3300013306 Bacteria 7603
73 Ga0163163_10020623 3300014325 Bacteria 6211
74 Ga0183363_1232 3300015690 Bacteria 10251
75 Ga0163161_10134323 3300017792 Bacteria 1869
76 Ga0214544_1001054 3300021320 Bacteria 55518
77 Ga0214542_1000019 3300021321 Bacteria 199445
78 Ga0214542_1023426 3300021321 Bacteria 3703
79 Ga0214543_1000010 3300021327 Bacteria 364844
80 Ga0214543_1000173 3300021327 Bacteria 93894
81 Ga0213876_10003903 3300021384 Bacteria 8428
82 Ga0213875_10002735 3300021388 Bacteria 10408
83 Ga0213871_10002923 3300021441 Bacteria 3220
84 Ga0228711_1000007 3300022739 Bacteria 202413
85 Ga0228710_1000007 3300022740 Bacteria 189104
86 Ga0209436_100582 3300025208 Bacteria 15655
87 Ga0209677_102015 3300025253 Bacteria 8073
88 Ga0209233_1000949 3300025261 Bacteria 12587
89 Ga0209455_1009820 3300025272 Bacteria 2481
90 Ga0209130_1000007 3300025284 Bacteria 591584
91 Ga0209675_1000467 3300025291 Bacteria 31046
92 Ga0209676_1013458 3300025292 Bacteria 3143
93 Ga0209025_1000033 3300025294 Bacteria 414511
94 Ga0209564_1000152 3300025295 Bacteria 167572
95 Ga0209564_1008342 3300025295 Bacteria 5127
96 Ga0209758_1000030 3300025297 Bacteria 509217
97 Ga0209758_1000429 3300025297 Bacteria 71157
98 Ga0209050_1019769 3300025298 Bacteria 2540
99 Ga0209256_1000218 3300025299 Bacteria 106228
100 Ga0209256_1002999 3300025299 Bacteria 12539
101 Ga0209256_1006075 3300025299 Bacteria 6576
102 Ga0207426_1000111 3300025302 Bacteria 234032
103 Ga0209257_1003962 3300025304 Bacteria 12003
104 Ga0209257_1009473 3300025304 Bacteria 5199
105 Ga0207697_10000757 3300025315 Bacteria 18294
106 Ga0207656_10000640 3300025321 Bacteria 11434
107 Ga0207710_10001291 3300025900 Bacteria 12662
108 Ga0207680_10000033 3300025903 Bacteria 77177
109 Ga0207705_10003051 3300025909 Bacteria 12772
110 Ga0207705_10003496 3300025909 Bacteria 11958
111 Ga0207705_10010082 3300025909 Bacteria 6878
112 Ga0207654_10023057 3300025911 Bacteria 3329
113 Ga0207657_10095129 3300025919 Bacteria 2479
114 Ga0207649_10001587 3300025920 Bacteria 13215
115 Ga0207652_10016213 3300025921 Bacteria 6079
116 Ga0207652_10085394 3300025921 Bacteria 2766
117 Ga0207681_10000002 3300025923 Bacteria 985597
118 Ga0207694_10028667 3300025924 Bacteria 4245
119 Ga0207694_10177083 3300025924 Bacteria 1728
120 Ga0207650_10050605 3300025925 Bacteria 3073
121 Ga0207644_10000002 3300025931 Bacteria 942221
122 Ga0207644_10000780 3300025931 Bacteria 20214
123 Ga0207709_10102920 3300025935 Bacteria 1892
124 Ga0207667_10104123 3300025949 Bacteria 2927
125 Ga0207712_10041965 3300025961 Bacteria 3148
126 Ga0207668_10000641 3300025972 Bacteria 21579
127 Ga0207668_10020560 3300025972 Bacteria 4197
128 Ga0207640_10006439 3300025981 Bacteria 6444
129 Ga0207658_10008452 3300025986 Bacteria 7006
130 Ga0207658_10025506 3300025986 Bacteria 4139
131 Ga0207703_10005067 3300026035 Bacteria 10666
132 Ga0207639_10002221 3300026041 Bacteria 13071
133 Ga0207678_10068113 3300026067 Bacteria 3055
134 Ga0207641_10002603 3300026088 Bacteria 16561
135 Ga0207641_10031784 3300026088 Bacteria 4379
136 Ga0207676_10000922 3300026095 Bacteria 22753
137 Ga0207675_100004821 3300026118 Bacteria 12988
138 Ga0207698_10019381 3300026142 Bacteria 4656
139 Ga0209281_1000128 3300027111 Bacteria 199265
140 Ga0209281_1000496 3300027111 Bacteria 53494
141 Ga0209282_1000100 3300027666 Bacteria 59184
142 Ga0268266_10000314 3300028379 Bacteria 76554
143 Ga0268265_10000116 3300028380 Bacteria 100689
144 Ga0268265_10018086 3300028380 Bacteria 4880
145 Ga0268264_10000116 3300028381 Bacteria 198591
146 Ga0268264_10023795 3300028381 Bacteria 4996
147 Ga0265319_1014582 3300028563 Bacteria 3079
148 Ga0265336_10000960 3300028666 Bacteria 14406
149 Ga0265338_10000155 3300028800 Bacteria 125121
150 Ga0265325_10001298 3300031241 Bacteria 17692
151 Ga0265339_10000187 3300031249 Bacteria 52396
152 Ga0265331_10017944 3300031250 Bacteria 3680
153 Ga0265327_10002772 3300031251 Bacteria 17724
154 Ga0265316_10006747 3300031344 Bacteria 10941
155 Ga0307408_100190835 3300031548 Bacteria 1650
156 Ga0265313_10002689 3300031595 Bacteria 15053
157 Ga0307410_10013827 3300031852 Bacteria 4724
158 Ga0315914_1002597 3300031967 Bacteria 27642
159 Ga0315913_1001225 3300033430 Bacteria 27514
160 Ga0315915_1000012 3300033464 Bacteria 199284
161 Ga0373933_0004939 3300035724 Bacteria 7272
162 Ga0373937_0014200 3300036401 Bacteria 7027
163 Ga0373925_0024527 3300037068 Bacteria 4403
164 Ga0436364_0211444 3300037853 Bacteria 2449
165 Ga0436364_0387505 3300037853 Bacteria 7771
166 Ga0436364_0404199 3300037853 Bacteria 41005
167 Ga0436364_0747907 3300037853 Bacteria 18866
168 Ga0436364_1141179 3300037853 Bacteria 3661
169 Ga0395901_0069639 3300038443 Bacteria 3664
170 Ga0436365_1034188 3300039437 Bacteria 34077
171 Ga0436365_1888596 3300039437 Bacteria 1880
172 Ga0436360_0048819 3300039438 Bacteria 1480
173 Ga0436360_0380760 3300039438 Bacteria 4208
174 Ga0436360_0437652 3300039438 Unclassified 1437
175 Ga0436360_0643514 3300039438 Bacteria 2171
176 Ga0436360_1316669 3300039438 Bacteria 9110
177 Ga0436360_1346700 3300039438 Bacteria 2927
178 Ga0436361_0653152 3300039447 Bacteria 3301
179 Ga0436362_0042939 3300039453 Bacteria 1495
180 Ga0439436_0003132 3300041404 Bacteria 5014
181 Ga0439465_0013882 3300041413 Bacteria 2508
182 Ga0439462_0000063 3300042015 Bacteria 15632
183 Ga0450918_002300 3300042531 Bacteria 3616
184 Ga0451577_0001063 3300042876 Bacteria 39602
185 Ga0453684_0000039 3300044712 Bacteria 697730
186 Ga0466968_0032280 3300044735 Bacteria 2177
187 Ga0466960_0064603 3300044901 Bacteria 1805
188 Ga0451576_0000024 3300045051 Bacteria 470499
189 Ga0451576_0001589 3300045051 Bacteria 38176
190 Ga0466967_0014506 3300045976 Bacteria 6141
191 Ga0466967_0327532 3300045976 Bacteria 1479
192 Ga0495638_0092479 3300046460 Bacteria 1820
193 Ga0495628_0150171 3300046516 Bacteria 1775
194 Ga0495635_0149852 3300046663 Bacteria 1588
195 Ga0495599_0036380 3300046678 Bacteria 3092
196 Ga0495680_0018251 3300047322 Bacteria 5963
197 Ga0495675_0062714 3300047444 Bacteria 2353
198 Ga0495602_0075482 3300048088 Bacteria 2861
199 Ga0495602_0083688 3300048088 Bacteria 2672
200 Ga0496103_0005350 3300048906 Bacteria 7694
201 Ga0496116_0058344 3300048919 Bacteria 2517
202 Ga0496118_0007700 3300048921 Bacteria 11325
203 Ga0496118_0058861 3300048921 Bacteria 2867
204 Ga0496121_0020012 3300048924 Bacteria 6656
205 Ga0496121_0043139 3300048924 Bacteria 3911
206 Ga0496121_0123544 3300048924 Bacteria 1950
207 Ga0496123_0040936 3300048926 Bacteria 3219
208 Ga0496126_0029886 3300048929 Bacteria 5173
209 Ga0496126_0105305 3300048929 Bacteria 2463
210 Ga0501033_0013952 3300049570 Bacteria 6112
211 Ga0501034_0058766 3300049571 Bacteria 3863
212 Ga0501038_0044803 3300049574 Bacteria 3842
213 Ga0501040_0002807 3300049576 Bacteria 11234
214 Ga0501041_0006155 3300049577 Bacteria 7013
215 Ga0501042_0011251 3300049578 Bacteria 6031
216 Ga0501048_0046857 3300049582 Bacteria 3086
217 Ga0501074_0056051 3300049590 Bacteria 2840
218 Ga0501075_0003923 3300049591 Bacteria 10019
219 Ga0501076_0003434 3300049592 Bacteria 11115
220 Ga0501077_0004543 3300049593 Bacteria 8439
221 Ga0501079_0003162 3300049741 Bacteria 12068
222 Ga0501081_0025458 3300049743 Bacteria 3979
223 Ga0501083_0044248 3300049744 Bacteria 3014
224 Ga0501035_0249740 3300049822 Bacteria 1507
225 Ga0501044_0056386 3300049823 Bacteria 4034
226 Ga0501045_0002816 3300049824 Bacteria 11879
227 Ga0501045_0042177 3300049824 Bacteria 3322
228 nmdc:mga05p37_233120_c1 3300050507 Bacteria 2217
229 nmdc:mga09592_9424_c1 3300050508 Bacteria 7932
230 nmdc:mga0qj67_204593_c1 3300050509 Bacteria 1603
231 nmdc:mga06r32_49989_c1 3300050510 Bacteria 4000
232 Ga0500641_0003452 3300053096 Bacteria 5588
233 Ga0500636_0022301 3300053177 Bacteria 3748
234 Ga0501084_0014563 3300054114 Bacteria 6520
235 Ga0501084_0022912 3300054114 Bacteria 5212
236 Ga0530510_0008676 3300061734 Bacteria 7105

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0003434 Ga0501076_0003434_9980_11101 344
2 iso_pu_bacteria 2916076590 2916081631 361
3 3300037853 Ga0436364_0747907 Ga0436364_0747907_14672_15994 363
4 3300049824 Ga0501045_0002816 Ga0501045_0002816_39_1226 366
5 3300021320 Ga0214544_1001054 Ga0214544_100105446 380
6 3300021321 Ga0214542_1000019 Ga0214542_1000019155 380
7 3300021327 Ga0214543_1000010 Ga0214543_1000010311 380
8 3300039437 Ga0436365_1888596 Ga0436365_1888596_252_1571 382
9 3300045051 Ga0451576_0001589 Ga0451576_0001589_22332_23639 394
10 3300003215 JGI25153J46596_10007643 JGI25153J46596_100076432 398
11 3300006847 Ga0075431_100008812 Ga0075431_1000088124 398
12 3300009147 Ga0114129_10002004 Ga0114129_1000200414 398
13 3300025295 Ga0209564_1008342 Ga0209564_10083424 398
14 3300025297 Ga0209758_1000030 Ga0209758_1000030269 398
15 3300025297 Ga0209758_1000429 Ga0209758_100042913 398
16 3300025304 Ga0209257_1003962 Ga0209257_10039623 398
17 3300037853 Ga0436364_0387505 Ga0436364_0387505_3338_4645 398
18 3300039438 Ga0436360_0437652 Ga0436360_0437652_41_1354 398
19 3300039447 Ga0436361_0653152 Ga0436361_0653152_830_2128 398
20 3300048921 Ga0496118_0058861 Ga0496118_0058861_1496_2806 398
21 3300048924 Ga0496121_0043139 Ga0496121_0043139_1481_2791 398
22 3300048929 Ga0496126_0105305 Ga0496126_0105305_699_2009 398
23 3300050507 nmdc:mga05p37_233120_c1 nmdc:mga05p37_233120_c1_712_2025 398
24 3300050508 nmdc:mga09592_9424_c1 nmdc:mga09592_9424_c1_3153_4466 398
25 3300050510 nmdc:mga06r32_49989_c1 nmdc:mga06r32_49989_c1_2556_3869 398
26 3300053177 Ga0500636_0022301 Ga0500636_0022301_759_2069 398
27 3300049570 Ga0501033_0013952 Ga0501033_0013952_644_1939 402
28 3300049574 Ga0501038_0044803 Ga0501038_0044803_1239_2534 402
29 3300049576 Ga0501040_0002807 Ga0501040_0002807_3902_5197 402
30 3300049577 Ga0501041_0006155 Ga0501041_0006155_3602_4897 402
31 3300049578 Ga0501042_0011251 Ga0501042_0011251_764_2059 402
32 3300049582 Ga0501048_0046857 Ga0501048_0046857_175_1470 402
33 3300049590 Ga0501074_0056051 Ga0501074_0056051_690_1985 402
34 3300049591 Ga0501075_0003923 Ga0501075_0003923_632_1927 402
35 3300049593 Ga0501077_0004543 Ga0501077_0004543_6867_8162 402
36 3300049741 Ga0501079_0003162 Ga0501079_0003162_1230_2525 402
37 3300049743 Ga0501081_0025458 Ga0501081_0025458_409_1704 402
38 3300049744 Ga0501083_0044248 Ga0501083_0044248_1199_2494 402
39 3300054114 Ga0501084_0014563 Ga0501084_0014563_1729_3024 402
40 3300061734 Ga0530510_0008676 Ga0530510_0008676_3216_4511 402
41 3300025299 Ga0209256_1002999 Ga0209256_10029996 403
42 3300031548 Ga0307408_100190835 Ga0307408_1001908352 403
43 3300031852 Ga0307410_10013827 Ga0307410_100138271 403
44 3300039438 Ga0436360_1316669 Ga0436360_1316669_2056_3369 403
45 3300039453 Ga0436362_0042939 Ga0436362_0042939_37_1350 403
46 3300035724 Ga0373933_0004939 Ga0373933_0004939_1120_2418 404
47 3300036401 Ga0373937_0014200 Ga0373937_0014200_2859_4157 404
48 3300037068 Ga0373925_0024527 Ga0373925_0024527_2693_3991 404
49 3300046516 Ga0495628_0150171 Ga0495628_0150171_27_1325 404
50 3300046678 Ga0495599_0036380 Ga0495599_0036380_358_1656 404
51 3300047322 Ga0495680_0018251 Ga0495680_0018251_3758_5056 404
52 3300047444 Ga0495675_0062714 Ga0495675_0062714_699_1997 404
53 3300005262 Ga0065165_1006457 Ga0065165_10064572 406
54 3300028563 Ga0265319_1014582 Ga0265319_10145822 406
55 3300028666 Ga0265336_10000960 Ga0265336_100009609 406
56 3300028800 Ga0265338_10000155 Ga0265338_1000015577 406
57 3300010375 Ga0105239_10249092 Ga0105239_102490921 407
58 3300025924 Ga0207694_10177083 Ga0207694_101770832 407
59 3300037853 Ga0436364_0211444 Ga0436364_0211444_658_1962 407
60 3300005329 Ga0070683_100063393 Ga0070683_1000633933 408
61 3300005530 Ga0070679_100004001 Ga0070679_10000400112 408
62 3300006175 Ga0070712_100189578 Ga0070712_1001895782 408
63 3300025921 Ga0207652_10016213 Ga0207652_100162134 408
64 3300005289 Ga0065704_10089049 Ga0065704_100890494 409
65 3300025986 Ga0207658_10008452 Ga0207658_100084524 409
66 3300048906 Ga0496103_0005350 Ga0496103_0005350_3850_5175 409
67 3300048926 Ga0496123_0040936 Ga0496123_0040936_498_1823 409
68 3300049823 Ga0501044_0056386 Ga0501044_0056386_31_1446 410
69 3300002987 JGI25159J45721_1000121 JGI25159J45721_100012111 411
70 3300003354 JGI25160J50197_1000019 JGI25160J50197_1000019231 411
71 3300003374 JGI25161J50226_1000480 JGI25161J50226_100048014 411
72 3300003771 Ga0055526_1004467 Ga0055526_10044676 411
73 3300003781 Ga0055536_1018674 Ga0055536_10186742 411
74 3300003794 Ga0055531_10001596 Ga0055531_1000159613 411
75 3300004625 Ga0055543_1000428 Ga0055543_100042810 411
76 3300005262 Ga0065165_1000149 Ga0065165_1000149111 411
77 3300013249 Ga0171463_1008 Ga0171463_100813 411
78 3300015690 Ga0183363_1232 Ga0183363_12326 411
79 3300025208 Ga0209436_100582 Ga0209436_1005828 411
80 3300025284 Ga0209130_1000007 Ga0209130_1000007581 411
81 3300025292 Ga0209676_1013458 Ga0209676_10134582 411
82 3300025294 Ga0209025_1000033 Ga0209025_1000033265 411
83 3300025295 Ga0209564_1000152 Ga0209564_100015278 411
84 3300025298 Ga0209050_1019769 Ga0209050_10197692 411
85 3300025299 Ga0209256_1006075 Ga0209256_10060754 411
86 3300025302 Ga0207426_1000111 Ga0207426_1000111222 411
87 3300025304 Ga0209257_1009473 Ga0209257_10094734 411
88 3300025972 Ga0207668_10020560 Ga0207668_100205606 411
89 3300042015 Ga0439462_0000063 Ga0439462_0000063_11542_12837 411
90 3300005347 Ga0070668_100050622 Ga0070668_1000506223 412
91 3300009148 Ga0105243_10088475 Ga0105243_100884753 412
92 3300013100 Ga0157373_10013975 Ga0157373_100139755 412
93 3300025935 Ga0207709_10102920 Ga0207709_101029201 412
94 3300037853 Ga0436364_0404199 Ga0436364_0404199_7705_9066 412
95 3300048088 Ga0495602_0083688 Ga0495602_0083688_1028_2350 412
96 3300048921 Ga0496118_0007700 Ga0496118_0007700_3081_4391 412
97 3300037853 Ga0436364_1141179 Ga0436364_1141179_529_1836 413
98 3300045976 Ga0466967_0014506 Ga0466967_0014506_712_2016 413
99 3300049824 Ga0501045_0042177 Ga0501045_0042177_391_1692 413
100 3300005617 Ga0068859_100266709 Ga0068859_1002667093 414
101 3300005844 Ga0068862_100202872 Ga0068862_1002028721 414
102 3300006931 Ga0097620_100266732 Ga0097620_1002667323 414
103 3300021384 Ga0213876_10003903 Ga0213876_100039032 414
104 3300039437 Ga0436365_1034188 Ga0436365_1034188_12876_14153 414
105 3300005337 Ga0070682_100052520 Ga0070682_1000525203 415
106 3300005339 Ga0070660_100082857 Ga0070660_1000828572 415
107 3300005344 Ga0070661_100002236 Ga0070661_10000223610 415
108 3300005539 Ga0068853_100002747 Ga0068853_1000027475 415
109 3300005563 Ga0068855_100132141 Ga0068855_1001321412 415
110 3300005578 Ga0068854_100049869 Ga0068854_1000498693 415
111 3300005616 Ga0068852_100007260 Ga0068852_1000072605 415
112 3300005834 Ga0068851_10000619 Ga0068851_1000061912 415
113 3300021321 Ga0214542_1023426 Ga0214542_10234262 415
114 3300021327 Ga0214543_1000173 Ga0214543_100017337 415
115 3300025321 Ga0207656_10000640 Ga0207656_100006405 415
116 3300025909 Ga0207705_10003051 Ga0207705_100030518 415
117 3300025911 Ga0207654_10023057 Ga0207654_100230572 415
118 3300025919 Ga0207657_10095129 Ga0207657_100951292 415
119 3300025920 Ga0207649_10001587 Ga0207649_100015875 415
120 3300025924 Ga0207694_10028667 Ga0207694_100286673 415
121 3300025949 Ga0207667_10104123 Ga0207667_101041232 415
122 3300025981 Ga0207640_10006439 Ga0207640_100064396 415
123 3300026041 Ga0207639_10002221 Ga0207639_1000222110 415
124 3300026067 Ga0207678_10068113 Ga0207678_100681132 415
125 3300026142 Ga0207698_10019381 Ga0207698_100193811 415
126 3300038443 Ga0395901_0069639 Ga0395901_0069639_1459_2736 415
127 3300021388 Ga0213875_10002735 Ga0213875_100027355 416
128 3300025261 Ga0209233_1000949 Ga0209233_10009498 416
129 3300025272 Ga0209455_1009820 Ga0209455_10098201 416
130 3300045976 Ga0466967_0327532 Ga0466967_0327532_12_1307 416
131 3300021441 Ga0213871_10002923 Ga0213871_100029232 417
132 3300039438 Ga0436360_1346700 Ga0436360_1346700_641_1939 417
133 3300048924 Ga0496121_0020012 Ga0496121_0020012_3358_4668 417
134 3300049822 Ga0501035_0249740 Ga0501035_0249740_87_1373 417
135 3300039438 Ga0436360_0380760 Ga0436360_0380760_270_1568 418
136 3300054114 Ga0501084_0022912 Ga0501084_0022912_103_1392 418
137 iso_pu_bacteria 2513237159 2513997307 418
138 iso_pu_bacteria 2582581866 2585393755 418
139 iso_pu_bacteria 2842521101 2842522448 418
140 iso_pu_bacteria 2909399089 2909401514 419
141 iso_pu_bacteria 641228493 641334683 419
142 iso_pu_bacteria 643348555 643390816 419
143 iso_pu_bacteria 2599185156 2599331370 420
144 iso_pu_bacteria 2842775625 2842776161 420
145 iso_pu_bacteria 2842922631 2842923764 420
146 3300025253 Ga0209677_102015 Ga0209677_1020152 421
147 3300048924 Ga0496121_0123544 Ga0496121_0123544_13_1419 421
148 iso_pu_bacteria 2508501122 2509107730 421
149 iso_pu_bacteria 2509276019 2509376111 421
150 iso_pu_bacteria 2510065057 2510308343 421
151 iso_pu_bacteria 2511231052 2511501601 421
152 iso_pu_bacteria 2512047086 2512533044 421
153 iso_pu_bacteria 2512875026 2512971499 421
154 iso_pu_bacteria 2513237086 2513586251 421
155 iso_pu_bacteria 2513237089 2513604117 421
156 iso_pu_bacteria 2513237091 2513619809 421
157 iso_pu_bacteria 2513237140 2513884284 421
158 iso_pu_bacteria 2513237143 2513906604 421
159 iso_pu_bacteria 2513237156 2513987935 421
160 iso_pu_bacteria 2513237160 2514006343 421
161 iso_pu_bacteria 2515154107 2515608505 421
162 iso_pu_bacteria 2516143018 2516209377 421
163 iso_pu_bacteria 2516653046 2516892919 421
164 iso_pu_bacteria 2517487022 2517569710 421
165 iso_pu_bacteria 2524023207 2524453607 421
166 iso_pu_bacteria 2551306084 2551677587 421
167 iso_pu_bacteria 2551306085 2551686412 421
168 iso_pu_bacteria 2551306086 2551695125 421
169 iso_pu_bacteria 2551306087 2551698150 421
170 iso_pu_bacteria 2551306089 2551710701 421
171 iso_pu_bacteria 2551306090 2551718593 421
172 iso_pu_bacteria 2551306091 2551725569 421
173 iso_pu_bacteria 2551306092 2551736087 421
174 iso_pu_bacteria 2551306093 2551741394 421
175 iso_pu_bacteria 2558860100 2558868347 421
176 iso_pu_bacteria 2599185352 2600192462 421
177 iso_pu_bacteria 2643221557 2643808547 421
178 iso_pu_bacteria 2643221610 2644066356 421
179 iso_pu_bacteria 2643221618 2644109387 421
180 iso_pu_bacteria 2643221626 2644149113 421
181 iso_pu_bacteria 2643221637 2644210563 421
182 iso_pu_bacteria 2643221655 2644307652 421
183 iso_pu_bacteria 2643221659 2644332427 421
184 iso_pu_bacteria 2643221668 2644377907 421
185 iso_pu_bacteria 2643221675 2644415431 421
186 iso_pu_bacteria 2643221680 2644450167 421
187 iso_pu_bacteria 2643221698 2644544161 421
188 iso_pu_bacteria 2643221712 2644613741 421
189 iso_pu_bacteria 2643221718 2644654115 421
190 iso_pu_bacteria 2643221723 2644678038 421
191 iso_pu_bacteria 2643221726 2644687724 421
192 iso_pu_bacteria 2657244999 2657685361 421
193 iso_pu_bacteria 2690316117 2692316231 421
194 iso_pu_bacteria 2751185821 2753458189 421
195 iso_pu_bacteria 2791355082 2792580395 421
196 iso_pu_bacteria 2791355091 2792619845 421
197 iso_pu_bacteria 2791355092 2792626810 421
198 iso_pu_bacteria 2791355094 2792641548 421
199 iso_pu_bacteria 2791355253 2793279742 421
200 iso_pu_bacteria 2802428858 2802721973 421
201 iso_pu_bacteria 2802428859 2802727217 421
202 iso_pu_bacteria 2802428860 2802731998 421
203 iso_pu_bacteria 2802428861 2802738927 421
204 iso_pu_bacteria 2802428862 2802747589 421
205 iso_pu_bacteria 2802428863 2802752103 421
206 iso_pu_bacteria 2802429268 2804751995 421
207 iso_pu_bacteria 2838074704 2838080989 421
208 iso_pu_bacteria 2844163670 2844166923 421
209 iso_pu_bacteria 2847417321 2847418704 421
210 iso_pu_bacteria 2848992105 2848993683 421
211 iso_pu_bacteria 2850079185 2850080952 421
212 iso_pu_bacteria 2855825444 2855825697 421
213 iso_pu_bacteria 2855839649 2855841083 421
214 iso_pu_bacteria 2855872281 2855873713 421
215 iso_pu_bacteria 2858800743 2858801615 421
216 iso_pu_bacteria 2896384573 2896385123 421
217 iso_pu_bacteria 2913295892 2913300587 421
218 iso_pu_bacteria 2915980308 2915985510 421
219 iso_pu_bacteria 2915986958 2915988480 421
220 iso_pu_bacteria 2915993759 2916000444 421
221 iso_pu_bacteria 2916000859 2916006614 421
222 iso_pu_bacteria 2916007675 2916011450 421
223 iso_pu_bacteria 2916014648 2916015699 421
224 iso_pu_bacteria 2916021584 2916024493 421
225 iso_pu_bacteria 2916028427 2916032073 421
226 iso_pu_bacteria 2916035215 2916039019 421
227 iso_pu_bacteria 2916041962 2916045855 421
228 iso_pu_bacteria 2916048683 2916052565 421
229 iso_pu_bacteria 2916055098 2916059460 421
230 iso_pu_bacteria 2916061851 2916067841 421
231 iso_pu_bacteria 2916068649 2916073454 421
232 iso_pu_bacteria 2920760137 2920765841 421
233 iso_pu_bacteria 2920822456 2920824375 421
234 iso_pu_bacteria 2921201388 2921202416 421
235 iso_pu_bacteria 2921208531 2921209824 421
236 iso_pu_bacteria 2921237296 2921241336 421
237 iso_pu_bacteria 2921244191 2921248249 421
238 iso_pu_bacteria 2921250672 2921254983 421
239 iso_pu_bacteria 2921257292 2921263011 421
240 iso_pu_bacteria 2921263974 2921267758 421
241 iso_pu_bacteria 2921282425 2921283356 421
242 iso_pu_bacteria 2921289301 2921294899 421
243 iso_pu_bacteria 2924144063 2924148355 421
244 iso_pu_bacteria 2924150972 2924154821 421
245 iso_pu_bacteria 2924158325 2924159830 421
246 iso_pu_bacteria 2924165586 2924167076 421
247 iso_pu_bacteria 2924172951 2924177267 421
248 iso_pu_bacteria 2924179722 2924185014 421
249 iso_pu_bacteria 2924186466 2924192414 421
250 iso_pu_bacteria 2924193448 2924198827 421
251 iso_pu_bacteria 2924200457 2924204300 421
252 iso_pu_bacteria 2924207177 2924212918 421
253 iso_pu_bacteria 2924214083 2924220682 421
254 iso_pu_bacteria 2924221636 2924222917 421
255 iso_pu_bacteria 2924228884 2924232968 421
256 iso_pu_bacteria 2929199973 2929203658 421
257 iso_pu_bacteria 2936996657 2937002505 421
258 iso_pu_bacteria 2937002841 2937007484 421
259 iso_pu_bacteria 2937009748 2937013832 421
260 iso_pu_bacteria 2937016420 2937023037 421
261 iso_pu_bacteria 2937023124 2937028212 421
262 iso_pu_bacteria 2937029754 2937033736 421
263 iso_pu_bacteria 2937036028 2937038791 421
264 iso_pu_bacteria 2937042894 2937044726 421
265 iso_pu_bacteria 2937049772 2937050431 421
266 iso_pu_bacteria 2937056579 2937062553 421
267 iso_pu_bacteria 2937063883 2937068802 421
268 iso_pu_bacteria 2937071275 2937077406 421
269 iso_pu_bacteria 2937078374 2937079138 421
270 iso_pu_bacteria 2937091812 2937092524 421
271 iso_pu_bacteria 2937098957 2937099288 421
272 iso_pu_bacteria 2937113482 2937117109 421
273 iso_pu_bacteria 2937119839 2937124086 421
274 iso_pu_bacteria 2937126314 2937127523 421
275 iso_pu_bacteria 2941499720 2941505121 421
276 iso_pu_bacteria 2957375807 2957379600 421
277 iso_pu_bacteria 2957382221 2957386653 421
278 iso_pu_bacteria 2957388812 2957393072 421
279 iso_pu_bacteria 2957395598 2957401043 421
280 iso_pu_bacteria 2957402308 2957407218 421
281 iso_pu_bacteria 2957408893 2957412998 421
282 iso_pu_bacteria 2957415311 2957416955 421
283 iso_pu_bacteria 2957422303 2957423366 421
284 iso_pu_bacteria 2957430029 2957434933 421
285 iso_pu_bacteria 2957437181 2957440091 421
286 iso_pu_bacteria 2957443900 2957448564 421
287 iso_pu_bacteria 2957457609 2957462172 421
288 iso_pu_bacteria 2957464669 2957469094 421
289 iso_pu_bacteria 2957471148 2957474697 421
290 iso_pu_bacteria 2957478035 2957481632 421
291 iso_pu_bacteria 2957484790 2957489372 421
292 iso_pu_bacteria 2957491536 2957498048 421
293 iso_pu_bacteria 2957498199 2957503463 421
294 iso_pu_bacteria 2957505466 2957506585 421
295 iso_pu_bacteria 2960584000 2960585861 421
296 iso_pu_bacteria 2960591022 2960597136 421
297 iso_pu_bacteria 2960597568 2960600354 421
298 iso_pu_bacteria 2960603979 2960608878 421
299 iso_pu_bacteria 2960610863 2960615281 421
300 iso_pu_bacteria 2960617483 2960619006 421
301 iso_pu_bacteria 2960624210 2960628191 421
302 iso_pu_bacteria 2960631154 2960631715 421
303 iso_pu_bacteria 2960637947 2960642752 421
304 iso_pu_bacteria 2960645483 2960649713 421
305 iso_pu_bacteria 2960652885 2960658089 421
306 iso_pu_bacteria 2960660292 2960664456 421
307 iso_pu_bacteria 2960667422 2960669360 421
308 iso_pu_bacteria 2960674078 2960675083 421
309 iso_pu_bacteria 2960680706 2960686042 421
310 iso_pu_bacteria 2960687367 2960693014 421
311 iso_pu_bacteria 2960693952 2960697653 421
312 iso_pu_bacteria 2964607997 2964613829 421
313 iso_pu_bacteria 2964615318 2964621605 421
314 iso_pu_bacteria 2964621998 2964624713 421
315 iso_pu_bacteria 2964628898 2964633496 421
316 iso_pu_bacteria 2964636051 2964640885 421
317 iso_pu_bacteria 2964643177 2964647616 421
318 iso_pu_bacteria 2964649959 2964652176 421
319 iso_pu_bacteria 2964656573 2964661581 421
320 iso_pu_bacteria 2964663802 2964666950 421
321 iso_pu_bacteria 2964670856 2964671938 421
322 iso_pu_bacteria 2964678106 2964682932 421
323 iso_pu_bacteria 2964685014 2964689349 421
324 iso_pu_bacteria 2964691889 2964698684 421
325 iso_pu_bacteria 2964698721 2964703151 421
326 iso_pu_bacteria 2964705432 2964705853 421
327 iso_pu_bacteria 2964712639 2964716909 421
328 iso_pu_bacteria 2964719344 2964722825 421
329 iso_pu_bacteria 2967664464 2967671357 421
330 iso_pu_bacteria 2967671571 2967672619 421
331 iso_pu_bacteria 2967678726 2967685179 421
332 iso_pu_bacteria 2967686174 2967687357 421
333 iso_pu_bacteria 2967693043 2967697527 421
334 iso_pu_bacteria 2967699805 2967704778 421
335 iso_pu_bacteria 2967706974 2967713756 421
336 iso_pu_bacteria 2967714385 2967715398 421
337 iso_pu_bacteria 2967721400 2967725387 421
338 iso_pu_bacteria 2967728569 2967729299 421
339 iso_pu_bacteria 2967735183 2967741718 421
340 iso_pu_bacteria 2967742019 2967743988 421
341 iso_pu_bacteria 2967748971 2967753123 421
342 iso_pu_bacteria 2967755722 2967761018 421
343 iso_pu_bacteria 2967762386 2967766926 421
344 iso_pu_bacteria 2967769361 2967773109 421
345 iso_pu_bacteria 2967775926 2967779573 421
346 iso_pu_bacteria 2970019648 2970024692 421
347 iso_pu_bacteria 2970026789 2970029777 421
348 iso_pu_bacteria 2970033650 2970038371 421
349 iso_pu_bacteria 2970047711 2970051061 421
350 iso_pu_bacteria 2970054988 2970060437 421
351 iso_pu_bacteria 2970061556 2970066686 421
352 iso_pu_bacteria 2970068827 2970073605 421
353 iso_pu_bacteria 2970076120 2970079758 421
354 iso_pu_bacteria 2970082768 2970083789 421
355 iso_pu_bacteria 2970088815 2970093116 421
356 iso_pu_bacteria 2970095765 2970101155 421
357 iso_pu_bacteria 2970102677 2970107653 421
358 iso_pu_bacteria 2970109326 2970112788 421
359 iso_pu_bacteria 2970116247 2970120360 421
360 iso_pu_bacteria 2970122695 2970125713 421
361 iso_pu_bacteria 2970129317 2970133816 421
362 iso_pu_bacteria 2970136068 2970137032 421
363 iso_pu_bacteria 2970143518 2970146831 421
364 iso_pu_bacteria 2970149975 2970152810 421
365 iso_pu_bacteria 2970156795 2970163656 421
366 iso_pu_bacteria 2970164137 2970166380 421
367 iso_pu_bacteria 2970170962 2970177053 421
368 iso_pu_bacteria 2970177841 2970182338 421
369 iso_pu_bacteria 2970184632 2970188511 421
370 iso_pu_bacteria 2970191845 2970192664 421
371 iso_pu_bacteria 2977516862 2977521355 421
372 iso_pu_bacteria 2977523885 2977528596 421
373 iso_pu_bacteria 2977530762 2977532931 421
374 iso_pu_bacteria 2977537788 2977541529 421
375 iso_pu_bacteria 2977544691 2977545529 421
376 iso_pu_bacteria 2977551784 2977552649 421
377 iso_pu_bacteria 2977558990 2977563309 421
378 iso_pu_bacteria 2977565890 2977571000 421
379 iso_pu_bacteria 2977572785 2977578410 421
380 iso_pu_bacteria 2977579622 2977586272 421
381 iso_pu_bacteria 643692032 643825659 421
382 iso_pu_bacteria 648276728 648740707 421
383 iso_pu_bacteria 8003992118 8003993567 421
384 iso_pu_bacteria 8003999396 8004000978 421
385 iso_pu_bacteria 8049293176 8049294528 421
386 iso_pu_bacteria 8055909800 8055911151 421
387 3300041404 Ga0439436_0003132 Ga0439436_0003132_483_1757 422
388 3300041413 Ga0439465_0013882 Ga0439465_0013882_1076_2350 422
389 3300042531 Ga0450918_002300 Ga0450918_002300_1615_2889 422
390 3300046460 Ga0495638_0092479 Ga0495638_0092479_357_1646 422
391 3300053096 Ga0500641_0003452 Ga0500641_0003452_982_2271 422
392 iso_pu_bacteria 2894772417 2894772525 422
393 iso_pu_bacteria 8006926726 8006932898 422
394 3300009174 Ga0105241_10183468 Ga0105241_101834682 423
395 3300009551 Ga0105238_10033297 Ga0105238_100332973 423
396 3300010375 Ga0105239_10023078 Ga0105239_100230783 423
397 3300049571 Ga0501034_0058766 Ga0501034_0058766_2508_3818 423
398 3300031241 Ga0265325_10001298 Ga0265325_1000129820 424
399 3300031249 Ga0265339_10000187 Ga0265339_1000018727 424
400 3300031250 Ga0265331_10017944 Ga0265331_100179445 424
401 3300031344 Ga0265316_10006747 Ga0265316_100067479 424
402 3300031595 Ga0265313_10002689 Ga0265313_1000268913 424
403 iso_pu_bacteria 2883577096 2883578348 424
404 3300003775 Ga0055524_1000533 Ga0055524_100053317 425
405 3300005327 Ga0070658_10055846 Ga0070658_100558461 425
406 3300005458 Ga0070681_10062843 Ga0070681_100628434 425
407 3300006946 Ga0079104_1004616 Ga0079104_10046162 425
408 3300006946 Ga0079104_1011355 Ga0079104_10113552 425
409 3300022739 Ga0228711_1000007 Ga0228711_1000007193 425
410 3300022740 Ga0228710_1000007 Ga0228710_1000007180 425
411 3300025299 Ga0209256_1000218 Ga0209256_100021830 425
412 3300025909 Ga0207705_10010082 Ga0207705_100100825 425
413 3300027111 Ga0209281_1000128 Ga0209281_100012811 425
414 3300027111 Ga0209281_1000496 Ga0209281_100049610 425
415 3300027666 Ga0209282_1000100 Ga0209282_100010056 425
416 3300031967 Ga0315914_1002597 Ga0315914_100259711 425
417 3300033430 Ga0315913_1001225 Ga0315913_100122511 425
418 3300033464 Ga0315915_1000012 Ga0315915_1000012180 425
419 3300003203 JGI25406J46586_10000221 JGI25406J46586_1000022111 426
420 3300005985 Ga0081539_10000076 Ga0081539_10000076200 426
421 3300006846 Ga0075430_100130797 Ga0075430_1001307973 426
422 3300039438 Ga0436360_0048819 Ga0436360_0048819_124_1434 426
423 3300039438 Ga0436360_0643514 Ga0436360_0643514_176_1627 426
424 3300044735 Ga0466968_0032280 Ga0466968_0032280_31_1347 426
425 3300044901 Ga0466960_0064603 Ga0466960_0064603_100_1416 426
426 3300046663 Ga0495635_0149852 Ga0495635_0149852_175_1485 426
427 3300048088 Ga0495602_0075482 Ga0495602_0075482_629_1927 426
428 3300050509 nmdc:mga0qj67_204593_c1 nmdc:mga0qj67_204593_c1_95_1396 426
429 3300005937 Ga0081455_10120640 Ga0081455_101206402 428
430 3300025291 Ga0209675_1000467 Ga0209675_100046721 428
431 3300042876 Ga0451577_0001063 Ga0451577_0001063_4874_6184 428
432 3300044712 Ga0453684_0000039 Ga0453684_0000039_210351_211661 428
433 3300005436 Ga0070713_100169921 Ga0070713_1001699211 430
434 3300031251 Ga0265327_10002772 Ga0265327_1000277210 430
435 3300005295 Ga0065707_10098540 Ga0065707_100985402 431
436 3300005327 Ga0070658_10024280 Ga0070658_100242805 431
437 3300005331 Ga0070670_100025908 Ga0070670_1000259084 431
438 3300005355 Ga0070671_100005733 Ga0070671_1000057331 431
439 3300005530 Ga0070679_100178928 Ga0070679_1001789283 431
440 3300005548 Ga0070665_100000101 Ga0070665_10000010121 431
441 3300005841 Ga0068863_100012805 Ga0068863_1000128058 431
442 3300005843 Ga0068860_100123139 Ga0068860_1001231392 431
443 3300005844 Ga0068862_100031769 Ga0068862_1000317693 431
444 3300025909 Ga0207705_10003496 Ga0207705_100034965 431
445 3300025921 Ga0207652_10085394 Ga0207652_100853941 431
446 3300025931 Ga0207644_10000780 Ga0207644_1000078010 431
447 3300026088 Ga0207641_10031784 Ga0207641_100317844 431
448 3300028379 Ga0268266_10000314 Ga0268266_1000031437 431
449 3300028380 Ga0268265_10018086 Ga0268265_100180864 431
450 3300028381 Ga0268264_10023795 Ga0268264_100237954 431
451 3300045051 Ga0451576_0000024 Ga0451576_0000024_180411_181715 431
452 3300048919 Ga0496116_0058344 Ga0496116_0058344_92_1417 431
453 iso_pu_bacteria 2937084907 2937088899 432
454 3300001976 JGI24752J21851_1001178 JGI24752J21851_10011782 437
455 3300005289 Ga0065704_10070772 Ga0065704_100707728 437
456 3300005331 Ga0070670_100007105 Ga0070670_1000071052 437
457 3300005335 Ga0070666_10000182 Ga0070666_1000018218 437
458 3300005353 Ga0070669_100000001 Ga0070669_100000001514 437
459 3300005355 Ga0070671_100000002 Ga0070671_100000002102 437
460 3300005367 Ga0070667_100101843 Ga0070667_1001018432 437
461 3300005617 Ga0068859_100000571 Ga0068859_10000057127 437
462 3300005618 Ga0068864_100004727 Ga0068864_1000047275 437
463 3300005719 Ga0068861_100037506 Ga0068861_1000375062 437
464 3300005841 Ga0068863_100009586 Ga0068863_1000095867 437
465 3300005842 Ga0068858_100003312 Ga0068858_10000331214 437
466 3300005843 Ga0068860_100039444 Ga0068860_1000394444 437
467 3300005844 Ga0068862_100001481 Ga0068862_1000014812 437
468 3300006931 Ga0097620_100000571 Ga0097620_10000057127 437
469 3300009101 Ga0105247_10007587 Ga0105247_100075876 437
470 3300009553 Ga0105249_10332314 Ga0105249_103323141 437
471 3300013306 Ga0163162_10014858 Ga0163162_100148587 437
472 3300014325 Ga0163163_10020623 Ga0163163_100206236 437
473 3300017792 Ga0163161_10134323 Ga0163161_101343232 437
474 3300025315 Ga0207697_10000757 Ga0207697_100007575 437
475 3300025900 Ga0207710_10001291 Ga0207710_100012916 437
476 3300025903 Ga0207680_10000033 Ga0207680_1000003375 437
477 3300025923 Ga0207681_10000002 Ga0207681_10000002489 437
478 3300025925 Ga0207650_10050605 Ga0207650_100506052 437
479 3300025931 Ga0207644_10000002 Ga0207644_10000002494 437
480 3300025961 Ga0207712_10041965 Ga0207712_100419652 437
481 3300025972 Ga0207668_10000641 Ga0207668_1000064114 437
482 3300025986 Ga0207658_10025506 Ga0207658_100255063 437
483 3300026035 Ga0207703_10005067 Ga0207703_100050675 437
484 3300026088 Ga0207641_10002603 Ga0207641_1000260315 437
485 3300026095 Ga0207676_10000922 Ga0207676_1000092220 437
486 3300026118 Ga0207675_100004821 Ga0207675_10000482110 437
487 3300028380 Ga0268265_10000116 Ga0268265_1000011656 437
488 3300028381 Ga0268264_10000116 Ga0268264_10000116105 437
489 3300048929 Ga0496126_0029886 Ga0496126_0029886_2904_4220 437

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01595

CNNM

Cyclin M transmembrane N-terminal domain

53

240

0.95

PF03471

CorC_HlyC

Transporter associated domain

389

468

0.92

PF00571

CBS

CBS domain

320

375

0.87

PF00571

CBS

CBS domain

255

314

0.84

Feature Viewer

pLDDT pTM Quality
84.95 0.42 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map