F453696

General Info

Members Datasets Scaffolds Average Seq Length
488 313 485 143

Family's Representative Sequence

Representative Sequence 3300059424|Ga0590075_078144|Ga0590075_078144_373_828
Length 151
Sequence MDTPASSSLTWSDSLQDLDWDELSALYRVAPLGDKKPAALKVAFGNSMFRCLVRDARGQLVGAGRAVADGVDCSYLCDVAVHPSQQGRGLGRAIVARLVELSAGHKKIILYARPGTESFYLKQGFKRMATAMAIFENQALALERGLVVDGG

Samples

Sample ID Description Type Environment
1 2643221573 Lysobacter sp. Root604 Isolate Unclassified
2 2643221720 Lysobacter sp. Root916 Isolate Unclassified
3 2643221728 Lysobacter sp. Root983 Isolate Unclassified
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
145 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
167 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
168 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
171 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
172 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
173 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
177 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
178 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
179 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
180 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
181 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
182 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
183 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
184 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
185 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
186 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
187 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
188 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
212 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
297 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
298 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
301 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
302 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
303 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
304 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
305 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
306 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
309 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
310 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
311 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.98
Metatranscriptomes 0.41
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.07
Nodule 0
Rhizoplane 2.46
Rhizosphere 84.43
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000042 3300003215 Bacteria 161788
2 JGI25153J46596_10000087 3300003215 Bacteria 111217
3 rootH1_10189496 3300003323 Bacteria 1975
4 JGI25404J52841_10051555 3300003659 Unclassified 865
5 JGI25404J52841_10059408 3300003659 Unclassified 801
6 JGI25404J52841_10065322 3300003659 Unclassified 761
7 Ga0065712_10045287 3300005290 Bacteria 1268
8 Ga0065707_10684209 3300005295 Bacteria 647
9 Ga0070683_100069980 3300005329 Bacteria 3273
10 Ga0070682_100081085 3300005337 Bacteria 2100
11 Ga0070661_100003460 3300005344 Bacteria 10890
12 Ga0070668_100046941 3300005347 Bacteria 3319
13 Ga0070668_100865001 3300005347 Bacteria 806
14 Ga0070675_100008175 3300005354 Bacteria 8110
15 Ga0070675_100710753 3300005354 Bacteria 916
16 Ga0070671_100144517 3300005355 Bacteria 2008
17 Ga0070673_100287292 3300005364 Bacteria 1444
18 Ga0070667_100135681 3300005367 Bacteria 2151
19 Ga0070667_100477671 3300005367 Bacteria 1141
20 Ga0070709_10215935 3300005434 Bacteria 1365
21 Ga0070714_100000898 3300005435 Bacteria 21103
22 Ga0070714_102193800 3300005435 Bacteria 538
23 Ga0070713_100006995 3300005436 Bacteria 7877
24 Ga0070713_100170600 3300005436 Bacteria 1949
25 Ga0070713_100247688 3300005436 Bacteria 1624
26 Ga0070713_101413028 3300005436 Unclassified 675
27 Ga0070710_10140769 3300005437 Bacteria 1479
28 Ga0070710_10392289 3300005437 Bacteria 928
29 Ga0070711_100074837 3300005439 Bacteria 2396
30 Ga0070711_100433765 3300005439 Bacteria 1073
31 Ga0070711_100726153 3300005439 Unclassified 838
32 Ga0070705_100113143 3300005440 Bacteria 1738
33 Ga0070705_100394115 3300005440 Bacteria 1023
34 Ga0070663_100387210 3300005455 Bacteria 1140
35 Ga0070663_100499972 3300005455 Bacteria 1009
36 Ga0070681_10235409 3300005458 Bacteria 1745
37 Ga0068867_100291903 3300005459 Unclassified 1341
38 Ga0068867_100463398 3300005459 Unclassified 1082
39 Ga0070679_100918038 3300005530 Unclassified 819
40 Ga0070684_100079522 3300005535 Bacteria 2898
41 Ga0070672_100099258 3300005543 Bacteria 2360
42 Ga0070695_100343052 3300005545 Bacteria 1117
43 Ga0070696_100638846 3300005546 Bacteria 862
44 Ga0070696_100970524 3300005546 Bacteria 708
45 Ga0070665_100000214 3300005548 Bacteria 99943
46 Ga0070665_100143122 3300005548 Bacteria 2394
47 Ga0070704_100013495 3300005549 Bacteria 5070
48 Ga0070704_100014250 3300005549 Bacteria 4961
49 Ga0068855_100049732 3300005563 Bacteria 4943
50 Ga0068855_101983718 3300005563 Bacteria 588
51 Ga0070664_100000592 3300005564 Bacteria 27623
52 Ga0070664_102146728 3300005564 Bacteria 530
53 Ga0068857_100051030 3300005577 Bacteria 3668
54 Ga0068857_100180709 3300005577 Bacteria 1920
55 Ga0068857_100386110 3300005577 Bacteria 1301
56 Ga0068854_100345139 3300005578 Bacteria 1217
57 Ga0068856_100066992 3300005614 Bacteria 3548
58 Ga0068856_100410110 3300005614 Bacteria 1375
59 Ga0068852_100005510 3300005616 Bacteria 9070
60 Ga0068859_100001660 3300005617 Bacteria 22641
61 Ga0068859_100035690 3300005617 Bacteria 4989
62 Ga0068859_100221236 3300005617 Bacteria 1981
63 Ga0068859_100870515 3300005617 Bacteria 986
64 Ga0068864_100364142 3300005618 Bacteria 1367
65 Ga0068864_102521911 3300005618 Unclassified 520
66 Ga0068851_10108475 3300005834 Bacteria 1480
67 Ga0068863_100024525 3300005841 Bacteria 5753
68 Ga0068863_100080142 3300005841 Bacteria 3093
69 Ga0068860_100225007 3300005843 Unclassified 1822
70 Ga0068860_100360367 3300005843 Bacteria 1432
71 Ga0068860_100744303 3300005843 Bacteria 991
72 Ga0068860_100960165 3300005843 Bacteria 872
73 Ga0068860_102070758 3300005843 Unclassified 590
74 Ga0068862_100000111 3300005844 Bacteria 97515
75 Ga0068862_100004384 3300005844 Bacteria 11933
76 Ga0068862_100142366 3300005844 Bacteria 2129
77 Ga0068862_100571957 3300005844 Bacteria 1081
78 Ga0068862_101017558 3300005844 Unclassified 820
79 Ga0081455_10003088 3300005937 Bacteria 19407
80 Ga0081455_10013865 3300005937 Bacteria 7928
81 Ga0081455_10026737 3300005937 Bacteria 5298
82 Ga0081538_10031834 3300005981 Bacteria 3548
83 Ga0081540_1000176 3300005983 Bacteria 67057
84 Ga0081540_1000206 3300005983 Bacteria 61639
85 Ga0070717_10054387 3300006028 Bacteria 3301
86 Ga0070717_10660138 3300006028 Bacteria 949
87 Ga0075365_10012815 3300006038 Bacteria 4993
88 Ga0075368_10017357 3300006042 Bacteria 2693
89 Ga0075368_10066960 3300006042 Bacteria 1445
90 Ga0075363_100040505 3300006048 Bacteria 2456
91 Ga0075364_10836322 3300006051 Bacteria 627
92 Ga0070715_10007624 3300006163 Bacteria 3734
93 Ga0070716_100046759 3300006173 Bacteria 2437
94 Ga0070712_100059694 3300006175 Bacteria 2687
95 Ga0070712_100066403 3300006175 Bacteria 2564
96 Ga0075367_10079329 3300006178 Unclassified 1984
97 Ga0075367_10107038 3300006178 Bacteria 1714
98 Ga0075367_10237347 3300006178 Bacteria 1142
99 Ga0075367_10498227 3300006178 Bacteria 773
100 Ga0075366_10184710 3300006195 Bacteria 1267
101 Ga0075366_10581863 3300006195 Bacteria 694
102 Ga0097621_100784966 3300006237 Bacteria 882
103 Ga0075370_10076079 3300006353 Bacteria 1925
104 Ga0068871_100466686 3300006358 Bacteria 1134
105 Ga0075428_100032484 3300006844 Bacteria 5765
106 Ga0075428_100118791 3300006844 Bacteria 2879
107 Ga0075431_100050120 3300006847 Bacteria 4305
108 Ga0075431_101300000 3300006847 Bacteria 688
109 Ga0075433_10000194 3300006852 Bacteria 34121
110 Ga0075433_10170867 3300006852 Bacteria 1934
111 Ga0075434_100001852 3300006871 Bacteria 18253
112 Ga0075434_100424471 3300006871 Unclassified 1351
113 Ga0075429_100513637 3300006880 Bacteria 1050
114 Ga0075436_100080180 3300006914 Bacteria 2261
115 Ga0097620_100001660 3300006931 Bacteria 22641
116 Ga0097620_100035690 3300006931 Bacteria 4989
117 Ga0097620_100221250 3300006931 Bacteria 1981
118 Ga0097620_100870492 3300006931 Bacteria 986
119 Ga0097620_102275728 3300006931 Bacteria 598
120 Ga0075435_100449761 3300007076 Unclassified 1111
121 Ga0075435_100876395 3300007076 Bacteria 782
122 Ga0105240_10191843 3300009093 Bacteria 2402
123 Ga0105240_11371042 3300009093 Bacteria 744
124 Ga0111539_10002283 3300009094 Bacteria 25507
125 Ga0111539_10025340 3300009094 Bacteria 7270
126 Ga0105247_10008908 3300009101 Bacteria 6115
127 Ga0105247_10032069 3300009101 Bacteria 3191
128 Ga0114129_10043906 3300009147 Bacteria 6289
129 Ga0114129_10343634 3300009147 Bacteria 1978
130 Ga0114129_11457337 3300009147 Unclassified 843
131 Ga0105243_10638493 3300009148 Bacteria 1030
132 Ga0105241_10065958 3300009174 Unclassified 2798
133 Ga0105248_11052307 3300009177 Bacteria 919
134 Ga0105237_10165318 3300009545 Bacteria 2211
135 Ga0105237_10537916 3300009545 Bacteria 1175
136 Ga0105237_10902502 3300009545 Bacteria 891
137 Ga0105237_11963797 3300009545 Bacteria 593
138 Ga0105238_10457615 3300009551 Bacteria 1273
139 Ga0105249_10295733 3300009553 Bacteria 1622
140 Ga0105249_10473832 3300009553 Bacteria 1294
141 Ga0105249_10526827 3300009553 Unclassified 1230
142 Ga0105239_10698687 3300010375 Bacteria 1160
143 Ga0105239_10878772 3300010375 Bacteria 1028
144 Ga0105239_10905063 3300010375 Bacteria 1013
145 Ga0157370_10658385 3300013104 Bacteria 957
146 Ga0157369_10088622 3300013105 Bacteria 3303
147 Ga0163162_10191238 3300013306 Bacteria 2174
148 Ga0163162_10310989 3300013306 Bacteria 1708
149 Ga0157372_11037903 3300013307 Bacteria 949
150 Ga0163163_10381546 3300014325 Bacteria 1467
151 Ga0157380_10003693 3300014326 Bacteria 10530
152 Ga0157380_10017141 3300014326 Bacteria 5356
153 Ga0157379_10271455 3300014968 Bacteria 1542
154 Ga0157376_10189280 3300014969 Bacteria 1886
155 Ga0182006_1009171 3300015261 Bacteria 4446
156 Ga0182007_10015716 3300015262 Bacteria 2813
157 Ga0182005_1003414 3300015265 Bacteria 5400
158 Ga0206353_11371965 3300020082 Bacteria 741
159 Ga0206353_11914112 3300020082 Bacteria 2144
160 Ga0209758_1000110 3300025297 Bacteria 213110
161 Ga0209758_1079864 3300025297 Bacteria 994
162 Ga0209051_1063221 3300025303 Bacteria 1154
163 Ga0209257_1000376 3300025304 Bacteria 89065
164 Ga0209257_1028165 3300025304 Bacteria 1854
165 Ga0207656_10193782 3300025321 Bacteria 979
166 Ga0207692_10005506 3300025898 Bacteria 5078
167 Ga0207692_10082562 3300025898 Bacteria 1722
168 Ga0207710_10008446 3300025900 Bacteria 4343
169 Ga0207685_10009355 3300025905 Bacteria 2843
170 Ga0207699_10015504 3300025906 Bacteria 3960
171 Ga0207699_10103218 3300025906 Bacteria 1813
172 Ga0207695_10036237 3300025913 Bacteria 5335
173 Ga0207671_10038070 3300025914 Bacteria 3565
174 Ga0207693_10065925 3300025915 Bacteria 2835
175 Ga0207693_10090806 3300025915 Bacteria 2394
176 Ga0207693_10579821 3300025915 Unclassified 874
177 Ga0207663_10015774 3300025916 Bacteria 4176
178 Ga0207663_10156242 3300025916 Bacteria 1605
179 Ga0207663_10246221 3300025916 Bacteria 1313
180 Ga0207649_10017334 3300025920 Bacteria 4081
181 Ga0207694_10413517 3300025924 Bacteria 1123
182 Ga0207659_10106465 3300025926 Bacteria 2123
183 Ga0207700_10012827 3300025928 Bacteria 5421
184 Ga0207700_10032040 3300025928 Bacteria 3743
185 Ga0207664_10016194 3300025929 Bacteria 5431
186 Ga0207664_10027919 3300025929 Bacteria 4284
187 Ga0207664_10034644 3300025929 Bacteria 3889
188 Ga0207644_10173969 3300025931 Bacteria 1683
189 Ga0207709_10150875 3300025935 Bacteria 1609
190 Ga0207665_10082889 3300025939 Bacteria 2211
191 Ga0207691_10306371 3300025940 Bacteria 1364
192 Ga0207689_10060514 3300025942 Bacteria 3114
193 Ga0207661_10282909 3300025944 Bacteria 1483
194 Ga0207661_10617909 3300025944 Bacteria 995
195 Ga0207679_10000806 3300025945 Bacteria 20366
196 Ga0207667_10163776 3300025949 Bacteria 2287
197 Ga0207667_11485934 3300025949 Bacteria 649
198 Ga0207651_10060253 3300025960 Bacteria 2634
199 Ga0207712_10005111 3300025961 Bacteria 8303
200 Ga0207712_10018982 3300025961 Unclassified 4486
201 Ga0207668_10011730 3300025972 Bacteria 5338
202 Ga0207668_10848900 3300025972 Bacteria 811
203 Ga0207658_10700832 3300025986 Bacteria 915
204 Ga0207678_10540711 3300026067 Bacteria 1018
205 Ga0207702_10061689 3300026078 Bacteria 3199
206 Ga0207702_10610695 3300026078 Bacteria 1071
207 Ga0207641_10717600 3300026088 Bacteria 985
208 Ga0207674_10059123 3300026116 Bacteria 3880
209 Ga0207675_102384503 3300026118 Bacteria 542
210 Ga0207698_10003823 3300026142 Bacteria 9110
211 Ga0207698_10121734 3300026142 Bacteria 2210
212 Ga0209981_1068169 3300027378 Bacteria 548
213 Ga0209813_10008338 3300027866 Bacteria 2614
214 Ga0209813_10391229 3300027866 Bacteria 558
215 Ga0209974_10044570 3300027876 Unclassified 1480
216 Ga0207428_10013153 3300027907 Bacteria 7245
217 Ga0207428_10027853 3300027907 Bacteria 4700
218 Ga0268266_10000001 3300028379 Bacteria 4040580
219 Ga0268265_10000122 3300028380 Bacteria 97524
220 Ga0268265_10055740 3300028380 Bacteria 3004
221 Ga0268265_10120873 3300028380 Bacteria 2157
222 Ga0268265_10202760 3300028380 Bacteria 1722
223 Ga0268265_10800775 3300028380 Bacteria 918
224 Ga0268265_10929941 3300028380 Unclassified 855
225 Ga0268264_10037330 3300028381 Bacteria 4006
226 Ga0268264_10043422 3300028381 Unclassified 3725
227 Ga0268264_10096365 3300028381 Bacteria 2562
228 Ga0268264_10462532 3300028381 Bacteria 1231
229 Ga0307513_10315270 3300031456 Bacteria 1324
230 Ga0307408_100200922 3300031548 Unclassified 1613
231 Ga0307508_10141165 3300031616 Bacteria 2013
232 Ga0316575_10218719 3300031665 Bacteria 795
233 Ga0307405_11022237 3300031731 Bacteria 706
234 Ga0307406_10008281 3300031901 Bacteria 5792
235 Ga0307406_10745543 3300031901 Bacteria 822
236 Ga0307407_10822962 3300031903 Bacteria 708
237 Ga0307416_101292221 3300032002 Bacteria 835
238 Ga0307411_10519695 3300032005 Bacteria 1010
239 Ga0307415_100471331 3300032126 Unclassified 1091
240 Ga0373948_0046169 3300034817 Bacteria 925
241 Ga0373938_0021202 3300034957 Bacteria 1316
242 Ga0373934_0109434 3300035086 Bacteria 1120
243 Ga0373940_0008123 3300035088 Bacteria 2397
244 Ga0373944_0393705 3300035089 Unclassified 533
245 Ga0373949_0059211 3300035090 Bacteria 982
246 Ga0373952_0005051 3300035092 Bacteria 2404
247 Ga0373923_0050254 3300035111 Unclassified 1746
248 Ga0373932_0053615 3300035112 Bacteria 1204
249 Ga0373939_0061269 3300035114 Bacteria 1199
250 Ga0373941_0018568 3300035115 Bacteria 1923
251 Ga0373945_0220880 3300035116 Bacteria 792
252 Ga0373946_0059231 3300035171 Bacteria 1625
253 Ga0373955_0796288 3300035172 Bacteria 581
254 Ga0373942_0028632 3300035207 Bacteria 1457
255 Ga0373931_0019972 3300035691 Bacteria 3348
256 Ga0373931_0411483 3300035691 Unclassified 858
257 Ga0373931_0742030 3300035691 Bacteria 651
258 Ga0373927_0817222 3300035695 Bacteria 615
259 Ga0373947_0013512 3300035725 Bacteria 4677
260 Ga0373925_0096777 3300037068 Unclassified 2263
261 Ga0395898_0188629 3300037466 Bacteria 1970
262 Ga0395905_0207552 3300037471 Bacteria 1836
263 Ga0395905_0295494 3300037471 Bacteria 1507
264 Ga0395901_1173879 3300038443 Unclassified 735
265 Ga0400490_40065 3300038726 Bacteria 3351
266 Ga0400486_17470 3300038742 Bacteria 1141
267 Ga0400487_36289 3300039110 Unclassified 1305
268 Ga0439436_0002841 3300041404 Bacteria 5247
269 Ga0439436_0104068 3300041404 Unclassified 792
270 Ga0439439_0019903 3300041406 Bacteria 1667
271 Ga0439447_000252 3300041407 Bacteria 18824
272 Ga0439461_0106357 3300041410 Bacteria 688
273 Ga0439466_0248238 3300041411 Unclassified 539
274 Ga0439465_0002263 3300041413 Bacteria 6322
275 Ga0439465_0049298 3300041413 Bacteria 1375
276 Ga0439431_0052576 3300041997 Bacteria 1059
277 Ga0439445_0001103 3300042004 Bacteria 5773
278 Ga0439445_0054079 3300042004 Bacteria 1088
279 Ga0439449_0000144 3300042007 Bacteria 24266
280 Ga0450920_000175 3300042122 Bacteria 9097
281 Ga0450923_030509 3300042125 Bacteria 1097
282 Ga0450923_090973 3300042125 Bacteria 695
283 Ga0450894_007193 3300042131 Bacteria 1436
284 Ga0450895_002219 3300042132 Bacteria 1430
285 Ga0450896_000068 3300042133 Bacteria 6764
286 Ga0450898_071300 3300042134 Bacteria 696
287 Ga0450899_023409 3300042135 Bacteria 730
288 Ga0450906_018196 3300042145 Bacteria 1262
289 Ga0450907_003351 3300042146 Bacteria 2872
290 Ga0450908_000377 3300042184 Bacteria 8615
291 Ga0450918_001961 3300042531 Bacteria 3972
292 Ga0451577_1446701 3300042876 Unclassified 609
293 Ga0466969_0001007 3300044656 Bacteria 15244
294 Ga0466969_0032774 3300044656 Bacteria 2640
295 Ga0466969_0057037 3300044656 Bacteria 1905
296 Ga0466969_0076815 3300044656 Bacteria 1599
297 Ga0466965_0617391 3300044683 Unclassified 617
298 Ga0466966_0004313 3300044684 Bacteria 9375
299 Ga0466966_0005540 3300044684 Bacteria 8295
300 Ga0466961_0000044 3300044693 Bacteria 76071
301 Ga0466961_0473199 3300044693 Bacteria 757
302 Ga0466961_0545513 3300044693 Bacteria 698
303 Ga0466970_0242443 3300044765 Bacteria 1009
304 Ga0466960_0015021 3300044901 Bacteria 3331
305 Ga0466959_0005294 3300045049 Bacteria 8820
306 Ga0466959_0028106 3300045049 Bacteria 4171
307 Ga0466959_0116270 3300045049 Unclassified 1905
308 Ga0466959_0158424 3300045049 Archaea 1592
309 Ga0466959_0162325 3300045049 Bacteria 1570
310 Ga0466959_0339599 3300045049 Bacteria 1025
311 Ga0451576_0123198 3300045051 Unclassified 2700
312 Ga0451576_1031097 3300045051 Unclassified 862
313 Ga0466958_0285604 3300045836 Archaea 1058
314 Ga0495592_0014500 3300046454 Bacteria 5981
315 Ga0495592_0150615 3300046454 Unclassified 1609
316 Ga0495603_0074512 3300046455 Unclassified 1993
317 Ga0495629_0226640 3300046459 Bacteria 1288
318 Ga0495638_0273512 3300046460 Bacteria 921
319 Ga0495641_0298953 3300046461 Bacteria 725
320 Ga0495651_0002947 3300046462 Bacteria 13159
321 Ga0495651_0202503 3300046462 Bacteria 1388
322 Ga0495653_0059662 3300046463 Bacteria 2894
323 Ga0495582_0021334 3300046473 Unclassified 3545
324 Ga0495639_0073943 3300046475 Bacteria 1578
325 Ga0495664_0203553 3300046477 Unclassified 1199
326 Ga0495608_0000975 3300046511 Bacteria 20206
327 Ga0495608_0075479 3300046511 Unclassified 2197
328 Ga0495618_0004462 3300046514 Bacteria 8600
329 Ga0495628_0200701 3300046516 Bacteria 1503
330 Ga0495628_0384086 3300046516 Bacteria 1028
331 Ga0495630_0129583 3300046517 Bacteria 1915
332 Ga0495652_0032648 3300046529 Bacteria 4552
333 Ga0495652_0126335 3300046529 Unclassified 2031
334 Ga0495652_0189699 3300046529 Bacteria 1569
335 Ga0495665_0048469 3300046531 Bacteria 2252
336 Ga0495640_0023492 3300046533 Bacteria 4489
337 Ga0495587_0249132 3300046536 Bacteria 999
338 Ga0495645_0123050 3300046543 Bacteria 1825
339 Ga0495645_0201038 3300046543 Bacteria 1352
340 Ga0495645_0210479 3300046543 Bacteria 1313
341 Ga0495622_0060721 3300046557 Bacteria 1751
342 Ga0495634_0089427 3300046642 Bacteria 2001
343 Ga0495634_0397541 3300046642 Bacteria 819
344 Ga0495635_0132017 3300046663 Bacteria 1702
345 Ga0495588_0386146 3300046674 Bacteria 735
346 Ga0495657_0103437 3300046675 Bacteria 1812
347 Ga0495657_0143108 3300046675 Bacteria 1489
348 Ga0495599_0025637 3300046678 Bacteria 3691
349 Ga0495623_0044564 3300046679 Bacteria 2818
350 Ga0495646_0001775 3300046680 Bacteria 12961
351 Ga0495646_0015697 3300046680 Bacteria 4806
352 Ga0495647_0038321 3300046681 Bacteria 1812
353 Ga0495658_0063141 3300046683 Unclassified 2130
354 Ga0495613_0060916 3300046689 Unclassified 2764
355 Ga0495613_0165088 3300046689 Bacteria 1573
356 Ga0495624_0000704 3300046690 Bacteria 26244
357 Ga0495624_0020537 3300046690 Bacteria 4392
358 Ga0495624_0058344 3300046690 Unclassified 2424
359 Ga0495600_0000349 3300046809 Bacteria 24522
360 Ga0495600_0086794 3300046809 Bacteria 2041
361 Ga0495581_0008005 3300047315 Bacteria 6124
362 Ga0495604_0090609 3300047317 Bacteria 2270
363 Ga0495604_0202212 3300047317 Unclassified 1377
364 Ga0495674_0050851 3300047319 Unclassified 3655
365 Ga0495676_0125193 3300047321 Unclassified 1863
366 Ga0495680_0019894 3300047322 Bacteria 5658
367 Ga0495675_0280473 3300047444 Bacteria 994
368 Ga0495684_0028438 3300047471 Bacteria 4292
369 Ga0495593_0034781 3300047673 Unclassified 2738
370 Ga0495602_0037718 3300048088 Bacteria 4479
371 Ga0495602_0045868 3300048088 Bacteria 3952
372 Ga0495614_0068738 3300048089 Bacteria 1525
373 Ga0496100_0084000 3300048903 Bacteria 2157
374 Ga0496103_0021211 3300048906 Bacteria 3909
375 Ga0496104_0040998 3300048907 Bacteria 4340
376 Ga0496105_0019796 3300048908 Bacteria 5430
377 Ga0496106_0037461 3300048909 Bacteria 3628
378 Ga0496107_0163533 3300048910 Bacteria 1650
379 Ga0496108_0041919 3300048911 Bacteria 3821
380 Ga0496109_0048050 3300048912 Bacteria 3882
381 Ga0496110_0033643 3300048913 Bacteria 4436
382 Ga0496112_0149348 3300048915 Bacteria 2304
383 Ga0496114_0040404 3300048917 Bacteria 3862
384 Ga0496115_0024377 3300048918 Bacteria 4700
385 Ga0496125_0451645 3300048928 Bacteria 736
386 Ga0495682_0141569 3300049460 Bacteria 859
387 Ga0501036_0182801 3300049572 Bacteria 1765
388 Ga0501036_0295081 3300049572 Bacteria 1356
389 Ga0501036_0632142 3300049572 Bacteria 887
390 Ga0501038_0279444 3300049574 Bacteria 1315
391 Ga0501038_0406541 3300049574 Bacteria 1052
392 Ga0501038_0494479 3300049574 Bacteria 936
393 Ga0501039_0367516 3300049575 Bacteria 1130
394 Ga0501039_0615012 3300049575 Bacteria 851
395 Ga0501040_0027876 3300049576 Bacteria 3805
396 Ga0501040_0370802 3300049576 Bacteria 1027
397 Ga0501041_0024264 3300049577 Bacteria 3640
398 Ga0501041_0503877 3300049577 Bacteria 770
399 Ga0501042_0110950 3300049578 Bacteria 1975
400 Ga0501042_0111790 3300049578 Bacteria 1967
401 Ga0501043_0179460 3300049579 Bacteria 1650
402 Ga0501046_1121199 3300049580 Unclassified 543
403 Ga0501047_0420513 3300049581 Bacteria 1168
404 Ga0501067_0042772 3300049583 Bacteria 2516
405 Ga0501068_0014586 3300049584 Bacteria 4497
406 Ga0501069_0533669 3300049585 Unclassified 701
407 Ga0501070_0268262 3300049586 Bacteria 1394
408 Ga0501071_0160766 3300049587 Bacteria 1679
409 Ga0501071_0364688 3300049587 Bacteria 1100
410 Ga0501071_0436518 3300049587 Unclassified 1002
411 Ga0501071_1205013 3300049587 Bacteria 585
412 Ga0501072_0500357 3300049588 Bacteria 961
413 Ga0501073_0046206 3300049589 Bacteria 3063
414 Ga0501073_0140782 3300049589 Bacteria 1672
415 Ga0501075_0383611 3300049591 Bacteria 1071
416 Ga0501075_0535463 3300049591 Bacteria 894
417 Ga0501076_0198620 3300049592 Unclassified 1637
418 Ga0501076_0209319 3300049592 Bacteria 1593
419 Ga0501076_0245353 3300049592 Bacteria 1465
420 Ga0501076_0327423 3300049592 Bacteria 1257
421 Ga0501076_0604941 3300049592 Bacteria 904
422 Ga0501077_0239754 3300049593 Bacteria 1153
423 Ga0501077_0353855 3300049593 Bacteria 937
424 Ga0501081_0008332 3300049743 Bacteria 6727
425 Ga0501081_0135141 3300049743 Bacteria 1765
426 Ga0501083_0126662 3300049744 Bacteria 1674
427 Ga0501035_0177682 3300049822 Bacteria 1836
428 Ga0501044_0280792 3300049823 Bacteria 1599
429 Ga0501044_0346466 3300049823 Unclassified 1406
430 Ga0501045_0149428 3300049824 Bacteria 1738
431 Ga0501045_0177485 3300049824 Bacteria 1587
432 Ga0501045_0323085 3300049824 Bacteria 1148
433 Ga0501045_0824218 3300049824 Bacteria 683
434 nmdc:mga03683_91696_c1 3300050489 Bacteria 1325
435 nmdc:mga03n38_21733_c1 3300050490 Bacteria 2586
436 nmdc:mga03n38_54152_c1 3300050490 Bacteria 1802
437 nmdc:mga00v17_186519_c1 3300050491 Bacteria 1339
438 nmdc:mga00v17_322648_c1 3300050491 Bacteria 1003
439 nmdc:mga0yw44_33875_c1 3300050492 Bacteria 2988
440 nmdc:mga0k408_225678_c1 3300050493 Bacteria 1118
441 nmdc:mga0k408_422115_c1 3300050493 Bacteria 793
442 nmdc:mga06z11_44305_c1 3300050494 Bacteria 2243
443 nmdc:mga06z11_65387_c1 3300050494 Bacteria 1908
444 nmdc:mga06z11_9747_c1 3300050494 Bacteria 4059
445 nmdc:mga04h51_24128_c1 3300050495 Bacteria 1859
446 nmdc:mga04h51_4705_c1 3300050495 Bacteria 3418
447 nmdc:mga07m45_40401_c1 3300050496 Bacteria 2610
448 nmdc:mga07m45_717405_c1 3300050496 Unclassified 575
449 nmdc:mga05p37_37700_c1 3300050507 Bacteria 5928
450 nmdc:mga05p37_924432_c1 3300050507 Bacteria 937
451 nmdc:mga09592_102083_c2 3300050508 Bacteria 1484
452 nmdc:mga08y16_1105309_c1 3300050511 Bacteria 768
453 nmdc:mga08y16_43891_c1 3300050511 Bacteria 4685
454 nmdc:mga0n895_254601_c1 3300050512 Unclassified 1781
455 nmdc:mga0n895_7525_c1 3300050512 Bacteria 9354
456 nmdc:mga0n895_792088_c1 3300050512 Bacteria 939
457 nmdc:mga0rr50_882059_c1 3300050513 Bacteria 763
458 nmdc:mga08x19_104580_c1 3300050514 Bacteria 1882
459 nmdc:mga08x19_243317_c1 3300050514 Bacteria 1241
460 nmdc:mga0a205_414_c1 3300050515 Bacteria 32806
461 Ga0495601_0007629 3300053077 Bacteria 6354
462 Ga0495619_0026960 3300053085 Unclassified 3700
463 Ga0500644_0049497 3300053088 Bacteria 1435
464 Ga0500646_0009525 3300053090 Bacteria 2487
465 Ga0500651_0017406 3300053093 Bacteria 4434
466 Ga0500641_0242251 3300053096 Unclassified 759
467 Ga0500555_005786 3300053103 Plasmid 3510
468 Ga0500595_000784 3300053119 Bacteria 18541
469 Ga0500642_0002621 3300053130 Bacteria 5315
470 Ga0500658_0194470 3300053134 Bacteria 926
471 Ga0500658_0401285 3300053134 Bacteria 627
472 Ga0500574_003386 3300053141 Bacteria 2810
473 Ga0500588_0011787 3300053146 Bacteria 2150
474 Ga0500588_0296176 3300053146 Bacteria 612
475 Ga0500604_0004582 3300053151 Bacteria 3662
476 Ga0500616_0002864 3300053153 Bacteria 13839
477 Ga0500622_0004680 3300053156 Bacteria 8466
478 Ga0500622_0009288 3300053156 Bacteria 5451
479 Ga0500627_0437493 3300053158 Unclassified 552
480 Ga0500645_128025 3300053730 Unclassified 706
481 Ga0590075_078144 3300059424 Bacteria 857
482 Ga0501082_0030304 3300060353 Bacteria 4663
483 Ga0530510_0121112 3300061734 Bacteria 1921
484 Ga0530510_0182493 3300061734 Unclassified 1556
485 Ga0530510_0306611 3300061734 Bacteria 1189

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027378 Ga0209981_1068169 Ga0209981_10681692 128
2 3300003215 JGI25153J46596_10000042 JGI25153J46596_10000042118 139
3 3300003215 JGI25153J46596_10000087 JGI25153J46596_1000008712 139
4 3300003323 rootH1_10189496 rootH1_101894963 139
5 3300003659 JGI25404J52841_10051555 JGI25404J52841_100515551 139
6 3300003659 JGI25404J52841_10059408 JGI25404J52841_100594081 139
7 3300003659 JGI25404J52841_10065322 JGI25404J52841_100653221 139
8 3300005290 Ga0065712_10045287 Ga0065712_100452873 139
9 3300005295 Ga0065707_10684209 Ga0065707_106842091 139
10 3300005329 Ga0070683_100069980 Ga0070683_1000699802 139
11 3300005337 Ga0070682_100081085 Ga0070682_1000810852 139
12 3300005344 Ga0070661_100003460 Ga0070661_1000034607 139
13 3300005347 Ga0070668_100046941 Ga0070668_1000469414 139
14 3300005347 Ga0070668_100865001 Ga0070668_1008650011 139
15 3300005354 Ga0070675_100008175 Ga0070675_1000081756 139
16 3300005354 Ga0070675_100710753 Ga0070675_1007107532 139
17 3300005355 Ga0070671_100144517 Ga0070671_1001445172 139
18 3300005364 Ga0070673_100287292 Ga0070673_1002872923 139
19 3300005367 Ga0070667_100135681 Ga0070667_1001356814 139
20 3300005367 Ga0070667_100477671 Ga0070667_1004776712 139
21 3300005434 Ga0070709_10215935 Ga0070709_102159352 139
22 3300005435 Ga0070714_100000898 Ga0070714_10000089819 139
23 3300005435 Ga0070714_102193800 Ga0070714_1021938001 139
24 3300005436 Ga0070713_100006995 Ga0070713_10000699510 139
25 3300005436 Ga0070713_100170600 Ga0070713_1001706002 139
26 3300005436 Ga0070713_100247688 Ga0070713_1002476883 139
27 3300005436 Ga0070713_101413028 Ga0070713_1014130281 139
28 3300005437 Ga0070710_10140769 Ga0070710_101407692 139
29 3300005437 Ga0070710_10392289 Ga0070710_103922891 139
30 3300005439 Ga0070711_100074837 Ga0070711_1000748375 139
31 3300005439 Ga0070711_100433765 Ga0070711_1004337652 139
32 3300005439 Ga0070711_100726153 Ga0070711_1007261532 139
33 3300005440 Ga0070705_100113143 Ga0070705_1001131432 139
34 3300005440 Ga0070705_100394115 Ga0070705_1003941152 139
35 3300005455 Ga0070663_100387210 Ga0070663_1003872102 139
36 3300005455 Ga0070663_100499972 Ga0070663_1004999722 139
37 3300005458 Ga0070681_10235409 Ga0070681_102354093 139
38 3300005459 Ga0068867_100291903 Ga0068867_1002919032 139
39 3300005459 Ga0068867_100463398 Ga0068867_1004633981 139
40 3300005530 Ga0070679_100918038 Ga0070679_1009180381 139
41 3300005535 Ga0070684_100079522 Ga0070684_1000795222 139
42 3300005543 Ga0070672_100099258 Ga0070672_1000992586 139
43 3300005545 Ga0070695_100343052 Ga0070695_1003430522 139
44 3300005546 Ga0070696_100638846 Ga0070696_1006388461 139
45 3300005546 Ga0070696_100970524 Ga0070696_1009705241 139
46 3300005548 Ga0070665_100000214 Ga0070665_10000021417 139
47 3300005548 Ga0070665_100143122 Ga0070665_1001431223 139
48 3300005549 Ga0070704_100013495 Ga0070704_1000134955 139
49 3300005549 Ga0070704_100014250 Ga0070704_1000142502 139
50 3300005563 Ga0068855_100049732 Ga0068855_1000497326 139
51 3300005563 Ga0068855_101983718 Ga0068855_1019837182 139
52 3300005564 Ga0070664_100000592 Ga0070664_10000059214 139
53 3300005564 Ga0070664_102146728 Ga0070664_1021467281 139
54 3300005577 Ga0068857_100051030 Ga0068857_1000510302 139
55 3300005577 Ga0068857_100180709 Ga0068857_1001807091 139
56 3300005577 Ga0068857_100386110 Ga0068857_1003861102 139
57 3300005578 Ga0068854_100345139 Ga0068854_1003451393 139
58 3300005614 Ga0068856_100066992 Ga0068856_1000669923 139
59 3300005614 Ga0068856_100410110 Ga0068856_1004101103 139
60 3300005616 Ga0068852_100005510 Ga0068852_1000055106 139
61 3300005617 Ga0068859_100001660 Ga0068859_10000166023 139
62 3300005617 Ga0068859_100035690 Ga0068859_1000356906 139
63 3300005617 Ga0068859_100221236 Ga0068859_1002212363 139
64 3300005617 Ga0068859_100870515 Ga0068859_1008705152 139
65 3300005618 Ga0068864_100364142 Ga0068864_1003641422 139
66 3300005618 Ga0068864_102521911 Ga0068864_1025219111 139
67 3300005834 Ga0068851_10108475 Ga0068851_101084752 139
68 3300005841 Ga0068863_100024525 Ga0068863_1000245255 139
69 3300005841 Ga0068863_100080142 Ga0068863_1000801423 139
70 3300005843 Ga0068860_100225007 Ga0068860_1002250072 139
71 3300005843 Ga0068860_100360367 Ga0068860_1003603672 139
72 3300005843 Ga0068860_100744303 Ga0068860_1007443032 139
73 3300005843 Ga0068860_100960165 Ga0068860_1009601652 139
74 3300005843 Ga0068860_102070758 Ga0068860_1020707582 139
75 3300005844 Ga0068862_100000111 Ga0068862_10000011180 139
76 3300005844 Ga0068862_100004384 Ga0068862_1000043845 139
77 3300005844 Ga0068862_100142366 Ga0068862_1001423663 139
78 3300005844 Ga0068862_100571957 Ga0068862_1005719572 139
79 3300005844 Ga0068862_101017558 Ga0068862_1010175582 139
80 3300005937 Ga0081455_10003088 Ga0081455_1000308810 139
81 3300005937 Ga0081455_10013865 Ga0081455_100138651 139
82 3300005937 Ga0081455_10026737 Ga0081455_100267376 139
83 3300005981 Ga0081538_10031834 Ga0081538_100318342 139
84 3300005983 Ga0081540_1000176 Ga0081540_100017648 139
85 3300005983 Ga0081540_1000206 Ga0081540_10002064 139
86 3300006028 Ga0070717_10054387 Ga0070717_100543872 139
87 3300006028 Ga0070717_10660138 Ga0070717_106601382 139
88 3300006038 Ga0075365_10012815 Ga0075365_100128155 139
89 3300006042 Ga0075368_10017357 Ga0075368_100173573 139
90 3300006042 Ga0075368_10066960 Ga0075368_100669601 139
91 3300006048 Ga0075363_100040505 Ga0075363_1000405052 139
92 3300006051 Ga0075364_10836322 Ga0075364_108363222 139
93 3300006163 Ga0070715_10007624 Ga0070715_100076243 139
94 3300006173 Ga0070716_100046759 Ga0070716_1000467592 139
95 3300006175 Ga0070712_100059694 Ga0070712_1000596941 139
96 3300006175 Ga0070712_100066403 Ga0070712_1000664034 139
97 3300006178 Ga0075367_10079329 Ga0075367_100793292 139
98 3300006178 Ga0075367_10107038 Ga0075367_101070383 139
99 3300006178 Ga0075367_10237347 Ga0075367_102373472 139
100 3300006178 Ga0075367_10498227 Ga0075367_104982271 139
101 3300006195 Ga0075366_10184710 Ga0075366_101847102 139
102 3300006195 Ga0075366_10581863 Ga0075366_105818631 139
103 3300006237 Ga0097621_100784966 Ga0097621_1007849661 139
104 3300006353 Ga0075370_10076079 Ga0075370_100760793 139
105 3300006358 Ga0068871_100466686 Ga0068871_1004666862 139
106 3300006844 Ga0075428_100032484 Ga0075428_1000324848 139
107 3300006844 Ga0075428_100118791 Ga0075428_1001187912 139
108 3300006847 Ga0075431_100050120 Ga0075431_1000501207 139
109 3300006847 Ga0075431_101300000 Ga0075431_1013000001 139
110 3300006852 Ga0075433_10000194 Ga0075433_1000019420 139
111 3300006852 Ga0075433_10170867 Ga0075433_101708672 139
112 3300006871 Ga0075434_100001852 Ga0075434_10000185210 139
113 3300006871 Ga0075434_100424471 Ga0075434_1004244712 139
114 3300006880 Ga0075429_100513637 Ga0075429_1005136372 139
115 3300006914 Ga0075436_100080180 Ga0075436_1000801803 139
116 3300006931 Ga0097620_100001660 Ga0097620_10000166023 139
117 3300006931 Ga0097620_100035690 Ga0097620_1000356906 139
118 3300006931 Ga0097620_100221250 Ga0097620_1002212503 139
119 3300006931 Ga0097620_100870492 Ga0097620_1008704921 139
120 3300006931 Ga0097620_102275728 Ga0097620_1022757282 139
121 3300007076 Ga0075435_100449761 Ga0075435_1004497612 139
122 3300007076 Ga0075435_100876395 Ga0075435_1008763952 139
123 3300009093 Ga0105240_10191843 Ga0105240_101918431 139
124 3300009093 Ga0105240_11371042 Ga0105240_113710421 139
125 3300009094 Ga0111539_10002283 Ga0111539_1000228333 139
126 3300009094 Ga0111539_10025340 Ga0111539_100253404 139
127 3300009101 Ga0105247_10008908 Ga0105247_100089082 139
128 3300009101 Ga0105247_10032069 Ga0105247_100320694 139
129 3300009147 Ga0114129_10043906 Ga0114129_100439062 139
130 3300009147 Ga0114129_10343634 Ga0114129_103436343 139
131 3300009147 Ga0114129_11457337 Ga0114129_114573372 139
132 3300009148 Ga0105243_10638493 Ga0105243_106384931 139
133 3300009174 Ga0105241_10065958 Ga0105241_100659584 139
134 3300009177 Ga0105248_11052307 Ga0105248_110523072 139
135 3300009545 Ga0105237_10165318 Ga0105237_101653182 139
136 3300009545 Ga0105237_10537916 Ga0105237_105379162 139
137 3300009545 Ga0105237_10902502 Ga0105237_109025022 139
138 3300009545 Ga0105237_11963797 Ga0105237_119637971 139
139 3300009551 Ga0105238_10457615 Ga0105238_104576151 139
140 3300009553 Ga0105249_10295733 Ga0105249_102957332 139
141 3300009553 Ga0105249_10473832 Ga0105249_104738322 139
142 3300009553 Ga0105249_10526827 Ga0105249_105268272 139
143 3300010375 Ga0105239_10698687 Ga0105239_106986872 139
144 3300010375 Ga0105239_10878772 Ga0105239_108787721 139
145 3300010375 Ga0105239_10905063 Ga0105239_109050632 139
146 3300013104 Ga0157370_10658385 Ga0157370_106583853 139
147 3300013105 Ga0157369_10088622 Ga0157369_100886222 139
148 3300013306 Ga0163162_10191238 Ga0163162_101912382 139
149 3300013306 Ga0163162_10310989 Ga0163162_103109892 139
150 3300013307 Ga0157372_11037903 Ga0157372_110379032 139
151 3300014325 Ga0163163_10381546 Ga0163163_103815462 139
152 3300014326 Ga0157380_10003693 Ga0157380_1000369310 139
153 3300014326 Ga0157380_10017141 Ga0157380_100171417 139
154 3300014968 Ga0157379_10271455 Ga0157379_102714552 139
155 3300014969 Ga0157376_10189280 Ga0157376_101892801 139
156 3300015261 Ga0182006_1009171 Ga0182006_10091711 139
157 3300015262 Ga0182007_10015716 Ga0182007_100157162 139
158 3300015265 Ga0182005_1003414 Ga0182005_10034144 139
159 3300020082 Ga0206353_11371965 Ga0206353_113719651 139
160 3300020082 Ga0206353_11914112 Ga0206353_119141123 139
161 3300025297 Ga0209758_1000110 Ga0209758_100011086 139
162 3300025297 Ga0209758_1079864 Ga0209758_10798642 139
163 3300025303 Ga0209051_1063221 Ga0209051_10632212 139
164 3300025304 Ga0209257_1000376 Ga0209257_100037633 139
165 3300025304 Ga0209257_1028165 Ga0209257_10281653 139
166 3300025321 Ga0207656_10193782 Ga0207656_101937822 139
167 3300025898 Ga0207692_10005506 Ga0207692_100055067 139
168 3300025898 Ga0207692_10082562 Ga0207692_100825621 139
169 3300025900 Ga0207710_10008446 Ga0207710_100084462 139
170 3300025905 Ga0207685_10009355 Ga0207685_100093552 139
171 3300025906 Ga0207699_10015504 Ga0207699_100155046 139
172 3300025906 Ga0207699_10103218 Ga0207699_101032182 139
173 3300025913 Ga0207695_10036237 Ga0207695_100362375 139
174 3300025914 Ga0207671_10038070 Ga0207671_100380702 139
175 3300025915 Ga0207693_10065925 Ga0207693_100659252 139
176 3300025915 Ga0207693_10090806 Ga0207693_100908064 139
177 3300025915 Ga0207693_10579821 Ga0207693_105798212 139
178 3300025916 Ga0207663_10015774 Ga0207663_100157746 139
179 3300025916 Ga0207663_10156242 Ga0207663_101562422 139
180 3300025916 Ga0207663_10246221 Ga0207663_102462212 139
181 3300025920 Ga0207649_10017334 Ga0207649_100173343 139
182 3300025924 Ga0207694_10413517 Ga0207694_104135172 139
183 3300025926 Ga0207659_10106465 Ga0207659_101064652 139
184 3300025928 Ga0207700_10012827 Ga0207700_100128272 139
185 3300025928 Ga0207700_10032040 Ga0207700_100320407 139
186 3300025929 Ga0207664_10016194 Ga0207664_100161942 139
187 3300025929 Ga0207664_10027919 Ga0207664_100279195 139
188 3300025929 Ga0207664_10034644 Ga0207664_100346444 139
189 3300025931 Ga0207644_10173969 Ga0207644_101739692 139
190 3300025935 Ga0207709_10150875 Ga0207709_101508753 139
191 3300025939 Ga0207665_10082889 Ga0207665_100828893 139
192 3300025940 Ga0207691_10306371 Ga0207691_103063713 139
193 3300025942 Ga0207689_10060514 Ga0207689_100605142 139
194 3300025944 Ga0207661_10282909 Ga0207661_102829093 139
195 3300025944 Ga0207661_10617909 Ga0207661_106179092 139
196 3300025945 Ga0207679_10000806 Ga0207679_100008064 139
197 3300025949 Ga0207667_10163776 Ga0207667_101637763 139
198 3300025949 Ga0207667_11485934 Ga0207667_114859341 139
199 3300025960 Ga0207651_10060253 Ga0207651_100602531 139
200 3300025961 Ga0207712_10005111 Ga0207712_100051115 139
201 3300025961 Ga0207712_10018982 Ga0207712_100189822 139
202 3300025972 Ga0207668_10011730 Ga0207668_100117305 139
203 3300025972 Ga0207668_10848900 Ga0207668_108489002 139
204 3300025986 Ga0207658_10700832 Ga0207658_107008322 139
205 3300026067 Ga0207678_10540711 Ga0207678_105407112 139
206 3300026078 Ga0207702_10061689 Ga0207702_100616892 139
207 3300026078 Ga0207702_10610695 Ga0207702_106106953 139
208 3300026088 Ga0207641_10717600 Ga0207641_107176002 139
209 3300026116 Ga0207674_10059123 Ga0207674_100591233 139
210 3300026118 Ga0207675_102384503 Ga0207675_1023845032 139
211 3300026142 Ga0207698_10003823 Ga0207698_100038236 139
212 3300026142 Ga0207698_10121734 Ga0207698_101217343 139
213 3300027866 Ga0209813_10008338 Ga0209813_100083383 139
214 3300027866 Ga0209813_10391229 Ga0209813_103912291 139
215 3300027876 Ga0209974_10044570 Ga0209974_100445701 139
216 3300027907 Ga0207428_10013153 Ga0207428_100131533 139
217 3300027907 Ga0207428_10027853 Ga0207428_100278534 139
218 3300028379 Ga0268266_10000001 Ga0268266_10000001761 139
219 3300028380 Ga0268265_10000122 Ga0268265_1000012281 139
220 3300028380 Ga0268265_10055740 Ga0268265_100557404 139
221 3300028380 Ga0268265_10120873 Ga0268265_101208732 139
222 3300028380 Ga0268265_10202760 Ga0268265_102027602 139
223 3300028380 Ga0268265_10800775 Ga0268265_108007751 139
224 3300028380 Ga0268265_10929941 Ga0268265_109299412 139
225 3300028381 Ga0268264_10037330 Ga0268264_100373302 139
226 3300028381 Ga0268264_10043422 Ga0268264_100434222 139
227 3300028381 Ga0268264_10096365 Ga0268264_100963654 139
228 3300028381 Ga0268264_10462532 Ga0268264_104625322 139
229 3300031456 Ga0307513_10315270 Ga0307513_103152702 139
230 3300031548 Ga0307408_100200922 Ga0307408_1002009222 139
231 3300031616 Ga0307508_10141165 Ga0307508_101411652 139
232 3300031665 Ga0316575_10218719 Ga0316575_102187191 139
233 3300031731 Ga0307405_11022237 Ga0307405_110222371 139
234 3300031901 Ga0307406_10008281 Ga0307406_100082812 139
235 3300031901 Ga0307406_10745543 Ga0307406_107455431 139
236 3300031903 Ga0307407_10822962 Ga0307407_108229621 139
237 3300032002 Ga0307416_101292221 Ga0307416_1012922212 139
238 3300032005 Ga0307411_10519695 Ga0307411_105196952 139
239 3300032126 Ga0307415_100471331 Ga0307415_1004713312 139
240 3300034817 Ga0373948_0046169 Ga0373948_0046169_471_908 139
241 3300034957 Ga0373938_0021202 Ga0373938_0021202_687_1124 139
242 3300035086 Ga0373934_0109434 Ga0373934_0109434_172_609 139
243 3300035088 Ga0373940_0008123 Ga0373940_0008123_488_925 139
244 3300035089 Ga0373944_0393705 Ga0373944_0393705_80_517 139
245 3300035090 Ga0373949_0059211 Ga0373949_0059211_361_798 139
246 3300035092 Ga0373952_0005051 Ga0373952_0005051_466_903 139
247 3300035111 Ga0373923_0050254 Ga0373923_0050254_211_648 139
248 3300035112 Ga0373932_0053615 Ga0373932_0053615_733_1170 139
249 3300035114 Ga0373939_0061269 Ga0373939_0061269_393_830 139
250 3300035115 Ga0373941_0018568 Ga0373941_0018568_1165_1602 139
251 3300035116 Ga0373945_0220880 Ga0373945_0220880_146_583 139
252 3300035171 Ga0373946_0059231 Ga0373946_0059231_749_1186 139
253 3300035172 Ga0373955_0796288 Ga0373955_0796288_114_551 139
254 3300035207 Ga0373942_0028632 Ga0373942_0028632_954_1391 139
255 3300035691 Ga0373931_0019972 Ga0373931_0019972_2416_2853 139
256 3300035691 Ga0373931_0411483 Ga0373931_0411483_22_450 139
257 3300035691 Ga0373931_0742030 Ga0373931_0742030_189_632 139
258 3300035695 Ga0373927_0817222 Ga0373927_0817222_101_538 139
259 3300035725 Ga0373947_0013512 Ga0373947_0013512_749_1186 139
260 3300037068 Ga0373925_0096777 Ga0373925_0096777_1084_1521 139
261 3300037466 Ga0395898_0188629 Ga0395898_0188629_549_974 139
262 3300037471 Ga0395905_0207552 Ga0395905_0207552_1291_1722 139
263 3300037471 Ga0395905_0295494 Ga0395905_0295494_211_636 139
264 3300038443 Ga0395901_1173879 Ga0395901_1173879_157_582 139
265 3300038726 Ga0400490_40065 Ga0400490_40065_172_603 139
266 3300038742 Ga0400486_17470 Ga0400486_17470_642_1073 139
267 3300039110 Ga0400487_36289 Ga0400487_36289_483_914 139
268 3300041404 Ga0439436_0002841 Ga0439436_0002841_3441_3866 139
269 3300041404 Ga0439436_0104068 Ga0439436_0104068_100_528 139
270 3300041406 Ga0439439_0019903 Ga0439439_0019903_662_1087 139
271 3300041407 Ga0439447_000252 Ga0439447_000252_15124_15549 139
272 3300041410 Ga0439461_0106357 Ga0439461_0106357_140_568 139
273 3300041411 Ga0439466_0248238 Ga0439466_0248238_92_517 139
274 3300041413 Ga0439465_0002263 Ga0439465_0002263_3950_4384 139
275 3300041413 Ga0439465_0049298 Ga0439465_0049298_209_634 139
276 3300041997 Ga0439431_0052576 Ga0439431_0052576_465_893 139
277 3300042004 Ga0439445_0001103 Ga0439445_0001103_5323_5757 139
278 3300042004 Ga0439445_0054079 Ga0439445_0054079_414_839 139
279 3300042007 Ga0439449_0000144 Ga0439449_0000144_5700_6134 139
280 3300042122 Ga0450920_000175 Ga0450920_000175_2234_2665 139
281 3300042125 Ga0450923_030509 Ga0450923_030509_219_647 139
282 3300042125 Ga0450923_090973 Ga0450923_090973_205_639 139
283 3300042131 Ga0450894_007193 Ga0450894_007193_798_1229 139
284 3300042132 Ga0450895_002219 Ga0450895_002219_150_581 139
285 3300042133 Ga0450896_000068 Ga0450896_000068_871_1302 139
286 3300042134 Ga0450898_071300 Ga0450898_071300_182_613 139
287 3300042135 Ga0450899_023409 Ga0450899_023409_37_468 139
288 3300042145 Ga0450906_018196 Ga0450906_018196_152_583 139
289 3300042146 Ga0450907_003351 Ga0450907_003351_1539_1970 139
290 3300042184 Ga0450908_000377 Ga0450908_000377_3243_3674 139
291 3300042531 Ga0450918_001961 Ga0450918_001961_1772_2203 139
292 3300042876 Ga0451577_1446701 Ga0451577_1446701_90_509 139
293 3300044656 Ga0466969_0001007 Ga0466969_0001007_14613_15077 139
294 3300044656 Ga0466969_0032774 Ga0466969_0032774_2018_2446 139
295 3300044656 Ga0466969_0057037 Ga0466969_0057037_1014_1457 139
296 3300044656 Ga0466969_0076815 Ga0466969_0076815_1003_1434 139
297 3300044683 Ga0466965_0617391 Ga0466965_0617391_157_585 139
298 3300044684 Ga0466966_0004313 Ga0466966_0004313_3437_3865 139
299 3300044684 Ga0466966_0005540 Ga0466966_0005540_5071_5502 139
300 3300044693 Ga0466961_0000044 Ga0466961_0000044_68103_68534 139
301 3300044693 Ga0466961_0473199 Ga0466961_0473199_198_626 139
302 3300044693 Ga0466961_0545513 Ga0466961_0545513_127_591 139
303 3300044765 Ga0466970_0242443 Ga0466970_0242443_33_497 139
304 3300044901 Ga0466960_0015021 Ga0466960_0015021_2074_2553 139
305 3300045049 Ga0466959_0005294 Ga0466959_0005294_2069_2500 139
306 3300045049 Ga0466959_0028106 Ga0466959_0028106_1002_1466 139
307 3300045049 Ga0466959_0116270 Ga0466959_0116270_1200_1643 139
308 3300045049 Ga0466959_0158424 Ga0466959_0158424_411_854 139
309 3300045049 Ga0466959_0162325 Ga0466959_0162325_1084_1512 139
310 3300045049 Ga0466959_0339599 Ga0466959_0339599_173_622 139
311 3300045051 Ga0451576_0123198 Ga0451576_0123198_70_489 139
312 3300045051 Ga0451576_1031097 Ga0451576_1031097_204_629 139
313 3300045836 Ga0466958_0285604 Ga0466958_0285604_261_704 139
314 3300046454 Ga0495592_0014500 Ga0495592_0014500_807_1232 139
315 3300046454 Ga0495592_0150615 Ga0495592_0150615_140_577 139
316 3300046455 Ga0495603_0074512 Ga0495603_0074512_243_680 139
317 3300046459 Ga0495629_0226640 Ga0495629_0226640_616_1053 139
318 3300046460 Ga0495638_0273512 Ga0495638_0273512_194_613 139
319 3300046461 Ga0495641_0298953 Ga0495641_0298953_189_626 139
320 3300046462 Ga0495651_0002947 Ga0495651_0002947_6109_6534 139
321 3300046462 Ga0495651_0202503 Ga0495651_0202503_88_525 139
322 3300046463 Ga0495653_0059662 Ga0495653_0059662_1296_1721 139
323 3300046473 Ga0495582_0021334 Ga0495582_0021334_1550_1987 139
324 3300046475 Ga0495639_0073943 Ga0495639_0073943_250_687 139
325 3300046477 Ga0495664_0203553 Ga0495664_0203553_632_1069 139
326 3300046511 Ga0495608_0000975 Ga0495608_0000975_14379_14804 139
327 3300046511 Ga0495608_0075479 Ga0495608_0075479_1379_1816 139
328 3300046514 Ga0495618_0004462 Ga0495618_0004462_3435_3860 139
329 3300046516 Ga0495628_0200701 Ga0495628_0200701_642_1067 139
330 3300046516 Ga0495628_0384086 Ga0495628_0384086_447_884 139
331 3300046517 Ga0495630_0129583 Ga0495630_0129583_1063_1500 139
332 3300046529 Ga0495652_0032648 Ga0495652_0032648_2357_2782 139
333 3300046529 Ga0495652_0126335 Ga0495652_0126335_435_872 139
334 3300046529 Ga0495652_0189699 Ga0495652_0189699_928_1353 139
335 3300046531 Ga0495665_0048469 Ga0495665_0048469_550_987 139
336 3300046533 Ga0495640_0023492 Ga0495640_0023492_3529_3966 139
337 3300046536 Ga0495587_0249132 Ga0495587_0249132_115_552 139
338 3300046543 Ga0495645_0123050 Ga0495645_0123050_506_988 139
339 3300046543 Ga0495645_0201038 Ga0495645_0201038_144_569 139
340 3300046543 Ga0495645_0210479 Ga0495645_0210479_711_1136 139
341 3300046557 Ga0495622_0060721 Ga0495622_0060721_147_572 139
342 3300046642 Ga0495634_0089427 Ga0495634_0089427_816_1253 139
343 3300046642 Ga0495634_0397541 Ga0495634_0397541_11_436 139
344 3300046663 Ga0495635_0132017 Ga0495635_0132017_216_653 139
345 3300046674 Ga0495588_0386146 Ga0495588_0386146_189_626 139
346 3300046675 Ga0495657_0103437 Ga0495657_0103437_735_1217 139
347 3300046675 Ga0495657_0143108 Ga0495657_0143108_596_1021 139
348 3300046678 Ga0495599_0025637 Ga0495599_0025637_2781_3206 139
349 3300046679 Ga0495623_0044564 Ga0495623_0044564_186_611 139
350 3300046680 Ga0495646_0001775 Ga0495646_0001775_4782_5207 139
351 3300046680 Ga0495646_0015697 Ga0495646_0015697_539_964 139
352 3300046681 Ga0495647_0038321 Ga0495647_0038321_940_1377 139
353 3300046683 Ga0495658_0063141 Ga0495658_0063141_1313_1750 139
354 3300046689 Ga0495613_0060916 Ga0495613_0060916_2151_2588 139
355 3300046689 Ga0495613_0165088 Ga0495613_0165088_722_1159 139
356 3300046690 Ga0495624_0000704 Ga0495624_0000704_4790_5215 139
357 3300046690 Ga0495624_0020537 Ga0495624_0020537_304_741 139
358 3300046690 Ga0495624_0058344 Ga0495624_0058344_576_1013 139
359 3300046809 Ga0495600_0000349 Ga0495600_0000349_18774_19199 139
360 3300046809 Ga0495600_0086794 Ga0495600_0086794_954_1391 139
361 3300047315 Ga0495581_0008005 Ga0495581_0008005_5218_5655 139
362 3300047317 Ga0495604_0090609 Ga0495604_0090609_27_452 139
363 3300047317 Ga0495604_0202212 Ga0495604_0202212_309_746 139
364 3300047319 Ga0495674_0050851 Ga0495674_0050851_2788_3225 139
365 3300047321 Ga0495676_0125193 Ga0495676_0125193_1316_1753 139
366 3300047322 Ga0495680_0019894 Ga0495680_0019894_4384_4821 139
367 3300047444 Ga0495675_0280473 Ga0495675_0280473_148_585 139
368 3300047471 Ga0495684_0028438 Ga0495684_0028438_2124_2561 139
369 3300047673 Ga0495593_0034781 Ga0495593_0034781_1240_1677 139
370 3300048088 Ga0495602_0037718 Ga0495602_0037718_1174_1599 139
371 3300048088 Ga0495602_0045868 Ga0495602_0045868_1212_1637 139
372 3300048089 Ga0495614_0068738 Ga0495614_0068738_839_1276 139
373 3300048903 Ga0496100_0084000 Ga0496100_0084000_1701_2138 139
374 3300048906 Ga0496103_0021211 Ga0496103_0021211_1638_2075 139
375 3300048907 Ga0496104_0040998 Ga0496104_0040998_1531_1968 139
376 3300048908 Ga0496105_0019796 Ga0496105_0019796_2268_2705 139
377 3300048909 Ga0496106_0037461 Ga0496106_0037461_498_935 139
378 3300048910 Ga0496107_0163533 Ga0496107_0163533_322_759 139
379 3300048911 Ga0496108_0041919 Ga0496108_0041919_1457_1894 139
380 3300048912 Ga0496109_0048050 Ga0496109_0048050_435_872 139
381 3300048913 Ga0496110_0033643 Ga0496110_0033643_1507_1944 139
382 3300048915 Ga0496112_0149348 Ga0496112_0149348_197_634 139
383 3300048917 Ga0496114_0040404 Ga0496114_0040404_3307_3744 139
384 3300048918 Ga0496115_0024377 Ga0496115_0024377_2733_3170 139
385 3300048928 Ga0496125_0451645 Ga0496125_0451645_235_660 139
386 3300049460 Ga0495682_0141569 Ga0495682_0141569_202_627 139
387 3300049572 Ga0501036_0182801 Ga0501036_0182801_1110_1541 139
388 3300049572 Ga0501036_0295081 Ga0501036_0295081_846_1280 139
389 3300049572 Ga0501036_0632142 Ga0501036_0632142_161_607 139
390 3300049574 Ga0501038_0279444 Ga0501038_0279444_475_903 139
391 3300049574 Ga0501038_0406541 Ga0501038_0406541_479_913 139
392 3300049574 Ga0501038_0494479 Ga0501038_0494479_80_526 139
393 3300049575 Ga0501039_0367516 Ga0501039_0367516_604_1035 139
394 3300049575 Ga0501039_0615012 Ga0501039_0615012_313_747 139
395 3300049576 Ga0501040_0027876 Ga0501040_0027876_2222_2656 139
396 3300049576 Ga0501040_0370802 Ga0501040_0370802_386_820 139
397 3300049577 Ga0501041_0024264 Ga0501041_0024264_2537_2971 139
398 3300049577 Ga0501041_0503877 Ga0501041_0503877_214_648 139
399 3300049578 Ga0501042_0110950 Ga0501042_0110950_323_757 139
400 3300049578 Ga0501042_0111790 Ga0501042_0111790_1416_1847 139
401 3300049579 Ga0501043_0179460 Ga0501043_0179460_415_861 139
402 3300049580 Ga0501046_1121199 Ga0501046_1121199_66_500 139
403 3300049581 Ga0501047_0420513 Ga0501047_0420513_350_805 139
404 3300049583 Ga0501067_0042772 Ga0501067_0042772_1469_1915 139
405 3300049584 Ga0501068_0014586 Ga0501068_0014586_646_1074 139
406 3300049585 Ga0501069_0533669 Ga0501069_0533669_96_524 139
407 3300049586 Ga0501070_0268262 Ga0501070_0268262_79_525 139
408 3300049587 Ga0501071_0160766 Ga0501071_0160766_1001_1435 139
409 3300049587 Ga0501071_0364688 Ga0501071_0364688_295_723 139
410 3300049587 Ga0501071_0436518 Ga0501071_0436518_530_985 139
411 3300049587 Ga0501071_1205013 Ga0501071_1205013_127_561 139
412 3300049588 Ga0501072_0500357 Ga0501072_0500357_207_641 139
413 3300049589 Ga0501073_0046206 Ga0501073_0046206_748_1194 139
414 3300049589 Ga0501073_0140782 Ga0501073_0140782_152_571 139
415 3300049591 Ga0501075_0383611 Ga0501075_0383611_35_469 139
416 3300049591 Ga0501075_0535463 Ga0501075_0535463_76_606 139
417 3300049592 Ga0501076_0198620 Ga0501076_0198620_724_1158 139
418 3300049592 Ga0501076_0209319 Ga0501076_0209319_1021_1452 139
419 3300049592 Ga0501076_0245353 Ga0501076_0245353_381_815 139
420 3300049592 Ga0501076_0327423 Ga0501076_0327423_443_868 139
421 3300049592 Ga0501076_0604941 Ga0501076_0604941_344_778 139
422 3300049593 Ga0501077_0239754 Ga0501077_0239754_417_851 139
423 3300049593 Ga0501077_0353855 Ga0501077_0353855_368_802 139
424 3300049743 Ga0501081_0008332 Ga0501081_0008332_1585_2019 139
425 3300049743 Ga0501081_0135141 Ga0501081_0135141_653_1078 139
426 3300049744 Ga0501083_0126662 Ga0501083_0126662_1149_1595 139
427 3300049822 Ga0501035_0177682 Ga0501035_0177682_171_602 139
428 3300049823 Ga0501044_0280792 Ga0501044_0280792_602_1048 139
429 3300049823 Ga0501044_0346466 Ga0501044_0346466_177_611 139
430 3300049824 Ga0501045_0149428 Ga0501045_0149428_55_486 139
431 3300049824 Ga0501045_0177485 Ga0501045_0177485_895_1329 139
432 3300049824 Ga0501045_0323085 Ga0501045_0323085_617_1051 139
433 3300049824 Ga0501045_0824218 Ga0501045_0824218_112_561 139
434 3300050489 nmdc:mga03683_91696_c1 nmdc:mga03683_91696_c1_70_495 139
435 3300050490 nmdc:mga03n38_21733_c1 nmdc:mga03n38_21733_c1_1567_1992 139
436 3300050490 nmdc:mga03n38_54152_c1 nmdc:mga03n38_54152_c1_994_1419 139
437 3300050491 nmdc:mga00v17_186519_c1 nmdc:mga00v17_186519_c1_51_476 139
438 3300050491 nmdc:mga00v17_322648_c1 nmdc:mga00v17_322648_c1_440_865 139
439 3300050492 nmdc:mga0yw44_33875_c1 nmdc:mga0yw44_33875_c1_1322_1747 139
440 3300050493 nmdc:mga0k408_225678_c1 nmdc:mga0k408_225678_c1_558_983 139
441 3300050493 nmdc:mga0k408_422115_c1 nmdc:mga0k408_422115_c1_289_720 139
442 3300050494 nmdc:mga06z11_44305_c1 nmdc:mga06z11_44305_c1_1647_2072 139
443 3300050494 nmdc:mga06z11_65387_c1 nmdc:mga06z11_65387_c1_589_1029 139
444 3300050494 nmdc:mga06z11_9747_c1 nmdc:mga06z11_9747_c1_259_684 139
445 3300050495 nmdc:mga04h51_24128_c1 nmdc:mga04h51_24128_c1_108_533 139
446 3300050495 nmdc:mga04h51_4705_c1 nmdc:mga04h51_4705_c1_1572_1997 139
447 3300050496 nmdc:mga07m45_40401_c1 nmdc:mga07m45_40401_c1_1184_1609 139
448 3300050496 nmdc:mga07m45_717405_c1 nmdc:mga07m45_717405_c1_47_472 139
449 3300050507 nmdc:mga05p37_37700_c1 nmdc:mga05p37_37700_c1_985_1413 139
450 3300050507 nmdc:mga05p37_924432_c1 nmdc:mga05p37_924432_c1_179_607 139
451 3300050508 nmdc:mga09592_102083_c2 nmdc:mga09592_102083_c2_186_614 139
452 3300050511 nmdc:mga08y16_1105309_c1 nmdc:mga08y16_1105309_c1_101_529 139
453 3300050511 nmdc:mga08y16_43891_c1 nmdc:mga08y16_43891_c1_1617_2057 139
454 3300050512 nmdc:mga0n895_254601_c1 nmdc:mga0n895_254601_c1_432_857 139
455 3300050512 nmdc:mga0n895_7525_c1 nmdc:mga0n895_7525_c1_7342_7770 139
456 3300050512 nmdc:mga0n895_792088_c1 nmdc:mga0n895_792088_c1_349_786 139
457 3300050513 nmdc:mga0rr50_882059_c1 nmdc:mga0rr50_882059_c1_23_460 139
458 3300050514 nmdc:mga08x19_104580_c1 nmdc:mga08x19_104580_c1_311_748 139
459 3300050514 nmdc:mga08x19_243317_c1 nmdc:mga08x19_243317_c1_715_1140 139
460 3300050515 nmdc:mga0a205_414_c1 nmdc:mga0a205_414_c1_3145_3573 139
461 3300053077 Ga0495601_0007629 Ga0495601_0007629_127_552 139
462 3300053085 Ga0495619_0026960 Ga0495619_0026960_816_1253 139
463 3300053088 Ga0500644_0049497 Ga0500644_0049497_970_1389 139
464 3300053090 Ga0500646_0009525 Ga0500646_0009525_437_856 139
465 3300053093 Ga0500651_0017406 Ga0500651_0017406_118_543 139
466 3300053096 Ga0500641_0242251 Ga0500641_0242251_309_740 139
467 3300053103 Ga0500555_005786 Ga0500555_005786_1808_2239 139
468 3300053119 Ga0500595_000784 Ga0500595_000784_12217_12642 139
469 3300053130 Ga0500642_0002621 Ga0500642_0002621_1388_1807 139
470 3300053134 Ga0500658_0194470 Ga0500658_0194470_377_802 139
471 3300053134 Ga0500658_0401285 Ga0500658_0401285_22_441 139
472 3300053141 Ga0500574_003386 Ga0500574_003386_652_1077 139
473 3300053146 Ga0500588_0011787 Ga0500588_0011787_790_1209 139
474 3300053146 Ga0500588_0296176 Ga0500588_0296176_178_600 139
475 3300053151 Ga0500604_0004582 Ga0500604_0004582_962_1381 139
476 3300053153 Ga0500616_0002864 Ga0500616_0002864_7779_8201 139
477 3300053156 Ga0500622_0004680 Ga0500622_0004680_2344_2775 139
478 3300053156 Ga0500622_0009288 Ga0500622_0009288_3368_3799 139
479 3300053158 Ga0500627_0437493 Ga0500627_0437493_71_502 139
480 3300053730 Ga0500645_128025 Ga0500645_128025_62_487 139
481 3300059424 Ga0590075_078144 Ga0590075_078144_373_828 139
482 3300060353 Ga0501082_0030304 Ga0501082_0030304_1226_1660 139
483 3300061734 Ga0530510_0121112 Ga0530510_0121112_1269_1703 139
484 3300061734 Ga0530510_0182493 Ga0530510_0182493_130_564 139
485 3300061734 Ga0530510_0306611 Ga0530510_0306611_619_1050 139
486 iso_pu_bacteria 2643221573 2643880552 139
487 iso_pu_bacteria 2643221720 2644661120 139
488 iso_pu_bacteria 2643221728 2644699198 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

33

137

0.85

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

47

127

0.78

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

12

125

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dai-assembly1.cif.gz_A-2 the crystal structure of a serotonin n-acetyltransferase from oryza sativa 0.8865 2 116
7dai-assembly2.cif.gz_C the crystal structure of a serotonin n-acetyltransferase from oryza sativa 0.8831 2 116
7daj-assembly1.cif.gz_B the crystal structure of serotonin n-acetyltransferase in complex with acetyl-coa from oryza sativa 0.8779 2 116
7dal-assembly1.cif.gz_B the crystal structure of a serotonin n-acetyltransferase in complex with serotonin and acetyl-coa from oryza sativa 0.8741 2 116
1y7r-assembly1.cif.gz_B 1.7 a crystal structure of protein of unknown function sa2161 from meticillin-resistant staphylococcus aureus, probable acetyltransferase 0.8629 2 120
ID Description Score Start End Superfamily
af_Q6Z1Y6_51_185_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9172 2 118 3.40.630.30
af_O13738_1_94_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9044 42 113 3.40.630.30
af_A0A0R0JI04_11_132_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8954 41 118 3.40.630.30
af_A0A0R0KKK3_57_216_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8871 2 118 3.40.630.30
af_Q19835_80_302_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8548 42 118 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A0E3PKF5-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9756 2 91 GO:0005737
GO:0008080
AF-A0A1C3E8U6-F1-model_v4 N-acetyltransferase domain-containing protein 0.9741 2 120 GO:0005737
GO:0008080
AF-A0A2N3AHA4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9586 37 119 GO:0005737
GO:0008080
AF-A0A6M0S8I8-F1-model_v4 N-acetyltransferase 0.9483 2 121 GO:0016747
AF-A0A7X7NLT9-F1-model_v4 GNAT family N-acetyltransferase 0.9437 27 119 GO:0005737
GO:0008080

Feature Viewer

pLDDT pTM Quality
96.17 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map