F453696
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 488 | 313 | 485 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300059424|Ga0590075_078144|Ga0590075_078144_373_828 |
| Length | 151 |
| Sequence | MDTPASSSLTWSDSLQDLDWDELSALYRVAPLGDKKPAALKVAFGNSMFRCLVRDARGQLVGAGRAVADGVDCSYLCDVAVHPSQQGRGLGRAIVARLVELSAGHKKIILYARPGTESFYLKQGFKRMATAMAIFENQALALERGLVVDGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 2 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 3 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 46 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 131 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 135 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 136 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 137 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 138 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 140 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 143 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 144 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 145 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 146 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 147 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 150 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 151 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 154 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 155 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 161 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 164 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 167 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 168 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 169 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 170 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 171 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 172 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 173 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 174 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 175 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 176 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 177 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 178 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 179 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 180 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 181 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 182 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 183 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 184 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 185 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 186 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 187 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 188 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 189 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 190 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 243 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 247 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 254 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 280 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 281 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 282 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 283 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 284 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 286 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 297 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 298 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 299 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 300 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 301 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 302 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 303 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 305 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 306 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 309 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 311 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.98 |
| Metatranscriptomes | 0.41 |
| Isolates | 0.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.07 |
| Nodule | 0 |
| Rhizoplane | 2.46 |
| Rhizosphere | 84.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000042 | 3300003215 | Bacteria | 161788 |
| 2 | JGI25153J46596_10000087 | 3300003215 | Bacteria | 111217 |
| 3 | rootH1_10189496 | 3300003323 | Bacteria | 1975 |
| 4 | JGI25404J52841_10051555 | 3300003659 | Unclassified | 865 |
| 5 | JGI25404J52841_10059408 | 3300003659 | Unclassified | 801 |
| 6 | JGI25404J52841_10065322 | 3300003659 | Unclassified | 761 |
| 7 | Ga0065712_10045287 | 3300005290 | Bacteria | 1268 |
| 8 | Ga0065707_10684209 | 3300005295 | Bacteria | 647 |
| 9 | Ga0070683_100069980 | 3300005329 | Bacteria | 3273 |
| 10 | Ga0070682_100081085 | 3300005337 | Bacteria | 2100 |
| 11 | Ga0070661_100003460 | 3300005344 | Bacteria | 10890 |
| 12 | Ga0070668_100046941 | 3300005347 | Bacteria | 3319 |
| 13 | Ga0070668_100865001 | 3300005347 | Bacteria | 806 |
| 14 | Ga0070675_100008175 | 3300005354 | Bacteria | 8110 |
| 15 | Ga0070675_100710753 | 3300005354 | Bacteria | 916 |
| 16 | Ga0070671_100144517 | 3300005355 | Bacteria | 2008 |
| 17 | Ga0070673_100287292 | 3300005364 | Bacteria | 1444 |
| 18 | Ga0070667_100135681 | 3300005367 | Bacteria | 2151 |
| 19 | Ga0070667_100477671 | 3300005367 | Bacteria | 1141 |
| 20 | Ga0070709_10215935 | 3300005434 | Bacteria | 1365 |
| 21 | Ga0070714_100000898 | 3300005435 | Bacteria | 21103 |
| 22 | Ga0070714_102193800 | 3300005435 | Bacteria | 538 |
| 23 | Ga0070713_100006995 | 3300005436 | Bacteria | 7877 |
| 24 | Ga0070713_100170600 | 3300005436 | Bacteria | 1949 |
| 25 | Ga0070713_100247688 | 3300005436 | Bacteria | 1624 |
| 26 | Ga0070713_101413028 | 3300005436 | Unclassified | 675 |
| 27 | Ga0070710_10140769 | 3300005437 | Bacteria | 1479 |
| 28 | Ga0070710_10392289 | 3300005437 | Bacteria | 928 |
| 29 | Ga0070711_100074837 | 3300005439 | Bacteria | 2396 |
| 30 | Ga0070711_100433765 | 3300005439 | Bacteria | 1073 |
| 31 | Ga0070711_100726153 | 3300005439 | Unclassified | 838 |
| 32 | Ga0070705_100113143 | 3300005440 | Bacteria | 1738 |
| 33 | Ga0070705_100394115 | 3300005440 | Bacteria | 1023 |
| 34 | Ga0070663_100387210 | 3300005455 | Bacteria | 1140 |
| 35 | Ga0070663_100499972 | 3300005455 | Bacteria | 1009 |
| 36 | Ga0070681_10235409 | 3300005458 | Bacteria | 1745 |
| 37 | Ga0068867_100291903 | 3300005459 | Unclassified | 1341 |
| 38 | Ga0068867_100463398 | 3300005459 | Unclassified | 1082 |
| 39 | Ga0070679_100918038 | 3300005530 | Unclassified | 819 |
| 40 | Ga0070684_100079522 | 3300005535 | Bacteria | 2898 |
| 41 | Ga0070672_100099258 | 3300005543 | Bacteria | 2360 |
| 42 | Ga0070695_100343052 | 3300005545 | Bacteria | 1117 |
| 43 | Ga0070696_100638846 | 3300005546 | Bacteria | 862 |
| 44 | Ga0070696_100970524 | 3300005546 | Bacteria | 708 |
| 45 | Ga0070665_100000214 | 3300005548 | Bacteria | 99943 |
| 46 | Ga0070665_100143122 | 3300005548 | Bacteria | 2394 |
| 47 | Ga0070704_100013495 | 3300005549 | Bacteria | 5070 |
| 48 | Ga0070704_100014250 | 3300005549 | Bacteria | 4961 |
| 49 | Ga0068855_100049732 | 3300005563 | Bacteria | 4943 |
| 50 | Ga0068855_101983718 | 3300005563 | Bacteria | 588 |
| 51 | Ga0070664_100000592 | 3300005564 | Bacteria | 27623 |
| 52 | Ga0070664_102146728 | 3300005564 | Bacteria | 530 |
| 53 | Ga0068857_100051030 | 3300005577 | Bacteria | 3668 |
| 54 | Ga0068857_100180709 | 3300005577 | Bacteria | 1920 |
| 55 | Ga0068857_100386110 | 3300005577 | Bacteria | 1301 |
| 56 | Ga0068854_100345139 | 3300005578 | Bacteria | 1217 |
| 57 | Ga0068856_100066992 | 3300005614 | Bacteria | 3548 |
| 58 | Ga0068856_100410110 | 3300005614 | Bacteria | 1375 |
| 59 | Ga0068852_100005510 | 3300005616 | Bacteria | 9070 |
| 60 | Ga0068859_100001660 | 3300005617 | Bacteria | 22641 |
| 61 | Ga0068859_100035690 | 3300005617 | Bacteria | 4989 |
| 62 | Ga0068859_100221236 | 3300005617 | Bacteria | 1981 |
| 63 | Ga0068859_100870515 | 3300005617 | Bacteria | 986 |
| 64 | Ga0068864_100364142 | 3300005618 | Bacteria | 1367 |
| 65 | Ga0068864_102521911 | 3300005618 | Unclassified | 520 |
| 66 | Ga0068851_10108475 | 3300005834 | Bacteria | 1480 |
| 67 | Ga0068863_100024525 | 3300005841 | Bacteria | 5753 |
| 68 | Ga0068863_100080142 | 3300005841 | Bacteria | 3093 |
| 69 | Ga0068860_100225007 | 3300005843 | Unclassified | 1822 |
| 70 | Ga0068860_100360367 | 3300005843 | Bacteria | 1432 |
| 71 | Ga0068860_100744303 | 3300005843 | Bacteria | 991 |
| 72 | Ga0068860_100960165 | 3300005843 | Bacteria | 872 |
| 73 | Ga0068860_102070758 | 3300005843 | Unclassified | 590 |
| 74 | Ga0068862_100000111 | 3300005844 | Bacteria | 97515 |
| 75 | Ga0068862_100004384 | 3300005844 | Bacteria | 11933 |
| 76 | Ga0068862_100142366 | 3300005844 | Bacteria | 2129 |
| 77 | Ga0068862_100571957 | 3300005844 | Bacteria | 1081 |
| 78 | Ga0068862_101017558 | 3300005844 | Unclassified | 820 |
| 79 | Ga0081455_10003088 | 3300005937 | Bacteria | 19407 |
| 80 | Ga0081455_10013865 | 3300005937 | Bacteria | 7928 |
| 81 | Ga0081455_10026737 | 3300005937 | Bacteria | 5298 |
| 82 | Ga0081538_10031834 | 3300005981 | Bacteria | 3548 |
| 83 | Ga0081540_1000176 | 3300005983 | Bacteria | 67057 |
| 84 | Ga0081540_1000206 | 3300005983 | Bacteria | 61639 |
| 85 | Ga0070717_10054387 | 3300006028 | Bacteria | 3301 |
| 86 | Ga0070717_10660138 | 3300006028 | Bacteria | 949 |
| 87 | Ga0075365_10012815 | 3300006038 | Bacteria | 4993 |
| 88 | Ga0075368_10017357 | 3300006042 | Bacteria | 2693 |
| 89 | Ga0075368_10066960 | 3300006042 | Bacteria | 1445 |
| 90 | Ga0075363_100040505 | 3300006048 | Bacteria | 2456 |
| 91 | Ga0075364_10836322 | 3300006051 | Bacteria | 627 |
| 92 | Ga0070715_10007624 | 3300006163 | Bacteria | 3734 |
| 93 | Ga0070716_100046759 | 3300006173 | Bacteria | 2437 |
| 94 | Ga0070712_100059694 | 3300006175 | Bacteria | 2687 |
| 95 | Ga0070712_100066403 | 3300006175 | Bacteria | 2564 |
| 96 | Ga0075367_10079329 | 3300006178 | Unclassified | 1984 |
| 97 | Ga0075367_10107038 | 3300006178 | Bacteria | 1714 |
| 98 | Ga0075367_10237347 | 3300006178 | Bacteria | 1142 |
| 99 | Ga0075367_10498227 | 3300006178 | Bacteria | 773 |
| 100 | Ga0075366_10184710 | 3300006195 | Bacteria | 1267 |
| 101 | Ga0075366_10581863 | 3300006195 | Bacteria | 694 |
| 102 | Ga0097621_100784966 | 3300006237 | Bacteria | 882 |
| 103 | Ga0075370_10076079 | 3300006353 | Bacteria | 1925 |
| 104 | Ga0068871_100466686 | 3300006358 | Bacteria | 1134 |
| 105 | Ga0075428_100032484 | 3300006844 | Bacteria | 5765 |
| 106 | Ga0075428_100118791 | 3300006844 | Bacteria | 2879 |
| 107 | Ga0075431_100050120 | 3300006847 | Bacteria | 4305 |
| 108 | Ga0075431_101300000 | 3300006847 | Bacteria | 688 |
| 109 | Ga0075433_10000194 | 3300006852 | Bacteria | 34121 |
| 110 | Ga0075433_10170867 | 3300006852 | Bacteria | 1934 |
| 111 | Ga0075434_100001852 | 3300006871 | Bacteria | 18253 |
| 112 | Ga0075434_100424471 | 3300006871 | Unclassified | 1351 |
| 113 | Ga0075429_100513637 | 3300006880 | Bacteria | 1050 |
| 114 | Ga0075436_100080180 | 3300006914 | Bacteria | 2261 |
| 115 | Ga0097620_100001660 | 3300006931 | Bacteria | 22641 |
| 116 | Ga0097620_100035690 | 3300006931 | Bacteria | 4989 |
| 117 | Ga0097620_100221250 | 3300006931 | Bacteria | 1981 |
| 118 | Ga0097620_100870492 | 3300006931 | Bacteria | 986 |
| 119 | Ga0097620_102275728 | 3300006931 | Bacteria | 598 |
| 120 | Ga0075435_100449761 | 3300007076 | Unclassified | 1111 |
| 121 | Ga0075435_100876395 | 3300007076 | Bacteria | 782 |
| 122 | Ga0105240_10191843 | 3300009093 | Bacteria | 2402 |
| 123 | Ga0105240_11371042 | 3300009093 | Bacteria | 744 |
| 124 | Ga0111539_10002283 | 3300009094 | Bacteria | 25507 |
| 125 | Ga0111539_10025340 | 3300009094 | Bacteria | 7270 |
| 126 | Ga0105247_10008908 | 3300009101 | Bacteria | 6115 |
| 127 | Ga0105247_10032069 | 3300009101 | Bacteria | 3191 |
| 128 | Ga0114129_10043906 | 3300009147 | Bacteria | 6289 |
| 129 | Ga0114129_10343634 | 3300009147 | Bacteria | 1978 |
| 130 | Ga0114129_11457337 | 3300009147 | Unclassified | 843 |
| 131 | Ga0105243_10638493 | 3300009148 | Bacteria | 1030 |
| 132 | Ga0105241_10065958 | 3300009174 | Unclassified | 2798 |
| 133 | Ga0105248_11052307 | 3300009177 | Bacteria | 919 |
| 134 | Ga0105237_10165318 | 3300009545 | Bacteria | 2211 |
| 135 | Ga0105237_10537916 | 3300009545 | Bacteria | 1175 |
| 136 | Ga0105237_10902502 | 3300009545 | Bacteria | 891 |
| 137 | Ga0105237_11963797 | 3300009545 | Bacteria | 593 |
| 138 | Ga0105238_10457615 | 3300009551 | Bacteria | 1273 |
| 139 | Ga0105249_10295733 | 3300009553 | Bacteria | 1622 |
| 140 | Ga0105249_10473832 | 3300009553 | Bacteria | 1294 |
| 141 | Ga0105249_10526827 | 3300009553 | Unclassified | 1230 |
| 142 | Ga0105239_10698687 | 3300010375 | Bacteria | 1160 |
| 143 | Ga0105239_10878772 | 3300010375 | Bacteria | 1028 |
| 144 | Ga0105239_10905063 | 3300010375 | Bacteria | 1013 |
| 145 | Ga0157370_10658385 | 3300013104 | Bacteria | 957 |
| 146 | Ga0157369_10088622 | 3300013105 | Bacteria | 3303 |
| 147 | Ga0163162_10191238 | 3300013306 | Bacteria | 2174 |
| 148 | Ga0163162_10310989 | 3300013306 | Bacteria | 1708 |
| 149 | Ga0157372_11037903 | 3300013307 | Bacteria | 949 |
| 150 | Ga0163163_10381546 | 3300014325 | Bacteria | 1467 |
| 151 | Ga0157380_10003693 | 3300014326 | Bacteria | 10530 |
| 152 | Ga0157380_10017141 | 3300014326 | Bacteria | 5356 |
| 153 | Ga0157379_10271455 | 3300014968 | Bacteria | 1542 |
| 154 | Ga0157376_10189280 | 3300014969 | Bacteria | 1886 |
| 155 | Ga0182006_1009171 | 3300015261 | Bacteria | 4446 |
| 156 | Ga0182007_10015716 | 3300015262 | Bacteria | 2813 |
| 157 | Ga0182005_1003414 | 3300015265 | Bacteria | 5400 |
| 158 | Ga0206353_11371965 | 3300020082 | Bacteria | 741 |
| 159 | Ga0206353_11914112 | 3300020082 | Bacteria | 2144 |
| 160 | Ga0209758_1000110 | 3300025297 | Bacteria | 213110 |
| 161 | Ga0209758_1079864 | 3300025297 | Bacteria | 994 |
| 162 | Ga0209051_1063221 | 3300025303 | Bacteria | 1154 |
| 163 | Ga0209257_1000376 | 3300025304 | Bacteria | 89065 |
| 164 | Ga0209257_1028165 | 3300025304 | Bacteria | 1854 |
| 165 | Ga0207656_10193782 | 3300025321 | Bacteria | 979 |
| 166 | Ga0207692_10005506 | 3300025898 | Bacteria | 5078 |
| 167 | Ga0207692_10082562 | 3300025898 | Bacteria | 1722 |
| 168 | Ga0207710_10008446 | 3300025900 | Bacteria | 4343 |
| 169 | Ga0207685_10009355 | 3300025905 | Bacteria | 2843 |
| 170 | Ga0207699_10015504 | 3300025906 | Bacteria | 3960 |
| 171 | Ga0207699_10103218 | 3300025906 | Bacteria | 1813 |
| 172 | Ga0207695_10036237 | 3300025913 | Bacteria | 5335 |
| 173 | Ga0207671_10038070 | 3300025914 | Bacteria | 3565 |
| 174 | Ga0207693_10065925 | 3300025915 | Bacteria | 2835 |
| 175 | Ga0207693_10090806 | 3300025915 | Bacteria | 2394 |
| 176 | Ga0207693_10579821 | 3300025915 | Unclassified | 874 |
| 177 | Ga0207663_10015774 | 3300025916 | Bacteria | 4176 |
| 178 | Ga0207663_10156242 | 3300025916 | Bacteria | 1605 |
| 179 | Ga0207663_10246221 | 3300025916 | Bacteria | 1313 |
| 180 | Ga0207649_10017334 | 3300025920 | Bacteria | 4081 |
| 181 | Ga0207694_10413517 | 3300025924 | Bacteria | 1123 |
| 182 | Ga0207659_10106465 | 3300025926 | Bacteria | 2123 |
| 183 | Ga0207700_10012827 | 3300025928 | Bacteria | 5421 |
| 184 | Ga0207700_10032040 | 3300025928 | Bacteria | 3743 |
| 185 | Ga0207664_10016194 | 3300025929 | Bacteria | 5431 |
| 186 | Ga0207664_10027919 | 3300025929 | Bacteria | 4284 |
| 187 | Ga0207664_10034644 | 3300025929 | Bacteria | 3889 |
| 188 | Ga0207644_10173969 | 3300025931 | Bacteria | 1683 |
| 189 | Ga0207709_10150875 | 3300025935 | Bacteria | 1609 |
| 190 | Ga0207665_10082889 | 3300025939 | Bacteria | 2211 |
| 191 | Ga0207691_10306371 | 3300025940 | Bacteria | 1364 |
| 192 | Ga0207689_10060514 | 3300025942 | Bacteria | 3114 |
| 193 | Ga0207661_10282909 | 3300025944 | Bacteria | 1483 |
| 194 | Ga0207661_10617909 | 3300025944 | Bacteria | 995 |
| 195 | Ga0207679_10000806 | 3300025945 | Bacteria | 20366 |
| 196 | Ga0207667_10163776 | 3300025949 | Bacteria | 2287 |
| 197 | Ga0207667_11485934 | 3300025949 | Bacteria | 649 |
| 198 | Ga0207651_10060253 | 3300025960 | Bacteria | 2634 |
| 199 | Ga0207712_10005111 | 3300025961 | Bacteria | 8303 |
| 200 | Ga0207712_10018982 | 3300025961 | Unclassified | 4486 |
| 201 | Ga0207668_10011730 | 3300025972 | Bacteria | 5338 |
| 202 | Ga0207668_10848900 | 3300025972 | Bacteria | 811 |
| 203 | Ga0207658_10700832 | 3300025986 | Bacteria | 915 |
| 204 | Ga0207678_10540711 | 3300026067 | Bacteria | 1018 |
| 205 | Ga0207702_10061689 | 3300026078 | Bacteria | 3199 |
| 206 | Ga0207702_10610695 | 3300026078 | Bacteria | 1071 |
| 207 | Ga0207641_10717600 | 3300026088 | Bacteria | 985 |
| 208 | Ga0207674_10059123 | 3300026116 | Bacteria | 3880 |
| 209 | Ga0207675_102384503 | 3300026118 | Bacteria | 542 |
| 210 | Ga0207698_10003823 | 3300026142 | Bacteria | 9110 |
| 211 | Ga0207698_10121734 | 3300026142 | Bacteria | 2210 |
| 212 | Ga0209981_1068169 | 3300027378 | Bacteria | 548 |
| 213 | Ga0209813_10008338 | 3300027866 | Bacteria | 2614 |
| 214 | Ga0209813_10391229 | 3300027866 | Bacteria | 558 |
| 215 | Ga0209974_10044570 | 3300027876 | Unclassified | 1480 |
| 216 | Ga0207428_10013153 | 3300027907 | Bacteria | 7245 |
| 217 | Ga0207428_10027853 | 3300027907 | Bacteria | 4700 |
| 218 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 219 | Ga0268265_10000122 | 3300028380 | Bacteria | 97524 |
| 220 | Ga0268265_10055740 | 3300028380 | Bacteria | 3004 |
| 221 | Ga0268265_10120873 | 3300028380 | Bacteria | 2157 |
| 222 | Ga0268265_10202760 | 3300028380 | Bacteria | 1722 |
| 223 | Ga0268265_10800775 | 3300028380 | Bacteria | 918 |
| 224 | Ga0268265_10929941 | 3300028380 | Unclassified | 855 |
| 225 | Ga0268264_10037330 | 3300028381 | Bacteria | 4006 |
| 226 | Ga0268264_10043422 | 3300028381 | Unclassified | 3725 |
| 227 | Ga0268264_10096365 | 3300028381 | Bacteria | 2562 |
| 228 | Ga0268264_10462532 | 3300028381 | Bacteria | 1231 |
| 229 | Ga0307513_10315270 | 3300031456 | Bacteria | 1324 |
| 230 | Ga0307408_100200922 | 3300031548 | Unclassified | 1613 |
| 231 | Ga0307508_10141165 | 3300031616 | Bacteria | 2013 |
| 232 | Ga0316575_10218719 | 3300031665 | Bacteria | 795 |
| 233 | Ga0307405_11022237 | 3300031731 | Bacteria | 706 |
| 234 | Ga0307406_10008281 | 3300031901 | Bacteria | 5792 |
| 235 | Ga0307406_10745543 | 3300031901 | Bacteria | 822 |
| 236 | Ga0307407_10822962 | 3300031903 | Bacteria | 708 |
| 237 | Ga0307416_101292221 | 3300032002 | Bacteria | 835 |
| 238 | Ga0307411_10519695 | 3300032005 | Bacteria | 1010 |
| 239 | Ga0307415_100471331 | 3300032126 | Unclassified | 1091 |
| 240 | Ga0373948_0046169 | 3300034817 | Bacteria | 925 |
| 241 | Ga0373938_0021202 | 3300034957 | Bacteria | 1316 |
| 242 | Ga0373934_0109434 | 3300035086 | Bacteria | 1120 |
| 243 | Ga0373940_0008123 | 3300035088 | Bacteria | 2397 |
| 244 | Ga0373944_0393705 | 3300035089 | Unclassified | 533 |
| 245 | Ga0373949_0059211 | 3300035090 | Bacteria | 982 |
| 246 | Ga0373952_0005051 | 3300035092 | Bacteria | 2404 |
| 247 | Ga0373923_0050254 | 3300035111 | Unclassified | 1746 |
| 248 | Ga0373932_0053615 | 3300035112 | Bacteria | 1204 |
| 249 | Ga0373939_0061269 | 3300035114 | Bacteria | 1199 |
| 250 | Ga0373941_0018568 | 3300035115 | Bacteria | 1923 |
| 251 | Ga0373945_0220880 | 3300035116 | Bacteria | 792 |
| 252 | Ga0373946_0059231 | 3300035171 | Bacteria | 1625 |
| 253 | Ga0373955_0796288 | 3300035172 | Bacteria | 581 |
| 254 | Ga0373942_0028632 | 3300035207 | Bacteria | 1457 |
| 255 | Ga0373931_0019972 | 3300035691 | Bacteria | 3348 |
| 256 | Ga0373931_0411483 | 3300035691 | Unclassified | 858 |
| 257 | Ga0373931_0742030 | 3300035691 | Bacteria | 651 |
| 258 | Ga0373927_0817222 | 3300035695 | Bacteria | 615 |
| 259 | Ga0373947_0013512 | 3300035725 | Bacteria | 4677 |
| 260 | Ga0373925_0096777 | 3300037068 | Unclassified | 2263 |
| 261 | Ga0395898_0188629 | 3300037466 | Bacteria | 1970 |
| 262 | Ga0395905_0207552 | 3300037471 | Bacteria | 1836 |
| 263 | Ga0395905_0295494 | 3300037471 | Bacteria | 1507 |
| 264 | Ga0395901_1173879 | 3300038443 | Unclassified | 735 |
| 265 | Ga0400490_40065 | 3300038726 | Bacteria | 3351 |
| 266 | Ga0400486_17470 | 3300038742 | Bacteria | 1141 |
| 267 | Ga0400487_36289 | 3300039110 | Unclassified | 1305 |
| 268 | Ga0439436_0002841 | 3300041404 | Bacteria | 5247 |
| 269 | Ga0439436_0104068 | 3300041404 | Unclassified | 792 |
| 270 | Ga0439439_0019903 | 3300041406 | Bacteria | 1667 |
| 271 | Ga0439447_000252 | 3300041407 | Bacteria | 18824 |
| 272 | Ga0439461_0106357 | 3300041410 | Bacteria | 688 |
| 273 | Ga0439466_0248238 | 3300041411 | Unclassified | 539 |
| 274 | Ga0439465_0002263 | 3300041413 | Bacteria | 6322 |
| 275 | Ga0439465_0049298 | 3300041413 | Bacteria | 1375 |
| 276 | Ga0439431_0052576 | 3300041997 | Bacteria | 1059 |
| 277 | Ga0439445_0001103 | 3300042004 | Bacteria | 5773 |
| 278 | Ga0439445_0054079 | 3300042004 | Bacteria | 1088 |
| 279 | Ga0439449_0000144 | 3300042007 | Bacteria | 24266 |
| 280 | Ga0450920_000175 | 3300042122 | Bacteria | 9097 |
| 281 | Ga0450923_030509 | 3300042125 | Bacteria | 1097 |
| 282 | Ga0450923_090973 | 3300042125 | Bacteria | 695 |
| 283 | Ga0450894_007193 | 3300042131 | Bacteria | 1436 |
| 284 | Ga0450895_002219 | 3300042132 | Bacteria | 1430 |
| 285 | Ga0450896_000068 | 3300042133 | Bacteria | 6764 |
| 286 | Ga0450898_071300 | 3300042134 | Bacteria | 696 |
| 287 | Ga0450899_023409 | 3300042135 | Bacteria | 730 |
| 288 | Ga0450906_018196 | 3300042145 | Bacteria | 1262 |
| 289 | Ga0450907_003351 | 3300042146 | Bacteria | 2872 |
| 290 | Ga0450908_000377 | 3300042184 | Bacteria | 8615 |
| 291 | Ga0450918_001961 | 3300042531 | Bacteria | 3972 |
| 292 | Ga0451577_1446701 | 3300042876 | Unclassified | 609 |
| 293 | Ga0466969_0001007 | 3300044656 | Bacteria | 15244 |
| 294 | Ga0466969_0032774 | 3300044656 | Bacteria | 2640 |
| 295 | Ga0466969_0057037 | 3300044656 | Bacteria | 1905 |
| 296 | Ga0466969_0076815 | 3300044656 | Bacteria | 1599 |
| 297 | Ga0466965_0617391 | 3300044683 | Unclassified | 617 |
| 298 | Ga0466966_0004313 | 3300044684 | Bacteria | 9375 |
| 299 | Ga0466966_0005540 | 3300044684 | Bacteria | 8295 |
| 300 | Ga0466961_0000044 | 3300044693 | Bacteria | 76071 |
| 301 | Ga0466961_0473199 | 3300044693 | Bacteria | 757 |
| 302 | Ga0466961_0545513 | 3300044693 | Bacteria | 698 |
| 303 | Ga0466970_0242443 | 3300044765 | Bacteria | 1009 |
| 304 | Ga0466960_0015021 | 3300044901 | Bacteria | 3331 |
| 305 | Ga0466959_0005294 | 3300045049 | Bacteria | 8820 |
| 306 | Ga0466959_0028106 | 3300045049 | Bacteria | 4171 |
| 307 | Ga0466959_0116270 | 3300045049 | Unclassified | 1905 |
| 308 | Ga0466959_0158424 | 3300045049 | Archaea | 1592 |
| 309 | Ga0466959_0162325 | 3300045049 | Bacteria | 1570 |
| 310 | Ga0466959_0339599 | 3300045049 | Bacteria | 1025 |
| 311 | Ga0451576_0123198 | 3300045051 | Unclassified | 2700 |
| 312 | Ga0451576_1031097 | 3300045051 | Unclassified | 862 |
| 313 | Ga0466958_0285604 | 3300045836 | Archaea | 1058 |
| 314 | Ga0495592_0014500 | 3300046454 | Bacteria | 5981 |
| 315 | Ga0495592_0150615 | 3300046454 | Unclassified | 1609 |
| 316 | Ga0495603_0074512 | 3300046455 | Unclassified | 1993 |
| 317 | Ga0495629_0226640 | 3300046459 | Bacteria | 1288 |
| 318 | Ga0495638_0273512 | 3300046460 | Bacteria | 921 |
| 319 | Ga0495641_0298953 | 3300046461 | Bacteria | 725 |
| 320 | Ga0495651_0002947 | 3300046462 | Bacteria | 13159 |
| 321 | Ga0495651_0202503 | 3300046462 | Bacteria | 1388 |
| 322 | Ga0495653_0059662 | 3300046463 | Bacteria | 2894 |
| 323 | Ga0495582_0021334 | 3300046473 | Unclassified | 3545 |
| 324 | Ga0495639_0073943 | 3300046475 | Bacteria | 1578 |
| 325 | Ga0495664_0203553 | 3300046477 | Unclassified | 1199 |
| 326 | Ga0495608_0000975 | 3300046511 | Bacteria | 20206 |
| 327 | Ga0495608_0075479 | 3300046511 | Unclassified | 2197 |
| 328 | Ga0495618_0004462 | 3300046514 | Bacteria | 8600 |
| 329 | Ga0495628_0200701 | 3300046516 | Bacteria | 1503 |
| 330 | Ga0495628_0384086 | 3300046516 | Bacteria | 1028 |
| 331 | Ga0495630_0129583 | 3300046517 | Bacteria | 1915 |
| 332 | Ga0495652_0032648 | 3300046529 | Bacteria | 4552 |
| 333 | Ga0495652_0126335 | 3300046529 | Unclassified | 2031 |
| 334 | Ga0495652_0189699 | 3300046529 | Bacteria | 1569 |
| 335 | Ga0495665_0048469 | 3300046531 | Bacteria | 2252 |
| 336 | Ga0495640_0023492 | 3300046533 | Bacteria | 4489 |
| 337 | Ga0495587_0249132 | 3300046536 | Bacteria | 999 |
| 338 | Ga0495645_0123050 | 3300046543 | Bacteria | 1825 |
| 339 | Ga0495645_0201038 | 3300046543 | Bacteria | 1352 |
| 340 | Ga0495645_0210479 | 3300046543 | Bacteria | 1313 |
| 341 | Ga0495622_0060721 | 3300046557 | Bacteria | 1751 |
| 342 | Ga0495634_0089427 | 3300046642 | Bacteria | 2001 |
| 343 | Ga0495634_0397541 | 3300046642 | Bacteria | 819 |
| 344 | Ga0495635_0132017 | 3300046663 | Bacteria | 1702 |
| 345 | Ga0495588_0386146 | 3300046674 | Bacteria | 735 |
| 346 | Ga0495657_0103437 | 3300046675 | Bacteria | 1812 |
| 347 | Ga0495657_0143108 | 3300046675 | Bacteria | 1489 |
| 348 | Ga0495599_0025637 | 3300046678 | Bacteria | 3691 |
| 349 | Ga0495623_0044564 | 3300046679 | Bacteria | 2818 |
| 350 | Ga0495646_0001775 | 3300046680 | Bacteria | 12961 |
| 351 | Ga0495646_0015697 | 3300046680 | Bacteria | 4806 |
| 352 | Ga0495647_0038321 | 3300046681 | Bacteria | 1812 |
| 353 | Ga0495658_0063141 | 3300046683 | Unclassified | 2130 |
| 354 | Ga0495613_0060916 | 3300046689 | Unclassified | 2764 |
| 355 | Ga0495613_0165088 | 3300046689 | Bacteria | 1573 |
| 356 | Ga0495624_0000704 | 3300046690 | Bacteria | 26244 |
| 357 | Ga0495624_0020537 | 3300046690 | Bacteria | 4392 |
| 358 | Ga0495624_0058344 | 3300046690 | Unclassified | 2424 |
| 359 | Ga0495600_0000349 | 3300046809 | Bacteria | 24522 |
| 360 | Ga0495600_0086794 | 3300046809 | Bacteria | 2041 |
| 361 | Ga0495581_0008005 | 3300047315 | Bacteria | 6124 |
| 362 | Ga0495604_0090609 | 3300047317 | Bacteria | 2270 |
| 363 | Ga0495604_0202212 | 3300047317 | Unclassified | 1377 |
| 364 | Ga0495674_0050851 | 3300047319 | Unclassified | 3655 |
| 365 | Ga0495676_0125193 | 3300047321 | Unclassified | 1863 |
| 366 | Ga0495680_0019894 | 3300047322 | Bacteria | 5658 |
| 367 | Ga0495675_0280473 | 3300047444 | Bacteria | 994 |
| 368 | Ga0495684_0028438 | 3300047471 | Bacteria | 4292 |
| 369 | Ga0495593_0034781 | 3300047673 | Unclassified | 2738 |
| 370 | Ga0495602_0037718 | 3300048088 | Bacteria | 4479 |
| 371 | Ga0495602_0045868 | 3300048088 | Bacteria | 3952 |
| 372 | Ga0495614_0068738 | 3300048089 | Bacteria | 1525 |
| 373 | Ga0496100_0084000 | 3300048903 | Bacteria | 2157 |
| 374 | Ga0496103_0021211 | 3300048906 | Bacteria | 3909 |
| 375 | Ga0496104_0040998 | 3300048907 | Bacteria | 4340 |
| 376 | Ga0496105_0019796 | 3300048908 | Bacteria | 5430 |
| 377 | Ga0496106_0037461 | 3300048909 | Bacteria | 3628 |
| 378 | Ga0496107_0163533 | 3300048910 | Bacteria | 1650 |
| 379 | Ga0496108_0041919 | 3300048911 | Bacteria | 3821 |
| 380 | Ga0496109_0048050 | 3300048912 | Bacteria | 3882 |
| 381 | Ga0496110_0033643 | 3300048913 | Bacteria | 4436 |
| 382 | Ga0496112_0149348 | 3300048915 | Bacteria | 2304 |
| 383 | Ga0496114_0040404 | 3300048917 | Bacteria | 3862 |
| 384 | Ga0496115_0024377 | 3300048918 | Bacteria | 4700 |
| 385 | Ga0496125_0451645 | 3300048928 | Bacteria | 736 |
| 386 | Ga0495682_0141569 | 3300049460 | Bacteria | 859 |
| 387 | Ga0501036_0182801 | 3300049572 | Bacteria | 1765 |
| 388 | Ga0501036_0295081 | 3300049572 | Bacteria | 1356 |
| 389 | Ga0501036_0632142 | 3300049572 | Bacteria | 887 |
| 390 | Ga0501038_0279444 | 3300049574 | Bacteria | 1315 |
| 391 | Ga0501038_0406541 | 3300049574 | Bacteria | 1052 |
| 392 | Ga0501038_0494479 | 3300049574 | Bacteria | 936 |
| 393 | Ga0501039_0367516 | 3300049575 | Bacteria | 1130 |
| 394 | Ga0501039_0615012 | 3300049575 | Bacteria | 851 |
| 395 | Ga0501040_0027876 | 3300049576 | Bacteria | 3805 |
| 396 | Ga0501040_0370802 | 3300049576 | Bacteria | 1027 |
| 397 | Ga0501041_0024264 | 3300049577 | Bacteria | 3640 |
| 398 | Ga0501041_0503877 | 3300049577 | Bacteria | 770 |
| 399 | Ga0501042_0110950 | 3300049578 | Bacteria | 1975 |
| 400 | Ga0501042_0111790 | 3300049578 | Bacteria | 1967 |
| 401 | Ga0501043_0179460 | 3300049579 | Bacteria | 1650 |
| 402 | Ga0501046_1121199 | 3300049580 | Unclassified | 543 |
| 403 | Ga0501047_0420513 | 3300049581 | Bacteria | 1168 |
| 404 | Ga0501067_0042772 | 3300049583 | Bacteria | 2516 |
| 405 | Ga0501068_0014586 | 3300049584 | Bacteria | 4497 |
| 406 | Ga0501069_0533669 | 3300049585 | Unclassified | 701 |
| 407 | Ga0501070_0268262 | 3300049586 | Bacteria | 1394 |
| 408 | Ga0501071_0160766 | 3300049587 | Bacteria | 1679 |
| 409 | Ga0501071_0364688 | 3300049587 | Bacteria | 1100 |
| 410 | Ga0501071_0436518 | 3300049587 | Unclassified | 1002 |
| 411 | Ga0501071_1205013 | 3300049587 | Bacteria | 585 |
| 412 | Ga0501072_0500357 | 3300049588 | Bacteria | 961 |
| 413 | Ga0501073_0046206 | 3300049589 | Bacteria | 3063 |
| 414 | Ga0501073_0140782 | 3300049589 | Bacteria | 1672 |
| 415 | Ga0501075_0383611 | 3300049591 | Bacteria | 1071 |
| 416 | Ga0501075_0535463 | 3300049591 | Bacteria | 894 |
| 417 | Ga0501076_0198620 | 3300049592 | Unclassified | 1637 |
| 418 | Ga0501076_0209319 | 3300049592 | Bacteria | 1593 |
| 419 | Ga0501076_0245353 | 3300049592 | Bacteria | 1465 |
| 420 | Ga0501076_0327423 | 3300049592 | Bacteria | 1257 |
| 421 | Ga0501076_0604941 | 3300049592 | Bacteria | 904 |
| 422 | Ga0501077_0239754 | 3300049593 | Bacteria | 1153 |
| 423 | Ga0501077_0353855 | 3300049593 | Bacteria | 937 |
| 424 | Ga0501081_0008332 | 3300049743 | Bacteria | 6727 |
| 425 | Ga0501081_0135141 | 3300049743 | Bacteria | 1765 |
| 426 | Ga0501083_0126662 | 3300049744 | Bacteria | 1674 |
| 427 | Ga0501035_0177682 | 3300049822 | Bacteria | 1836 |
| 428 | Ga0501044_0280792 | 3300049823 | Bacteria | 1599 |
| 429 | Ga0501044_0346466 | 3300049823 | Unclassified | 1406 |
| 430 | Ga0501045_0149428 | 3300049824 | Bacteria | 1738 |
| 431 | Ga0501045_0177485 | 3300049824 | Bacteria | 1587 |
| 432 | Ga0501045_0323085 | 3300049824 | Bacteria | 1148 |
| 433 | Ga0501045_0824218 | 3300049824 | Bacteria | 683 |
| 434 | nmdc:mga03683_91696_c1 | 3300050489 | Bacteria | 1325 |
| 435 | nmdc:mga03n38_21733_c1 | 3300050490 | Bacteria | 2586 |
| 436 | nmdc:mga03n38_54152_c1 | 3300050490 | Bacteria | 1802 |
| 437 | nmdc:mga00v17_186519_c1 | 3300050491 | Bacteria | 1339 |
| 438 | nmdc:mga00v17_322648_c1 | 3300050491 | Bacteria | 1003 |
| 439 | nmdc:mga0yw44_33875_c1 | 3300050492 | Bacteria | 2988 |
| 440 | nmdc:mga0k408_225678_c1 | 3300050493 | Bacteria | 1118 |
| 441 | nmdc:mga0k408_422115_c1 | 3300050493 | Bacteria | 793 |
| 442 | nmdc:mga06z11_44305_c1 | 3300050494 | Bacteria | 2243 |
| 443 | nmdc:mga06z11_65387_c1 | 3300050494 | Bacteria | 1908 |
| 444 | nmdc:mga06z11_9747_c1 | 3300050494 | Bacteria | 4059 |
| 445 | nmdc:mga04h51_24128_c1 | 3300050495 | Bacteria | 1859 |
| 446 | nmdc:mga04h51_4705_c1 | 3300050495 | Bacteria | 3418 |
| 447 | nmdc:mga07m45_40401_c1 | 3300050496 | Bacteria | 2610 |
| 448 | nmdc:mga07m45_717405_c1 | 3300050496 | Unclassified | 575 |
| 449 | nmdc:mga05p37_37700_c1 | 3300050507 | Bacteria | 5928 |
| 450 | nmdc:mga05p37_924432_c1 | 3300050507 | Bacteria | 937 |
| 451 | nmdc:mga09592_102083_c2 | 3300050508 | Bacteria | 1484 |
| 452 | nmdc:mga08y16_1105309_c1 | 3300050511 | Bacteria | 768 |
| 453 | nmdc:mga08y16_43891_c1 | 3300050511 | Bacteria | 4685 |
| 454 | nmdc:mga0n895_254601_c1 | 3300050512 | Unclassified | 1781 |
| 455 | nmdc:mga0n895_7525_c1 | 3300050512 | Bacteria | 9354 |
| 456 | nmdc:mga0n895_792088_c1 | 3300050512 | Bacteria | 939 |
| 457 | nmdc:mga0rr50_882059_c1 | 3300050513 | Bacteria | 763 |
| 458 | nmdc:mga08x19_104580_c1 | 3300050514 | Bacteria | 1882 |
| 459 | nmdc:mga08x19_243317_c1 | 3300050514 | Bacteria | 1241 |
| 460 | nmdc:mga0a205_414_c1 | 3300050515 | Bacteria | 32806 |
| 461 | Ga0495601_0007629 | 3300053077 | Bacteria | 6354 |
| 462 | Ga0495619_0026960 | 3300053085 | Unclassified | 3700 |
| 463 | Ga0500644_0049497 | 3300053088 | Bacteria | 1435 |
| 464 | Ga0500646_0009525 | 3300053090 | Bacteria | 2487 |
| 465 | Ga0500651_0017406 | 3300053093 | Bacteria | 4434 |
| 466 | Ga0500641_0242251 | 3300053096 | Unclassified | 759 |
| 467 | Ga0500555_005786 | 3300053103 | Plasmid | 3510 |
| 468 | Ga0500595_000784 | 3300053119 | Bacteria | 18541 |
| 469 | Ga0500642_0002621 | 3300053130 | Bacteria | 5315 |
| 470 | Ga0500658_0194470 | 3300053134 | Bacteria | 926 |
| 471 | Ga0500658_0401285 | 3300053134 | Bacteria | 627 |
| 472 | Ga0500574_003386 | 3300053141 | Bacteria | 2810 |
| 473 | Ga0500588_0011787 | 3300053146 | Bacteria | 2150 |
| 474 | Ga0500588_0296176 | 3300053146 | Bacteria | 612 |
| 475 | Ga0500604_0004582 | 3300053151 | Bacteria | 3662 |
| 476 | Ga0500616_0002864 | 3300053153 | Bacteria | 13839 |
| 477 | Ga0500622_0004680 | 3300053156 | Bacteria | 8466 |
| 478 | Ga0500622_0009288 | 3300053156 | Bacteria | 5451 |
| 479 | Ga0500627_0437493 | 3300053158 | Unclassified | 552 |
| 480 | Ga0500645_128025 | 3300053730 | Unclassified | 706 |
| 481 | Ga0590075_078144 | 3300059424 | Bacteria | 857 |
| 482 | Ga0501082_0030304 | 3300060353 | Bacteria | 4663 |
| 483 | Ga0530510_0121112 | 3300061734 | Bacteria | 1921 |
| 484 | Ga0530510_0182493 | 3300061734 | Unclassified | 1556 |
| 485 | Ga0530510_0306611 | 3300061734 | Bacteria | 1189 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300027378 | Ga0209981_1068169 | Ga0209981_10681692 | 128 |
| 2 | 3300003215 | JGI25153J46596_10000042 | JGI25153J46596_10000042118 | 139 |
| 3 | 3300003215 | JGI25153J46596_10000087 | JGI25153J46596_1000008712 | 139 |
| 4 | 3300003323 | rootH1_10189496 | rootH1_101894963 | 139 |
| 5 | 3300003659 | JGI25404J52841_10051555 | JGI25404J52841_100515551 | 139 |
| 6 | 3300003659 | JGI25404J52841_10059408 | JGI25404J52841_100594081 | 139 |
| 7 | 3300003659 | JGI25404J52841_10065322 | JGI25404J52841_100653221 | 139 |
| 8 | 3300005290 | Ga0065712_10045287 | Ga0065712_100452873 | 139 |
| 9 | 3300005295 | Ga0065707_10684209 | Ga0065707_106842091 | 139 |
| 10 | 3300005329 | Ga0070683_100069980 | Ga0070683_1000699802 | 139 |
| 11 | 3300005337 | Ga0070682_100081085 | Ga0070682_1000810852 | 139 |
| 12 | 3300005344 | Ga0070661_100003460 | Ga0070661_1000034607 | 139 |
| 13 | 3300005347 | Ga0070668_100046941 | Ga0070668_1000469414 | 139 |
| 14 | 3300005347 | Ga0070668_100865001 | Ga0070668_1008650011 | 139 |
| 15 | 3300005354 | Ga0070675_100008175 | Ga0070675_1000081756 | 139 |
| 16 | 3300005354 | Ga0070675_100710753 | Ga0070675_1007107532 | 139 |
| 17 | 3300005355 | Ga0070671_100144517 | Ga0070671_1001445172 | 139 |
| 18 | 3300005364 | Ga0070673_100287292 | Ga0070673_1002872923 | 139 |
| 19 | 3300005367 | Ga0070667_100135681 | Ga0070667_1001356814 | 139 |
| 20 | 3300005367 | Ga0070667_100477671 | Ga0070667_1004776712 | 139 |
| 21 | 3300005434 | Ga0070709_10215935 | Ga0070709_102159352 | 139 |
| 22 | 3300005435 | Ga0070714_100000898 | Ga0070714_10000089819 | 139 |
| 23 | 3300005435 | Ga0070714_102193800 | Ga0070714_1021938001 | 139 |
| 24 | 3300005436 | Ga0070713_100006995 | Ga0070713_10000699510 | 139 |
| 25 | 3300005436 | Ga0070713_100170600 | Ga0070713_1001706002 | 139 |
| 26 | 3300005436 | Ga0070713_100247688 | Ga0070713_1002476883 | 139 |
| 27 | 3300005436 | Ga0070713_101413028 | Ga0070713_1014130281 | 139 |
| 28 | 3300005437 | Ga0070710_10140769 | Ga0070710_101407692 | 139 |
| 29 | 3300005437 | Ga0070710_10392289 | Ga0070710_103922891 | 139 |
| 30 | 3300005439 | Ga0070711_100074837 | Ga0070711_1000748375 | 139 |
| 31 | 3300005439 | Ga0070711_100433765 | Ga0070711_1004337652 | 139 |
| 32 | 3300005439 | Ga0070711_100726153 | Ga0070711_1007261532 | 139 |
| 33 | 3300005440 | Ga0070705_100113143 | Ga0070705_1001131432 | 139 |
| 34 | 3300005440 | Ga0070705_100394115 | Ga0070705_1003941152 | 139 |
| 35 | 3300005455 | Ga0070663_100387210 | Ga0070663_1003872102 | 139 |
| 36 | 3300005455 | Ga0070663_100499972 | Ga0070663_1004999722 | 139 |
| 37 | 3300005458 | Ga0070681_10235409 | Ga0070681_102354093 | 139 |
| 38 | 3300005459 | Ga0068867_100291903 | Ga0068867_1002919032 | 139 |
| 39 | 3300005459 | Ga0068867_100463398 | Ga0068867_1004633981 | 139 |
| 40 | 3300005530 | Ga0070679_100918038 | Ga0070679_1009180381 | 139 |
| 41 | 3300005535 | Ga0070684_100079522 | Ga0070684_1000795222 | 139 |
| 42 | 3300005543 | Ga0070672_100099258 | Ga0070672_1000992586 | 139 |
| 43 | 3300005545 | Ga0070695_100343052 | Ga0070695_1003430522 | 139 |
| 44 | 3300005546 | Ga0070696_100638846 | Ga0070696_1006388461 | 139 |
| 45 | 3300005546 | Ga0070696_100970524 | Ga0070696_1009705241 | 139 |
| 46 | 3300005548 | Ga0070665_100000214 | Ga0070665_10000021417 | 139 |
| 47 | 3300005548 | Ga0070665_100143122 | Ga0070665_1001431223 | 139 |
| 48 | 3300005549 | Ga0070704_100013495 | Ga0070704_1000134955 | 139 |
| 49 | 3300005549 | Ga0070704_100014250 | Ga0070704_1000142502 | 139 |
| 50 | 3300005563 | Ga0068855_100049732 | Ga0068855_1000497326 | 139 |
| 51 | 3300005563 | Ga0068855_101983718 | Ga0068855_1019837182 | 139 |
| 52 | 3300005564 | Ga0070664_100000592 | Ga0070664_10000059214 | 139 |
| 53 | 3300005564 | Ga0070664_102146728 | Ga0070664_1021467281 | 139 |
| 54 | 3300005577 | Ga0068857_100051030 | Ga0068857_1000510302 | 139 |
| 55 | 3300005577 | Ga0068857_100180709 | Ga0068857_1001807091 | 139 |
| 56 | 3300005577 | Ga0068857_100386110 | Ga0068857_1003861102 | 139 |
| 57 | 3300005578 | Ga0068854_100345139 | Ga0068854_1003451393 | 139 |
| 58 | 3300005614 | Ga0068856_100066992 | Ga0068856_1000669923 | 139 |
| 59 | 3300005614 | Ga0068856_100410110 | Ga0068856_1004101103 | 139 |
| 60 | 3300005616 | Ga0068852_100005510 | Ga0068852_1000055106 | 139 |
| 61 | 3300005617 | Ga0068859_100001660 | Ga0068859_10000166023 | 139 |
| 62 | 3300005617 | Ga0068859_100035690 | Ga0068859_1000356906 | 139 |
| 63 | 3300005617 | Ga0068859_100221236 | Ga0068859_1002212363 | 139 |
| 64 | 3300005617 | Ga0068859_100870515 | Ga0068859_1008705152 | 139 |
| 65 | 3300005618 | Ga0068864_100364142 | Ga0068864_1003641422 | 139 |
| 66 | 3300005618 | Ga0068864_102521911 | Ga0068864_1025219111 | 139 |
| 67 | 3300005834 | Ga0068851_10108475 | Ga0068851_101084752 | 139 |
| 68 | 3300005841 | Ga0068863_100024525 | Ga0068863_1000245255 | 139 |
| 69 | 3300005841 | Ga0068863_100080142 | Ga0068863_1000801423 | 139 |
| 70 | 3300005843 | Ga0068860_100225007 | Ga0068860_1002250072 | 139 |
| 71 | 3300005843 | Ga0068860_100360367 | Ga0068860_1003603672 | 139 |
| 72 | 3300005843 | Ga0068860_100744303 | Ga0068860_1007443032 | 139 |
| 73 | 3300005843 | Ga0068860_100960165 | Ga0068860_1009601652 | 139 |
| 74 | 3300005843 | Ga0068860_102070758 | Ga0068860_1020707582 | 139 |
| 75 | 3300005844 | Ga0068862_100000111 | Ga0068862_10000011180 | 139 |
| 76 | 3300005844 | Ga0068862_100004384 | Ga0068862_1000043845 | 139 |
| 77 | 3300005844 | Ga0068862_100142366 | Ga0068862_1001423663 | 139 |
| 78 | 3300005844 | Ga0068862_100571957 | Ga0068862_1005719572 | 139 |
| 79 | 3300005844 | Ga0068862_101017558 | Ga0068862_1010175582 | 139 |
| 80 | 3300005937 | Ga0081455_10003088 | Ga0081455_1000308810 | 139 |
| 81 | 3300005937 | Ga0081455_10013865 | Ga0081455_100138651 | 139 |
| 82 | 3300005937 | Ga0081455_10026737 | Ga0081455_100267376 | 139 |
| 83 | 3300005981 | Ga0081538_10031834 | Ga0081538_100318342 | 139 |
| 84 | 3300005983 | Ga0081540_1000176 | Ga0081540_100017648 | 139 |
| 85 | 3300005983 | Ga0081540_1000206 | Ga0081540_10002064 | 139 |
| 86 | 3300006028 | Ga0070717_10054387 | Ga0070717_100543872 | 139 |
| 87 | 3300006028 | Ga0070717_10660138 | Ga0070717_106601382 | 139 |
| 88 | 3300006038 | Ga0075365_10012815 | Ga0075365_100128155 | 139 |
| 89 | 3300006042 | Ga0075368_10017357 | Ga0075368_100173573 | 139 |
| 90 | 3300006042 | Ga0075368_10066960 | Ga0075368_100669601 | 139 |
| 91 | 3300006048 | Ga0075363_100040505 | Ga0075363_1000405052 | 139 |
| 92 | 3300006051 | Ga0075364_10836322 | Ga0075364_108363222 | 139 |
| 93 | 3300006163 | Ga0070715_10007624 | Ga0070715_100076243 | 139 |
| 94 | 3300006173 | Ga0070716_100046759 | Ga0070716_1000467592 | 139 |
| 95 | 3300006175 | Ga0070712_100059694 | Ga0070712_1000596941 | 139 |
| 96 | 3300006175 | Ga0070712_100066403 | Ga0070712_1000664034 | 139 |
| 97 | 3300006178 | Ga0075367_10079329 | Ga0075367_100793292 | 139 |
| 98 | 3300006178 | Ga0075367_10107038 | Ga0075367_101070383 | 139 |
| 99 | 3300006178 | Ga0075367_10237347 | Ga0075367_102373472 | 139 |
| 100 | 3300006178 | Ga0075367_10498227 | Ga0075367_104982271 | 139 |
| 101 | 3300006195 | Ga0075366_10184710 | Ga0075366_101847102 | 139 |
| 102 | 3300006195 | Ga0075366_10581863 | Ga0075366_105818631 | 139 |
| 103 | 3300006237 | Ga0097621_100784966 | Ga0097621_1007849661 | 139 |
| 104 | 3300006353 | Ga0075370_10076079 | Ga0075370_100760793 | 139 |
| 105 | 3300006358 | Ga0068871_100466686 | Ga0068871_1004666862 | 139 |
| 106 | 3300006844 | Ga0075428_100032484 | Ga0075428_1000324848 | 139 |
| 107 | 3300006844 | Ga0075428_100118791 | Ga0075428_1001187912 | 139 |
| 108 | 3300006847 | Ga0075431_100050120 | Ga0075431_1000501207 | 139 |
| 109 | 3300006847 | Ga0075431_101300000 | Ga0075431_1013000001 | 139 |
| 110 | 3300006852 | Ga0075433_10000194 | Ga0075433_1000019420 | 139 |
| 111 | 3300006852 | Ga0075433_10170867 | Ga0075433_101708672 | 139 |
| 112 | 3300006871 | Ga0075434_100001852 | Ga0075434_10000185210 | 139 |
| 113 | 3300006871 | Ga0075434_100424471 | Ga0075434_1004244712 | 139 |
| 114 | 3300006880 | Ga0075429_100513637 | Ga0075429_1005136372 | 139 |
| 115 | 3300006914 | Ga0075436_100080180 | Ga0075436_1000801803 | 139 |
| 116 | 3300006931 | Ga0097620_100001660 | Ga0097620_10000166023 | 139 |
| 117 | 3300006931 | Ga0097620_100035690 | Ga0097620_1000356906 | 139 |
| 118 | 3300006931 | Ga0097620_100221250 | Ga0097620_1002212503 | 139 |
| 119 | 3300006931 | Ga0097620_100870492 | Ga0097620_1008704921 | 139 |
| 120 | 3300006931 | Ga0097620_102275728 | Ga0097620_1022757282 | 139 |
| 121 | 3300007076 | Ga0075435_100449761 | Ga0075435_1004497612 | 139 |
| 122 | 3300007076 | Ga0075435_100876395 | Ga0075435_1008763952 | 139 |
| 123 | 3300009093 | Ga0105240_10191843 | Ga0105240_101918431 | 139 |
| 124 | 3300009093 | Ga0105240_11371042 | Ga0105240_113710421 | 139 |
| 125 | 3300009094 | Ga0111539_10002283 | Ga0111539_1000228333 | 139 |
| 126 | 3300009094 | Ga0111539_10025340 | Ga0111539_100253404 | 139 |
| 127 | 3300009101 | Ga0105247_10008908 | Ga0105247_100089082 | 139 |
| 128 | 3300009101 | Ga0105247_10032069 | Ga0105247_100320694 | 139 |
| 129 | 3300009147 | Ga0114129_10043906 | Ga0114129_100439062 | 139 |
| 130 | 3300009147 | Ga0114129_10343634 | Ga0114129_103436343 | 139 |
| 131 | 3300009147 | Ga0114129_11457337 | Ga0114129_114573372 | 139 |
| 132 | 3300009148 | Ga0105243_10638493 | Ga0105243_106384931 | 139 |
| 133 | 3300009174 | Ga0105241_10065958 | Ga0105241_100659584 | 139 |
| 134 | 3300009177 | Ga0105248_11052307 | Ga0105248_110523072 | 139 |
| 135 | 3300009545 | Ga0105237_10165318 | Ga0105237_101653182 | 139 |
| 136 | 3300009545 | Ga0105237_10537916 | Ga0105237_105379162 | 139 |
| 137 | 3300009545 | Ga0105237_10902502 | Ga0105237_109025022 | 139 |
| 138 | 3300009545 | Ga0105237_11963797 | Ga0105237_119637971 | 139 |
| 139 | 3300009551 | Ga0105238_10457615 | Ga0105238_104576151 | 139 |
| 140 | 3300009553 | Ga0105249_10295733 | Ga0105249_102957332 | 139 |
| 141 | 3300009553 | Ga0105249_10473832 | Ga0105249_104738322 | 139 |
| 142 | 3300009553 | Ga0105249_10526827 | Ga0105249_105268272 | 139 |
| 143 | 3300010375 | Ga0105239_10698687 | Ga0105239_106986872 | 139 |
| 144 | 3300010375 | Ga0105239_10878772 | Ga0105239_108787721 | 139 |
| 145 | 3300010375 | Ga0105239_10905063 | Ga0105239_109050632 | 139 |
| 146 | 3300013104 | Ga0157370_10658385 | Ga0157370_106583853 | 139 |
| 147 | 3300013105 | Ga0157369_10088622 | Ga0157369_100886222 | 139 |
| 148 | 3300013306 | Ga0163162_10191238 | Ga0163162_101912382 | 139 |
| 149 | 3300013306 | Ga0163162_10310989 | Ga0163162_103109892 | 139 |
| 150 | 3300013307 | Ga0157372_11037903 | Ga0157372_110379032 | 139 |
| 151 | 3300014325 | Ga0163163_10381546 | Ga0163163_103815462 | 139 |
| 152 | 3300014326 | Ga0157380_10003693 | Ga0157380_1000369310 | 139 |
| 153 | 3300014326 | Ga0157380_10017141 | Ga0157380_100171417 | 139 |
| 154 | 3300014968 | Ga0157379_10271455 | Ga0157379_102714552 | 139 |
| 155 | 3300014969 | Ga0157376_10189280 | Ga0157376_101892801 | 139 |
| 156 | 3300015261 | Ga0182006_1009171 | Ga0182006_10091711 | 139 |
| 157 | 3300015262 | Ga0182007_10015716 | Ga0182007_100157162 | 139 |
| 158 | 3300015265 | Ga0182005_1003414 | Ga0182005_10034144 | 139 |
| 159 | 3300020082 | Ga0206353_11371965 | Ga0206353_113719651 | 139 |
| 160 | 3300020082 | Ga0206353_11914112 | Ga0206353_119141123 | 139 |
| 161 | 3300025297 | Ga0209758_1000110 | Ga0209758_100011086 | 139 |
| 162 | 3300025297 | Ga0209758_1079864 | Ga0209758_10798642 | 139 |
| 163 | 3300025303 | Ga0209051_1063221 | Ga0209051_10632212 | 139 |
| 164 | 3300025304 | Ga0209257_1000376 | Ga0209257_100037633 | 139 |
| 165 | 3300025304 | Ga0209257_1028165 | Ga0209257_10281653 | 139 |
| 166 | 3300025321 | Ga0207656_10193782 | Ga0207656_101937822 | 139 |
| 167 | 3300025898 | Ga0207692_10005506 | Ga0207692_100055067 | 139 |
| 168 | 3300025898 | Ga0207692_10082562 | Ga0207692_100825621 | 139 |
| 169 | 3300025900 | Ga0207710_10008446 | Ga0207710_100084462 | 139 |
| 170 | 3300025905 | Ga0207685_10009355 | Ga0207685_100093552 | 139 |
| 171 | 3300025906 | Ga0207699_10015504 | Ga0207699_100155046 | 139 |
| 172 | 3300025906 | Ga0207699_10103218 | Ga0207699_101032182 | 139 |
| 173 | 3300025913 | Ga0207695_10036237 | Ga0207695_100362375 | 139 |
| 174 | 3300025914 | Ga0207671_10038070 | Ga0207671_100380702 | 139 |
| 175 | 3300025915 | Ga0207693_10065925 | Ga0207693_100659252 | 139 |
| 176 | 3300025915 | Ga0207693_10090806 | Ga0207693_100908064 | 139 |
| 177 | 3300025915 | Ga0207693_10579821 | Ga0207693_105798212 | 139 |
| 178 | 3300025916 | Ga0207663_10015774 | Ga0207663_100157746 | 139 |
| 179 | 3300025916 | Ga0207663_10156242 | Ga0207663_101562422 | 139 |
| 180 | 3300025916 | Ga0207663_10246221 | Ga0207663_102462212 | 139 |
| 181 | 3300025920 | Ga0207649_10017334 | Ga0207649_100173343 | 139 |
| 182 | 3300025924 | Ga0207694_10413517 | Ga0207694_104135172 | 139 |
| 183 | 3300025926 | Ga0207659_10106465 | Ga0207659_101064652 | 139 |
| 184 | 3300025928 | Ga0207700_10012827 | Ga0207700_100128272 | 139 |
| 185 | 3300025928 | Ga0207700_10032040 | Ga0207700_100320407 | 139 |
| 186 | 3300025929 | Ga0207664_10016194 | Ga0207664_100161942 | 139 |
| 187 | 3300025929 | Ga0207664_10027919 | Ga0207664_100279195 | 139 |
| 188 | 3300025929 | Ga0207664_10034644 | Ga0207664_100346444 | 139 |
| 189 | 3300025931 | Ga0207644_10173969 | Ga0207644_101739692 | 139 |
| 190 | 3300025935 | Ga0207709_10150875 | Ga0207709_101508753 | 139 |
| 191 | 3300025939 | Ga0207665_10082889 | Ga0207665_100828893 | 139 |
| 192 | 3300025940 | Ga0207691_10306371 | Ga0207691_103063713 | 139 |
| 193 | 3300025942 | Ga0207689_10060514 | Ga0207689_100605142 | 139 |
| 194 | 3300025944 | Ga0207661_10282909 | Ga0207661_102829093 | 139 |
| 195 | 3300025944 | Ga0207661_10617909 | Ga0207661_106179092 | 139 |
| 196 | 3300025945 | Ga0207679_10000806 | Ga0207679_100008064 | 139 |
| 197 | 3300025949 | Ga0207667_10163776 | Ga0207667_101637763 | 139 |
| 198 | 3300025949 | Ga0207667_11485934 | Ga0207667_114859341 | 139 |
| 199 | 3300025960 | Ga0207651_10060253 | Ga0207651_100602531 | 139 |
| 200 | 3300025961 | Ga0207712_10005111 | Ga0207712_100051115 | 139 |
| 201 | 3300025961 | Ga0207712_10018982 | Ga0207712_100189822 | 139 |
| 202 | 3300025972 | Ga0207668_10011730 | Ga0207668_100117305 | 139 |
| 203 | 3300025972 | Ga0207668_10848900 | Ga0207668_108489002 | 139 |
| 204 | 3300025986 | Ga0207658_10700832 | Ga0207658_107008322 | 139 |
| 205 | 3300026067 | Ga0207678_10540711 | Ga0207678_105407112 | 139 |
| 206 | 3300026078 | Ga0207702_10061689 | Ga0207702_100616892 | 139 |
| 207 | 3300026078 | Ga0207702_10610695 | Ga0207702_106106953 | 139 |
| 208 | 3300026088 | Ga0207641_10717600 | Ga0207641_107176002 | 139 |
| 209 | 3300026116 | Ga0207674_10059123 | Ga0207674_100591233 | 139 |
| 210 | 3300026118 | Ga0207675_102384503 | Ga0207675_1023845032 | 139 |
| 211 | 3300026142 | Ga0207698_10003823 | Ga0207698_100038236 | 139 |
| 212 | 3300026142 | Ga0207698_10121734 | Ga0207698_101217343 | 139 |
| 213 | 3300027866 | Ga0209813_10008338 | Ga0209813_100083383 | 139 |
| 214 | 3300027866 | Ga0209813_10391229 | Ga0209813_103912291 | 139 |
| 215 | 3300027876 | Ga0209974_10044570 | Ga0209974_100445701 | 139 |
| 216 | 3300027907 | Ga0207428_10013153 | Ga0207428_100131533 | 139 |
| 217 | 3300027907 | Ga0207428_10027853 | Ga0207428_100278534 | 139 |
| 218 | 3300028379 | Ga0268266_10000001 | Ga0268266_10000001761 | 139 |
| 219 | 3300028380 | Ga0268265_10000122 | Ga0268265_1000012281 | 139 |
| 220 | 3300028380 | Ga0268265_10055740 | Ga0268265_100557404 | 139 |
| 221 | 3300028380 | Ga0268265_10120873 | Ga0268265_101208732 | 139 |
| 222 | 3300028380 | Ga0268265_10202760 | Ga0268265_102027602 | 139 |
| 223 | 3300028380 | Ga0268265_10800775 | Ga0268265_108007751 | 139 |
| 224 | 3300028380 | Ga0268265_10929941 | Ga0268265_109299412 | 139 |
| 225 | 3300028381 | Ga0268264_10037330 | Ga0268264_100373302 | 139 |
| 226 | 3300028381 | Ga0268264_10043422 | Ga0268264_100434222 | 139 |
| 227 | 3300028381 | Ga0268264_10096365 | Ga0268264_100963654 | 139 |
| 228 | 3300028381 | Ga0268264_10462532 | Ga0268264_104625322 | 139 |
| 229 | 3300031456 | Ga0307513_10315270 | Ga0307513_103152702 | 139 |
| 230 | 3300031548 | Ga0307408_100200922 | Ga0307408_1002009222 | 139 |
| 231 | 3300031616 | Ga0307508_10141165 | Ga0307508_101411652 | 139 |
| 232 | 3300031665 | Ga0316575_10218719 | Ga0316575_102187191 | 139 |
| 233 | 3300031731 | Ga0307405_11022237 | Ga0307405_110222371 | 139 |
| 234 | 3300031901 | Ga0307406_10008281 | Ga0307406_100082812 | 139 |
| 235 | 3300031901 | Ga0307406_10745543 | Ga0307406_107455431 | 139 |
| 236 | 3300031903 | Ga0307407_10822962 | Ga0307407_108229621 | 139 |
| 237 | 3300032002 | Ga0307416_101292221 | Ga0307416_1012922212 | 139 |
| 238 | 3300032005 | Ga0307411_10519695 | Ga0307411_105196952 | 139 |
| 239 | 3300032126 | Ga0307415_100471331 | Ga0307415_1004713312 | 139 |
| 240 | 3300034817 | Ga0373948_0046169 | Ga0373948_0046169_471_908 | 139 |
| 241 | 3300034957 | Ga0373938_0021202 | Ga0373938_0021202_687_1124 | 139 |
| 242 | 3300035086 | Ga0373934_0109434 | Ga0373934_0109434_172_609 | 139 |
| 243 | 3300035088 | Ga0373940_0008123 | Ga0373940_0008123_488_925 | 139 |
| 244 | 3300035089 | Ga0373944_0393705 | Ga0373944_0393705_80_517 | 139 |
| 245 | 3300035090 | Ga0373949_0059211 | Ga0373949_0059211_361_798 | 139 |
| 246 | 3300035092 | Ga0373952_0005051 | Ga0373952_0005051_466_903 | 139 |
| 247 | 3300035111 | Ga0373923_0050254 | Ga0373923_0050254_211_648 | 139 |
| 248 | 3300035112 | Ga0373932_0053615 | Ga0373932_0053615_733_1170 | 139 |
| 249 | 3300035114 | Ga0373939_0061269 | Ga0373939_0061269_393_830 | 139 |
| 250 | 3300035115 | Ga0373941_0018568 | Ga0373941_0018568_1165_1602 | 139 |
| 251 | 3300035116 | Ga0373945_0220880 | Ga0373945_0220880_146_583 | 139 |
| 252 | 3300035171 | Ga0373946_0059231 | Ga0373946_0059231_749_1186 | 139 |
| 253 | 3300035172 | Ga0373955_0796288 | Ga0373955_0796288_114_551 | 139 |
| 254 | 3300035207 | Ga0373942_0028632 | Ga0373942_0028632_954_1391 | 139 |
| 255 | 3300035691 | Ga0373931_0019972 | Ga0373931_0019972_2416_2853 | 139 |
| 256 | 3300035691 | Ga0373931_0411483 | Ga0373931_0411483_22_450 | 139 |
| 257 | 3300035691 | Ga0373931_0742030 | Ga0373931_0742030_189_632 | 139 |
| 258 | 3300035695 | Ga0373927_0817222 | Ga0373927_0817222_101_538 | 139 |
| 259 | 3300035725 | Ga0373947_0013512 | Ga0373947_0013512_749_1186 | 139 |
| 260 | 3300037068 | Ga0373925_0096777 | Ga0373925_0096777_1084_1521 | 139 |
| 261 | 3300037466 | Ga0395898_0188629 | Ga0395898_0188629_549_974 | 139 |
| 262 | 3300037471 | Ga0395905_0207552 | Ga0395905_0207552_1291_1722 | 139 |
| 263 | 3300037471 | Ga0395905_0295494 | Ga0395905_0295494_211_636 | 139 |
| 264 | 3300038443 | Ga0395901_1173879 | Ga0395901_1173879_157_582 | 139 |
| 265 | 3300038726 | Ga0400490_40065 | Ga0400490_40065_172_603 | 139 |
| 266 | 3300038742 | Ga0400486_17470 | Ga0400486_17470_642_1073 | 139 |
| 267 | 3300039110 | Ga0400487_36289 | Ga0400487_36289_483_914 | 139 |
| 268 | 3300041404 | Ga0439436_0002841 | Ga0439436_0002841_3441_3866 | 139 |
| 269 | 3300041404 | Ga0439436_0104068 | Ga0439436_0104068_100_528 | 139 |
| 270 | 3300041406 | Ga0439439_0019903 | Ga0439439_0019903_662_1087 | 139 |
| 271 | 3300041407 | Ga0439447_000252 | Ga0439447_000252_15124_15549 | 139 |
| 272 | 3300041410 | Ga0439461_0106357 | Ga0439461_0106357_140_568 | 139 |
| 273 | 3300041411 | Ga0439466_0248238 | Ga0439466_0248238_92_517 | 139 |
| 274 | 3300041413 | Ga0439465_0002263 | Ga0439465_0002263_3950_4384 | 139 |
| 275 | 3300041413 | Ga0439465_0049298 | Ga0439465_0049298_209_634 | 139 |
| 276 | 3300041997 | Ga0439431_0052576 | Ga0439431_0052576_465_893 | 139 |
| 277 | 3300042004 | Ga0439445_0001103 | Ga0439445_0001103_5323_5757 | 139 |
| 278 | 3300042004 | Ga0439445_0054079 | Ga0439445_0054079_414_839 | 139 |
| 279 | 3300042007 | Ga0439449_0000144 | Ga0439449_0000144_5700_6134 | 139 |
| 280 | 3300042122 | Ga0450920_000175 | Ga0450920_000175_2234_2665 | 139 |
| 281 | 3300042125 | Ga0450923_030509 | Ga0450923_030509_219_647 | 139 |
| 282 | 3300042125 | Ga0450923_090973 | Ga0450923_090973_205_639 | 139 |
| 283 | 3300042131 | Ga0450894_007193 | Ga0450894_007193_798_1229 | 139 |
| 284 | 3300042132 | Ga0450895_002219 | Ga0450895_002219_150_581 | 139 |
| 285 | 3300042133 | Ga0450896_000068 | Ga0450896_000068_871_1302 | 139 |
| 286 | 3300042134 | Ga0450898_071300 | Ga0450898_071300_182_613 | 139 |
| 287 | 3300042135 | Ga0450899_023409 | Ga0450899_023409_37_468 | 139 |
| 288 | 3300042145 | Ga0450906_018196 | Ga0450906_018196_152_583 | 139 |
| 289 | 3300042146 | Ga0450907_003351 | Ga0450907_003351_1539_1970 | 139 |
| 290 | 3300042184 | Ga0450908_000377 | Ga0450908_000377_3243_3674 | 139 |
| 291 | 3300042531 | Ga0450918_001961 | Ga0450918_001961_1772_2203 | 139 |
| 292 | 3300042876 | Ga0451577_1446701 | Ga0451577_1446701_90_509 | 139 |
| 293 | 3300044656 | Ga0466969_0001007 | Ga0466969_0001007_14613_15077 | 139 |
| 294 | 3300044656 | Ga0466969_0032774 | Ga0466969_0032774_2018_2446 | 139 |
| 295 | 3300044656 | Ga0466969_0057037 | Ga0466969_0057037_1014_1457 | 139 |
| 296 | 3300044656 | Ga0466969_0076815 | Ga0466969_0076815_1003_1434 | 139 |
| 297 | 3300044683 | Ga0466965_0617391 | Ga0466965_0617391_157_585 | 139 |
| 298 | 3300044684 | Ga0466966_0004313 | Ga0466966_0004313_3437_3865 | 139 |
| 299 | 3300044684 | Ga0466966_0005540 | Ga0466966_0005540_5071_5502 | 139 |
| 300 | 3300044693 | Ga0466961_0000044 | Ga0466961_0000044_68103_68534 | 139 |
| 301 | 3300044693 | Ga0466961_0473199 | Ga0466961_0473199_198_626 | 139 |
| 302 | 3300044693 | Ga0466961_0545513 | Ga0466961_0545513_127_591 | 139 |
| 303 | 3300044765 | Ga0466970_0242443 | Ga0466970_0242443_33_497 | 139 |
| 304 | 3300044901 | Ga0466960_0015021 | Ga0466960_0015021_2074_2553 | 139 |
| 305 | 3300045049 | Ga0466959_0005294 | Ga0466959_0005294_2069_2500 | 139 |
| 306 | 3300045049 | Ga0466959_0028106 | Ga0466959_0028106_1002_1466 | 139 |
| 307 | 3300045049 | Ga0466959_0116270 | Ga0466959_0116270_1200_1643 | 139 |
| 308 | 3300045049 | Ga0466959_0158424 | Ga0466959_0158424_411_854 | 139 |
| 309 | 3300045049 | Ga0466959_0162325 | Ga0466959_0162325_1084_1512 | 139 |
| 310 | 3300045049 | Ga0466959_0339599 | Ga0466959_0339599_173_622 | 139 |
| 311 | 3300045051 | Ga0451576_0123198 | Ga0451576_0123198_70_489 | 139 |
| 312 | 3300045051 | Ga0451576_1031097 | Ga0451576_1031097_204_629 | 139 |
| 313 | 3300045836 | Ga0466958_0285604 | Ga0466958_0285604_261_704 | 139 |
| 314 | 3300046454 | Ga0495592_0014500 | Ga0495592_0014500_807_1232 | 139 |
| 315 | 3300046454 | Ga0495592_0150615 | Ga0495592_0150615_140_577 | 139 |
| 316 | 3300046455 | Ga0495603_0074512 | Ga0495603_0074512_243_680 | 139 |
| 317 | 3300046459 | Ga0495629_0226640 | Ga0495629_0226640_616_1053 | 139 |
| 318 | 3300046460 | Ga0495638_0273512 | Ga0495638_0273512_194_613 | 139 |
| 319 | 3300046461 | Ga0495641_0298953 | Ga0495641_0298953_189_626 | 139 |
| 320 | 3300046462 | Ga0495651_0002947 | Ga0495651_0002947_6109_6534 | 139 |
| 321 | 3300046462 | Ga0495651_0202503 | Ga0495651_0202503_88_525 | 139 |
| 322 | 3300046463 | Ga0495653_0059662 | Ga0495653_0059662_1296_1721 | 139 |
| 323 | 3300046473 | Ga0495582_0021334 | Ga0495582_0021334_1550_1987 | 139 |
| 324 | 3300046475 | Ga0495639_0073943 | Ga0495639_0073943_250_687 | 139 |
| 325 | 3300046477 | Ga0495664_0203553 | Ga0495664_0203553_632_1069 | 139 |
| 326 | 3300046511 | Ga0495608_0000975 | Ga0495608_0000975_14379_14804 | 139 |
| 327 | 3300046511 | Ga0495608_0075479 | Ga0495608_0075479_1379_1816 | 139 |
| 328 | 3300046514 | Ga0495618_0004462 | Ga0495618_0004462_3435_3860 | 139 |
| 329 | 3300046516 | Ga0495628_0200701 | Ga0495628_0200701_642_1067 | 139 |
| 330 | 3300046516 | Ga0495628_0384086 | Ga0495628_0384086_447_884 | 139 |
| 331 | 3300046517 | Ga0495630_0129583 | Ga0495630_0129583_1063_1500 | 139 |
| 332 | 3300046529 | Ga0495652_0032648 | Ga0495652_0032648_2357_2782 | 139 |
| 333 | 3300046529 | Ga0495652_0126335 | Ga0495652_0126335_435_872 | 139 |
| 334 | 3300046529 | Ga0495652_0189699 | Ga0495652_0189699_928_1353 | 139 |
| 335 | 3300046531 | Ga0495665_0048469 | Ga0495665_0048469_550_987 | 139 |
| 336 | 3300046533 | Ga0495640_0023492 | Ga0495640_0023492_3529_3966 | 139 |
| 337 | 3300046536 | Ga0495587_0249132 | Ga0495587_0249132_115_552 | 139 |
| 338 | 3300046543 | Ga0495645_0123050 | Ga0495645_0123050_506_988 | 139 |
| 339 | 3300046543 | Ga0495645_0201038 | Ga0495645_0201038_144_569 | 139 |
| 340 | 3300046543 | Ga0495645_0210479 | Ga0495645_0210479_711_1136 | 139 |
| 341 | 3300046557 | Ga0495622_0060721 | Ga0495622_0060721_147_572 | 139 |
| 342 | 3300046642 | Ga0495634_0089427 | Ga0495634_0089427_816_1253 | 139 |
| 343 | 3300046642 | Ga0495634_0397541 | Ga0495634_0397541_11_436 | 139 |
| 344 | 3300046663 | Ga0495635_0132017 | Ga0495635_0132017_216_653 | 139 |
| 345 | 3300046674 | Ga0495588_0386146 | Ga0495588_0386146_189_626 | 139 |
| 346 | 3300046675 | Ga0495657_0103437 | Ga0495657_0103437_735_1217 | 139 |
| 347 | 3300046675 | Ga0495657_0143108 | Ga0495657_0143108_596_1021 | 139 |
| 348 | 3300046678 | Ga0495599_0025637 | Ga0495599_0025637_2781_3206 | 139 |
| 349 | 3300046679 | Ga0495623_0044564 | Ga0495623_0044564_186_611 | 139 |
| 350 | 3300046680 | Ga0495646_0001775 | Ga0495646_0001775_4782_5207 | 139 |
| 351 | 3300046680 | Ga0495646_0015697 | Ga0495646_0015697_539_964 | 139 |
| 352 | 3300046681 | Ga0495647_0038321 | Ga0495647_0038321_940_1377 | 139 |
| 353 | 3300046683 | Ga0495658_0063141 | Ga0495658_0063141_1313_1750 | 139 |
| 354 | 3300046689 | Ga0495613_0060916 | Ga0495613_0060916_2151_2588 | 139 |
| 355 | 3300046689 | Ga0495613_0165088 | Ga0495613_0165088_722_1159 | 139 |
| 356 | 3300046690 | Ga0495624_0000704 | Ga0495624_0000704_4790_5215 | 139 |
| 357 | 3300046690 | Ga0495624_0020537 | Ga0495624_0020537_304_741 | 139 |
| 358 | 3300046690 | Ga0495624_0058344 | Ga0495624_0058344_576_1013 | 139 |
| 359 | 3300046809 | Ga0495600_0000349 | Ga0495600_0000349_18774_19199 | 139 |
| 360 | 3300046809 | Ga0495600_0086794 | Ga0495600_0086794_954_1391 | 139 |
| 361 | 3300047315 | Ga0495581_0008005 | Ga0495581_0008005_5218_5655 | 139 |
| 362 | 3300047317 | Ga0495604_0090609 | Ga0495604_0090609_27_452 | 139 |
| 363 | 3300047317 | Ga0495604_0202212 | Ga0495604_0202212_309_746 | 139 |
| 364 | 3300047319 | Ga0495674_0050851 | Ga0495674_0050851_2788_3225 | 139 |
| 365 | 3300047321 | Ga0495676_0125193 | Ga0495676_0125193_1316_1753 | 139 |
| 366 | 3300047322 | Ga0495680_0019894 | Ga0495680_0019894_4384_4821 | 139 |
| 367 | 3300047444 | Ga0495675_0280473 | Ga0495675_0280473_148_585 | 139 |
| 368 | 3300047471 | Ga0495684_0028438 | Ga0495684_0028438_2124_2561 | 139 |
| 369 | 3300047673 | Ga0495593_0034781 | Ga0495593_0034781_1240_1677 | 139 |
| 370 | 3300048088 | Ga0495602_0037718 | Ga0495602_0037718_1174_1599 | 139 |
| 371 | 3300048088 | Ga0495602_0045868 | Ga0495602_0045868_1212_1637 | 139 |
| 372 | 3300048089 | Ga0495614_0068738 | Ga0495614_0068738_839_1276 | 139 |
| 373 | 3300048903 | Ga0496100_0084000 | Ga0496100_0084000_1701_2138 | 139 |
| 374 | 3300048906 | Ga0496103_0021211 | Ga0496103_0021211_1638_2075 | 139 |
| 375 | 3300048907 | Ga0496104_0040998 | Ga0496104_0040998_1531_1968 | 139 |
| 376 | 3300048908 | Ga0496105_0019796 | Ga0496105_0019796_2268_2705 | 139 |
| 377 | 3300048909 | Ga0496106_0037461 | Ga0496106_0037461_498_935 | 139 |
| 378 | 3300048910 | Ga0496107_0163533 | Ga0496107_0163533_322_759 | 139 |
| 379 | 3300048911 | Ga0496108_0041919 | Ga0496108_0041919_1457_1894 | 139 |
| 380 | 3300048912 | Ga0496109_0048050 | Ga0496109_0048050_435_872 | 139 |
| 381 | 3300048913 | Ga0496110_0033643 | Ga0496110_0033643_1507_1944 | 139 |
| 382 | 3300048915 | Ga0496112_0149348 | Ga0496112_0149348_197_634 | 139 |
| 383 | 3300048917 | Ga0496114_0040404 | Ga0496114_0040404_3307_3744 | 139 |
| 384 | 3300048918 | Ga0496115_0024377 | Ga0496115_0024377_2733_3170 | 139 |
| 385 | 3300048928 | Ga0496125_0451645 | Ga0496125_0451645_235_660 | 139 |
| 386 | 3300049460 | Ga0495682_0141569 | Ga0495682_0141569_202_627 | 139 |
| 387 | 3300049572 | Ga0501036_0182801 | Ga0501036_0182801_1110_1541 | 139 |
| 388 | 3300049572 | Ga0501036_0295081 | Ga0501036_0295081_846_1280 | 139 |
| 389 | 3300049572 | Ga0501036_0632142 | Ga0501036_0632142_161_607 | 139 |
| 390 | 3300049574 | Ga0501038_0279444 | Ga0501038_0279444_475_903 | 139 |
| 391 | 3300049574 | Ga0501038_0406541 | Ga0501038_0406541_479_913 | 139 |
| 392 | 3300049574 | Ga0501038_0494479 | Ga0501038_0494479_80_526 | 139 |
| 393 | 3300049575 | Ga0501039_0367516 | Ga0501039_0367516_604_1035 | 139 |
| 394 | 3300049575 | Ga0501039_0615012 | Ga0501039_0615012_313_747 | 139 |
| 395 | 3300049576 | Ga0501040_0027876 | Ga0501040_0027876_2222_2656 | 139 |
| 396 | 3300049576 | Ga0501040_0370802 | Ga0501040_0370802_386_820 | 139 |
| 397 | 3300049577 | Ga0501041_0024264 | Ga0501041_0024264_2537_2971 | 139 |
| 398 | 3300049577 | Ga0501041_0503877 | Ga0501041_0503877_214_648 | 139 |
| 399 | 3300049578 | Ga0501042_0110950 | Ga0501042_0110950_323_757 | 139 |
| 400 | 3300049578 | Ga0501042_0111790 | Ga0501042_0111790_1416_1847 | 139 |
| 401 | 3300049579 | Ga0501043_0179460 | Ga0501043_0179460_415_861 | 139 |
| 402 | 3300049580 | Ga0501046_1121199 | Ga0501046_1121199_66_500 | 139 |
| 403 | 3300049581 | Ga0501047_0420513 | Ga0501047_0420513_350_805 | 139 |
| 404 | 3300049583 | Ga0501067_0042772 | Ga0501067_0042772_1469_1915 | 139 |
| 405 | 3300049584 | Ga0501068_0014586 | Ga0501068_0014586_646_1074 | 139 |
| 406 | 3300049585 | Ga0501069_0533669 | Ga0501069_0533669_96_524 | 139 |
| 407 | 3300049586 | Ga0501070_0268262 | Ga0501070_0268262_79_525 | 139 |
| 408 | 3300049587 | Ga0501071_0160766 | Ga0501071_0160766_1001_1435 | 139 |
| 409 | 3300049587 | Ga0501071_0364688 | Ga0501071_0364688_295_723 | 139 |
| 410 | 3300049587 | Ga0501071_0436518 | Ga0501071_0436518_530_985 | 139 |
| 411 | 3300049587 | Ga0501071_1205013 | Ga0501071_1205013_127_561 | 139 |
| 412 | 3300049588 | Ga0501072_0500357 | Ga0501072_0500357_207_641 | 139 |
| 413 | 3300049589 | Ga0501073_0046206 | Ga0501073_0046206_748_1194 | 139 |
| 414 | 3300049589 | Ga0501073_0140782 | Ga0501073_0140782_152_571 | 139 |
| 415 | 3300049591 | Ga0501075_0383611 | Ga0501075_0383611_35_469 | 139 |
| 416 | 3300049591 | Ga0501075_0535463 | Ga0501075_0535463_76_606 | 139 |
| 417 | 3300049592 | Ga0501076_0198620 | Ga0501076_0198620_724_1158 | 139 |
| 418 | 3300049592 | Ga0501076_0209319 | Ga0501076_0209319_1021_1452 | 139 |
| 419 | 3300049592 | Ga0501076_0245353 | Ga0501076_0245353_381_815 | 139 |
| 420 | 3300049592 | Ga0501076_0327423 | Ga0501076_0327423_443_868 | 139 |
| 421 | 3300049592 | Ga0501076_0604941 | Ga0501076_0604941_344_778 | 139 |
| 422 | 3300049593 | Ga0501077_0239754 | Ga0501077_0239754_417_851 | 139 |
| 423 | 3300049593 | Ga0501077_0353855 | Ga0501077_0353855_368_802 | 139 |
| 424 | 3300049743 | Ga0501081_0008332 | Ga0501081_0008332_1585_2019 | 139 |
| 425 | 3300049743 | Ga0501081_0135141 | Ga0501081_0135141_653_1078 | 139 |
| 426 | 3300049744 | Ga0501083_0126662 | Ga0501083_0126662_1149_1595 | 139 |
| 427 | 3300049822 | Ga0501035_0177682 | Ga0501035_0177682_171_602 | 139 |
| 428 | 3300049823 | Ga0501044_0280792 | Ga0501044_0280792_602_1048 | 139 |
| 429 | 3300049823 | Ga0501044_0346466 | Ga0501044_0346466_177_611 | 139 |
| 430 | 3300049824 | Ga0501045_0149428 | Ga0501045_0149428_55_486 | 139 |
| 431 | 3300049824 | Ga0501045_0177485 | Ga0501045_0177485_895_1329 | 139 |
| 432 | 3300049824 | Ga0501045_0323085 | Ga0501045_0323085_617_1051 | 139 |
| 433 | 3300049824 | Ga0501045_0824218 | Ga0501045_0824218_112_561 | 139 |
| 434 | 3300050489 | nmdc:mga03683_91696_c1 | nmdc:mga03683_91696_c1_70_495 | 139 |
| 435 | 3300050490 | nmdc:mga03n38_21733_c1 | nmdc:mga03n38_21733_c1_1567_1992 | 139 |
| 436 | 3300050490 | nmdc:mga03n38_54152_c1 | nmdc:mga03n38_54152_c1_994_1419 | 139 |
| 437 | 3300050491 | nmdc:mga00v17_186519_c1 | nmdc:mga00v17_186519_c1_51_476 | 139 |
| 438 | 3300050491 | nmdc:mga00v17_322648_c1 | nmdc:mga00v17_322648_c1_440_865 | 139 |
| 439 | 3300050492 | nmdc:mga0yw44_33875_c1 | nmdc:mga0yw44_33875_c1_1322_1747 | 139 |
| 440 | 3300050493 | nmdc:mga0k408_225678_c1 | nmdc:mga0k408_225678_c1_558_983 | 139 |
| 441 | 3300050493 | nmdc:mga0k408_422115_c1 | nmdc:mga0k408_422115_c1_289_720 | 139 |
| 442 | 3300050494 | nmdc:mga06z11_44305_c1 | nmdc:mga06z11_44305_c1_1647_2072 | 139 |
| 443 | 3300050494 | nmdc:mga06z11_65387_c1 | nmdc:mga06z11_65387_c1_589_1029 | 139 |
| 444 | 3300050494 | nmdc:mga06z11_9747_c1 | nmdc:mga06z11_9747_c1_259_684 | 139 |
| 445 | 3300050495 | nmdc:mga04h51_24128_c1 | nmdc:mga04h51_24128_c1_108_533 | 139 |
| 446 | 3300050495 | nmdc:mga04h51_4705_c1 | nmdc:mga04h51_4705_c1_1572_1997 | 139 |
| 447 | 3300050496 | nmdc:mga07m45_40401_c1 | nmdc:mga07m45_40401_c1_1184_1609 | 139 |
| 448 | 3300050496 | nmdc:mga07m45_717405_c1 | nmdc:mga07m45_717405_c1_47_472 | 139 |
| 449 | 3300050507 | nmdc:mga05p37_37700_c1 | nmdc:mga05p37_37700_c1_985_1413 | 139 |
| 450 | 3300050507 | nmdc:mga05p37_924432_c1 | nmdc:mga05p37_924432_c1_179_607 | 139 |
| 451 | 3300050508 | nmdc:mga09592_102083_c2 | nmdc:mga09592_102083_c2_186_614 | 139 |
| 452 | 3300050511 | nmdc:mga08y16_1105309_c1 | nmdc:mga08y16_1105309_c1_101_529 | 139 |
| 453 | 3300050511 | nmdc:mga08y16_43891_c1 | nmdc:mga08y16_43891_c1_1617_2057 | 139 |
| 454 | 3300050512 | nmdc:mga0n895_254601_c1 | nmdc:mga0n895_254601_c1_432_857 | 139 |
| 455 | 3300050512 | nmdc:mga0n895_7525_c1 | nmdc:mga0n895_7525_c1_7342_7770 | 139 |
| 456 | 3300050512 | nmdc:mga0n895_792088_c1 | nmdc:mga0n895_792088_c1_349_786 | 139 |
| 457 | 3300050513 | nmdc:mga0rr50_882059_c1 | nmdc:mga0rr50_882059_c1_23_460 | 139 |
| 458 | 3300050514 | nmdc:mga08x19_104580_c1 | nmdc:mga08x19_104580_c1_311_748 | 139 |
| 459 | 3300050514 | nmdc:mga08x19_243317_c1 | nmdc:mga08x19_243317_c1_715_1140 | 139 |
| 460 | 3300050515 | nmdc:mga0a205_414_c1 | nmdc:mga0a205_414_c1_3145_3573 | 139 |
| 461 | 3300053077 | Ga0495601_0007629 | Ga0495601_0007629_127_552 | 139 |
| 462 | 3300053085 | Ga0495619_0026960 | Ga0495619_0026960_816_1253 | 139 |
| 463 | 3300053088 | Ga0500644_0049497 | Ga0500644_0049497_970_1389 | 139 |
| 464 | 3300053090 | Ga0500646_0009525 | Ga0500646_0009525_437_856 | 139 |
| 465 | 3300053093 | Ga0500651_0017406 | Ga0500651_0017406_118_543 | 139 |
| 466 | 3300053096 | Ga0500641_0242251 | Ga0500641_0242251_309_740 | 139 |
| 467 | 3300053103 | Ga0500555_005786 | Ga0500555_005786_1808_2239 | 139 |
| 468 | 3300053119 | Ga0500595_000784 | Ga0500595_000784_12217_12642 | 139 |
| 469 | 3300053130 | Ga0500642_0002621 | Ga0500642_0002621_1388_1807 | 139 |
| 470 | 3300053134 | Ga0500658_0194470 | Ga0500658_0194470_377_802 | 139 |
| 471 | 3300053134 | Ga0500658_0401285 | Ga0500658_0401285_22_441 | 139 |
| 472 | 3300053141 | Ga0500574_003386 | Ga0500574_003386_652_1077 | 139 |
| 473 | 3300053146 | Ga0500588_0011787 | Ga0500588_0011787_790_1209 | 139 |
| 474 | 3300053146 | Ga0500588_0296176 | Ga0500588_0296176_178_600 | 139 |
| 475 | 3300053151 | Ga0500604_0004582 | Ga0500604_0004582_962_1381 | 139 |
| 476 | 3300053153 | Ga0500616_0002864 | Ga0500616_0002864_7779_8201 | 139 |
| 477 | 3300053156 | Ga0500622_0004680 | Ga0500622_0004680_2344_2775 | 139 |
| 478 | 3300053156 | Ga0500622_0009288 | Ga0500622_0009288_3368_3799 | 139 |
| 479 | 3300053158 | Ga0500627_0437493 | Ga0500627_0437493_71_502 | 139 |
| 480 | 3300053730 | Ga0500645_128025 | Ga0500645_128025_62_487 | 139 |
| 481 | 3300059424 | Ga0590075_078144 | Ga0590075_078144_373_828 | 139 |
| 482 | 3300060353 | Ga0501082_0030304 | Ga0501082_0030304_1226_1660 | 139 |
| 483 | 3300061734 | Ga0530510_0121112 | Ga0530510_0121112_1269_1703 | 139 |
| 484 | 3300061734 | Ga0530510_0182493 | Ga0530510_0182493_130_564 | 139 |
| 485 | 3300061734 | Ga0530510_0306611 | Ga0530510_0306611_619_1050 | 139 |
| 486 | iso_pu_bacteria | 2643221573 | 2643880552 | 139 |
| 487 | iso_pu_bacteria | 2643221720 | 2644661120 | 139 |
| 488 | iso_pu_bacteria | 2643221728 | 2644699198 | 139 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7dai-assembly1.cif.gz_A-2 | the crystal structure of a serotonin n-acetyltransferase from oryza sativa | 0.8865 | 2 | 116 |
| 7dai-assembly2.cif.gz_C | the crystal structure of a serotonin n-acetyltransferase from oryza sativa | 0.8831 | 2 | 116 |
| 7daj-assembly1.cif.gz_B | the crystal structure of serotonin n-acetyltransferase in complex with acetyl-coa from oryza sativa | 0.8779 | 2 | 116 |
| 7dal-assembly1.cif.gz_B | the crystal structure of a serotonin n-acetyltransferase in complex with serotonin and acetyl-coa from oryza sativa | 0.8741 | 2 | 116 |
| 1y7r-assembly1.cif.gz_B | 1.7 a crystal structure of protein of unknown function sa2161 from meticillin-resistant staphylococcus aureus, probable acetyltransferase | 0.8629 | 2 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6Z1Y6_51_185_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9172 | 2 | 118 | 3.40.630.30 |
| af_O13738_1_94_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9044 | 42 | 113 | 3.40.630.30 |
| af_A0A0R0JI04_11_132_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8954 | 41 | 118 | 3.40.630.30 |
| af_A0A0R0KKK3_57_216_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8871 | 2 | 118 | 3.40.630.30 |
| af_Q19835_80_302_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8548 | 42 | 118 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0E3PKF5-F1-model_v4 | Acetyltransferase (GNAT) family protein | 0.9756 | 2 | 91 |
GO:0005737
GO:0008080 |
| AF-A0A1C3E8U6-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.9741 | 2 | 120 |
GO:0005737
GO:0008080 |
| AF-A0A2N3AHA4-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.9586 | 37 | 119 |
GO:0005737
GO:0008080 |
| AF-A0A6M0S8I8-F1-model_v4 | N-acetyltransferase | 0.9483 | 2 | 121 |
GO:0016747
|
| AF-A0A7X7NLT9-F1-model_v4 | GNAT family N-acetyltransferase | 0.9437 | 27 | 119 |
GO:0005737
GO:0008080 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar